diff --git a/go.mod b/go.mod index 03c121a..4c9f0a2 100644 --- a/go.mod +++ b/go.mod @@ -1,24 +1,24 @@ module github.com/grandchild/linux_installer -go 1.18 +go 1.20 require ( - github.com/GeertJohan/go.rice v1.0.2 + github.com/GeertJohan/go.rice v1.0.3 github.com/cloudfoundry/jibber_jabber v0.0.0-20151120183258-bcc4c8345a21 - github.com/gotk3/gotk3 v0.6.1 - golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f - golang.org/x/text v0.3.7 + github.com/gotk3/gotk3 v0.6.2 + golang.org/x/sys v0.10.0 + golang.org/x/text v0.11.0 gopkg.in/yaml.v2 v2.4.0 ) require ( github.com/GeertJohan/go.incremental v1.0.0 // indirect github.com/akavel/rsrc v0.8.0 // indirect - github.com/daaku/go.zipexe v1.0.0 // indirect + github.com/daaku/go.zipexe v1.0.2 // indirect github.com/jessevdk/go-flags v1.4.0 // indirect github.com/nkovacs/streamquote v1.0.0 // indirect github.com/onsi/ginkgo v1.16.5 // indirect - github.com/onsi/gomega v1.20.0 // indirect + github.com/onsi/gomega v1.27.8 // indirect github.com/valyala/bytebufferpool v1.0.0 // indirect github.com/valyala/fasttemplate v1.0.1 // indirect ) diff --git a/go.sum b/go.sum index e41b868..5925dd1 100644 --- a/go.sum +++ b/go.sum @@ -1,13 +1,13 @@ github.com/GeertJohan/go.incremental v1.0.0 h1:7AH+pY1XUgQE4Y1HcXYaMqAI0m9yrFqo/jt0CW30vsg= github.com/GeertJohan/go.incremental v1.0.0/go.mod h1:6fAjUhbVuX1KcMD3c8TEgVUqmo4seqhv0i0kdATSkM0= -github.com/GeertJohan/go.rice v1.0.2 h1:PtRw+Tg3oa3HYwiDBZyvOJ8LdIyf6lAovJJtr7YOAYk= -github.com/GeertJohan/go.rice v1.0.2/go.mod h1:af5vUNlDNkCjOZeSGFgIJxDje9qdjsO6hshx0gTmZt4= +github.com/GeertJohan/go.rice v1.0.3 h1:k5viR+xGtIhF61125vCE1cmJ5957RQGXG6dmbaWZSmI= +github.com/GeertJohan/go.rice v1.0.3/go.mod h1:XVdrU4pW00M4ikZed5q56tPf1v2KwnIKeIdc9CBYNt4= github.com/akavel/rsrc v0.8.0 h1:zjWn7ukO9Kc5Q62DOJCcxGpXC18RawVtYAGdz2aLlfw= github.com/akavel/rsrc v0.8.0/go.mod h1:uLoCtb9J+EyAqh+26kdrTgmzRBFPGOolLWKpdxkKq+c= github.com/cloudfoundry/jibber_jabber v0.0.0-20151120183258-bcc4c8345a21 h1:tuijfIjZyjZaHq9xDUh0tNitwXshJpbLkqMOJv4H3do= github.com/cloudfoundry/jibber_jabber v0.0.0-20151120183258-bcc4c8345a21/go.mod h1:po7NpZ/QiTKzBKyrsEAxwnTamCoh8uDk/egRpQ7siIc= -github.com/daaku/go.zipexe v1.0.0 h1:VSOgZtH418pH9L16hC/JrgSNJbbAL26pj7lmD1+CGdY= -github.com/daaku/go.zipexe v1.0.0/go.mod h1:z8IiR6TsVLEYKwXAoE/I+8ys/sDkgTzSL0CLnGVd57E= +github.com/daaku/go.zipexe v1.0.2 h1:Zg55YLYTr7M9wjKn8SY/WcpuuEi+kR2u4E8RhvpyXmk= +github.com/daaku/go.zipexe v1.0.2/go.mod h1:5xWogtqlYnfBXkSB1o9xysukNP9GTvaNkqzUZbt3Bw8= github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= github.com/fsnotify/fsnotify v1.4.7/go.mod h1:jwhsz4b93w/PPRr/qN1Yymfu8t87LnFCMoQvtojpjFo= @@ -24,9 +24,9 @@ github.com/golang/protobuf v1.4.2/go.mod h1:oDoupMAO8OvCJWAcko0GGGIgR6R6ocIYbsSw github.com/google/go-cmp v0.3.0/go.mod h1:8QqcDgzrUqlUb/G2PQTWiueGozuR1884gddMywk6iLU= github.com/google/go-cmp v0.3.1/go.mod h1:8QqcDgzrUqlUb/G2PQTWiueGozuR1884gddMywk6iLU= github.com/google/go-cmp v0.4.0/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE= -github.com/google/go-cmp v0.5.8 h1:e6P7q2lk1O+qJJb4BtCQXlK8vWEO8V1ZeuEdJNOqZyg= -github.com/gotk3/gotk3 v0.6.1 h1:GJ400a0ecEEWrzjBvzBzH+pB/esEMIGdB9zPSmBdoeo= -github.com/gotk3/gotk3 v0.6.1/go.mod h1:/hqFpkNa9T3JgNAE2fLvCdov7c5bw//FHNZrZ3Uv9/Q= +github.com/google/go-cmp v0.5.9 h1:O2Tfq5qg4qc4AmwVlvv0oLiVAGB7enBSJ2x2DqQFi38= +github.com/gotk3/gotk3 v0.6.2 h1:sx/PjaKfKULJPTPq8p2kn2ZbcNFxpOJqi4VLzMbEOO8= +github.com/gotk3/gotk3 v0.6.2/go.mod h1:/hqFpkNa9T3JgNAE2fLvCdov7c5bw//FHNZrZ3Uv9/Q= github.com/hpcloud/tail v1.0.0/go.mod h1:ab1qPbhIpdTxEkNHXyeSf5vhxWSCs/tWer42PpOxQnU= github.com/jessevdk/go-flags v1.4.0 h1:4IU2WS7AumrZ/40jfhf4QVDMsQwqA7VEHozFRrGARJA= github.com/jessevdk/go-flags v1.4.0/go.mod h1:4FA24M0QyGHXBuZZK/XkWh8h0e1EYbRYJSGM75WSRxI= @@ -41,8 +41,8 @@ github.com/onsi/ginkgo v1.16.5 h1:8xi0RTUf59SOSfEtZMvwTvXYMzG4gV23XVHOZiXNtnE= github.com/onsi/ginkgo v1.16.5/go.mod h1:+E8gABHa3K6zRBolWtd+ROzc/U5bkGt0FwiG042wbpU= github.com/onsi/gomega v1.7.1/go.mod h1:XdKZgCCFLUoM/7CFJVPcG8C1xQ1AJ0vpAezJrB7JYyY= github.com/onsi/gomega v1.10.1/go.mod h1:iN09h71vgCQne3DLsj+A5owkum+a2tYe+TOCB1ybHNo= -github.com/onsi/gomega v1.20.0 h1:8W0cWlwFkflGPLltQvLRB7ZVD5HuP6ng320w2IS245Q= -github.com/onsi/gomega v1.20.0/go.mod h1:DtrZpjmvpn2mPm4YWQa0/ALMDj9v4YxLgojwPeREyVo= +github.com/onsi/gomega v1.27.8 h1:gegWiwZjBsf2DgiSbf5hpokZ98JVDMcWkUiigk6/KXc= +github.com/onsi/gomega v1.27.8/go.mod h1:2J8vzI/s+2shY9XHRApDkdgPo1TKT7P2u6fXeJKFnNQ= github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME= github.com/stretchr/testify v1.5.1/go.mod h1:5W2xD1RspED5o8YsWQXVCued0rvSQ+mT+I5cxcmMvtA= @@ -60,7 +60,7 @@ golang.org/x/net v0.0.0-20190404232315-eb5bcb51f2a3/go.mod h1:t9HGtf8HONx5eT2rtn golang.org/x/net v0.0.0-20190620200207-3b0461eec859/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s= golang.org/x/net v0.0.0-20200520004742-59133d7f0dd7/go.mod h1:qpuaurCH72eLCgpAm/N6yyVIVM9cpaDIP3A8BGJEC5A= golang.org/x/net v0.0.0-20201021035429-f5854403a974/go.mod h1:sp8m0HH+o8qH0wwXwYZr8TS3Oi6o0r6Gce1SSxlDquU= -golang.org/x/net v0.0.0-20220425223048-2871e0cb64e4 h1:HVyaeDAYux4pnY+D/SiwmLOR36ewZ4iGQIIrtnuCjFA= +golang.org/x/net v0.10.0 h1:X2//UzNDwYmtCLn7To6G58Wr6f5ahEAQgKNzv9Y951M= golang.org/x/sync v0.0.0-20180314180146-1d60e4601c6f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20190423024810-112230192c58/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20201020160332-67f06af15bc9/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= @@ -73,12 +73,12 @@ golang.org/x/sys v0.0.0-20191120155948-bd437916bb0e/go.mod h1:h1NjWce9XRLGQEsW7w golang.org/x/sys v0.0.0-20200323222414-85ca7c5b95cd/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20200930185726-fdedc70b468f/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20210112080510-489259a85091/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= -golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f h1:v4INt8xihDGvnrfjMDVXGxw9wrfxYyCjk0KbXjhR55s= -golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.10.0 h1:SqMFp9UcQJZa+pmYuAKjd9xq1f0j5rLcDIk0mj4qAsA= +golang.org/x/sys v0.10.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= -golang.org/x/text v0.3.7 h1:olpwvP2KacW1ZWvsR7uQhoyTYvKAupfQrRGBFM352Gk= -golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ= +golang.org/x/text v0.11.0 h1:LAntKIrcmeSKERyiOh0XMV39LXS8IE9UL2yP7+f5ij4= +golang.org/x/text v0.11.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE= golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= golang.org/x/tools v0.0.0-20191119224855-298f0cb1881e/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo= golang.org/x/tools v0.0.0-20201224043029-2b0845dc783e/go.mod h1:emZCQorbCU4vsT4fOWvOPXz4eW1wZW4PmDk9uLelYpA= diff --git a/vendor/github.com/daaku/go.zipexe/zipexe.go b/vendor/github.com/daaku/go.zipexe/zipexe.go index 6004606..55ff90d 100644 --- a/vendor/github.com/daaku/go.zipexe/zipexe.go +++ b/vendor/github.com/daaku/go.zipexe/zipexe.go @@ -125,8 +125,10 @@ func zipExeReaderElf(rda io.ReaderAt, size int64) (*zip.Reader, error) { } // Check if this section has a zip file - if zfile, err := zip.NewReader(sect, int64(sect.Size)); err == nil { - return zfile, nil + if sect.ReaderAt != nil { + if zfile, err := zip.NewReader(sect, int64(sect.Size)); err == nil { + return zfile, nil + } } // Otherwise move end of file pointer diff --git a/vendor/github.com/gotk3/gotk3/cairo/canvas.go b/vendor/github.com/gotk3/gotk3/cairo/canvas.go index 2887c65..4033084 100644 --- a/vendor/github.com/gotk3/gotk3/cairo/canvas.go +++ b/vendor/github.com/gotk3/gotk3/cairo/canvas.go @@ -9,6 +9,8 @@ import ( "reflect" "runtime" "unsafe" + + "github.com/gotk3/gotk3/glib" ) // Context is a representation of Cairo's cairo_t. @@ -57,7 +59,7 @@ func (v *Context) Close() { func Create(target *Surface) *Context { c := C.cairo_create(target.native()) ctx := wrapContext(c) - runtime.SetFinalizer(ctx, (*Context).destroy) + runtime.SetFinalizer(ctx, func(v *Context) { glib.FinalizerStrategy(v.destroy) }) return ctx } @@ -95,7 +97,7 @@ func (v *Context) GetTarget() *Surface { c := C.cairo_get_target(v.native()) s := wrapSurface(c) s.reference() - runtime.SetFinalizer(s, (*Surface).destroy) + runtime.SetFinalizer(s, func(v *Surface) { glib.FinalizerStrategy(v.destroy) }) return s } @@ -122,7 +124,7 @@ func (v *Context) GetGroupTarget() *Surface { c := C.cairo_get_group_target(v.native()) s := wrapSurface(c) s.reference() - runtime.SetFinalizer(s, (*Surface).destroy) + runtime.SetFinalizer(s, func(v *Surface) { glib.FinalizerStrategy(v.destroy) }) return s } diff --git a/vendor/github.com/gotk3/gotk3/cairo/fontoptions.go b/vendor/github.com/gotk3/gotk3/cairo/fontoptions.go new file mode 100644 index 0000000..d5372ac --- /dev/null +++ b/vendor/github.com/gotk3/gotk3/cairo/fontoptions.go @@ -0,0 +1,167 @@ +package cairo + +// #include +// #include +// #include +import "C" +import ( + "runtime" + "unsafe" + + "github.com/gotk3/gotk3/glib" +) + +func init() { + tm := []glib.TypeMarshaler{ + // Enums + {glib.Type(C.cairo_gobject_subpixel_order_get_type()), marshalSubpixelOrder}, + {glib.Type(C.cairo_gobject_hint_style_get_type()), marshalHintStyle}, + {glib.Type(C.cairo_gobject_hint_metrics_get_type()), marshalHintMetrics}, + + // Boxed + {glib.Type(C.cairo_gobject_font_options_get_type()), marshalFontOptions}, + } + glib.RegisterGValueMarshalers(tm) +} + +// SubpixelOrder is a representation of Cairo's cairo_subpixel_order_t. +type SubpixelOrder int + +const ( + SUBPIXEL_ORDER_DEFAULT SubpixelOrder = C.CAIRO_SUBPIXEL_ORDER_DEFAULT + SUBPIXEL_ORDER_RGB SubpixelOrder = C.CAIRO_SUBPIXEL_ORDER_RGB + SUBPIXEL_ORDER_BGR SubpixelOrder = C.CAIRO_SUBPIXEL_ORDER_BGR + SUBPIXEL_ORDER_VRGB SubpixelOrder = C.CAIRO_SUBPIXEL_ORDER_VRGB + SUBPIXEL_ORDER_VBGR SubpixelOrder = C.CAIRO_SUBPIXEL_ORDER_VBGR +) + +func marshalSubpixelOrder(p uintptr) (interface{}, error) { + c := C.g_value_get_enum((*C.GValue)(unsafe.Pointer(p))) + return SubpixelOrder(c), nil +} + +// HintStyle is a representation of Cairo's cairo_hint_style_t. +type HintStyle int + +const ( + HINT_STYLE_DEFAULT HintStyle = C.CAIRO_HINT_STYLE_DEFAULT + HINT_STYLE_NONE HintStyle = C.CAIRO_HINT_STYLE_NONE + HINT_STYLE_SLIGHT HintStyle = C.CAIRO_HINT_STYLE_SLIGHT + HINT_STYLE_MEDIUM HintStyle = C.CAIRO_HINT_STYLE_MEDIUM + HINT_STYLE_FULL HintStyle = C.CAIRO_HINT_STYLE_FULL +) + +func marshalHintStyle(p uintptr) (interface{}, error) { + c := C.g_value_get_enum((*C.GValue)(unsafe.Pointer(p))) + return HintStyle(c), nil +} + +// HintMetrics is a representation of Cairo's cairo_hint_metrics_t. +type HintMetrics int + +const ( + HINT_METRICS_DEFAULT HintMetrics = C.CAIRO_HINT_METRICS_DEFAULT + HINT_METRICS_OFF HintMetrics = C.CAIRO_HINT_METRICS_OFF + HINT_METRICS_ON HintMetrics = C.CAIRO_HINT_METRICS_ON +) + +func marshalHintMetrics(p uintptr) (interface{}, error) { + c := C.g_value_get_enum((*C.GValue)(unsafe.Pointer(p))) + return HintMetrics(c), nil +} + +// FontOptions is a representation of Cairo's cairo_font_options_t. +type FontOptions struct { + native *C.cairo_font_options_t +} + +func marshalFontOptions(p uintptr) (interface{}, error) { + c := C.g_value_get_boxed((*C.GValue)(unsafe.Pointer(p))) + return &FontOptions{ + native: (*C.cairo_font_options_t)(unsafe.Pointer(c)), + }, nil +} + +// CreatFontOptions is a wrapper around cairo_font_options_create(). +func CreateFontOptions() *FontOptions { + native := C.cairo_font_options_create() + + opts := &FontOptions{native} + runtime.SetFinalizer(opts, func(v *FontOptions) { glib.FinalizerStrategy(v.destroy) }) + + return opts +} + +func (o *FontOptions) destroy() { + C.cairo_font_options_destroy(o.native) +} + +// Copy is a wrapper around cairo_font_options_copy(). +func (o *FontOptions) Copy() *FontOptions { + native := C.cairo_font_options_copy(o.native) + + opts := &FontOptions{native} + runtime.SetFinalizer(opts, func(v *FontOptions) { glib.FinalizerStrategy(v.destroy) }) + + return opts +} + +// Status is a wrapper around cairo_font_options_status(). +func (o *FontOptions) Status() Status { + return Status(C.cairo_font_options_status(o.native)) +} + +// Merge is a wrapper around cairo_font_options_merge(). +func (o *FontOptions) Merge(other *FontOptions) { + C.cairo_font_options_merge(o.native, other.native) +} + +// Hash is a wrapper around cairo_font_options_hash(). +func (o *FontOptions) Hash() uint32 { + return uint32(C.cairo_font_options_hash(o.native)) +} + +// Equal is a wrapper around cairo_font_options_equal(). +func (o *FontOptions) Equal(other *FontOptions) bool { + return gobool(C.cairo_font_options_equal(o.native, other.native)) +} + +// SetAntialias is a wrapper around cairo_font_options_set_antialias(). +func (o *FontOptions) SetAntialias(antialias Antialias) { + C.cairo_font_options_set_antialias(o.native, C.cairo_antialias_t(antialias)) +} + +// GetAntialias is a wrapper around cairo_font_options_get_antialias(). +func (o *FontOptions) GetAntialias() Antialias { + return Antialias(C.cairo_font_options_get_antialias(o.native)) +} + +// SetSubpixelOrder is a wrapper around cairo_font_options_set_subpixel_order(). +func (o *FontOptions) SetSubpixelOrder(subpixelOrder SubpixelOrder) { + C.cairo_font_options_set_subpixel_order(o.native, C.cairo_subpixel_order_t(subpixelOrder)) +} + +// GetSubpixelOrder is a wrapper around cairo_font_options_get_subpixel_order(). +func (o *FontOptions) GetSubpixelOrder() SubpixelOrder { + return SubpixelOrder(C.cairo_font_options_get_subpixel_order(o.native)) +} + +// SetHintStyle is a wrapper around cairo_font_options_set_hint_style(). +func (o *FontOptions) SetHintStyle(hintStyle HintStyle) { + C.cairo_font_options_set_hint_style(o.native, C.cairo_hint_style_t(hintStyle)) +} + +// GetHintStyle is a wrapper around cairo_font_options_get_hint_style(). +func (o *FontOptions) GetHintStyle() HintStyle { + return HintStyle(C.cairo_font_options_get_hint_style(o.native)) +} + +// SetHintMetrics is a wrapper around cairo_font_options_set_hint_metrics(). +func (o *FontOptions) SetHintMetrics(hintMetrics HintMetrics) { + C.cairo_font_options_set_hint_metrics(o.native, C.cairo_hint_metrics_t(hintMetrics)) +} + +// GetHintMetrics is a wrapper around cairo_font_options_get_hint_metrics(). +func (o *FontOptions) GetHintMetrics() HintMetrics { + return HintMetrics(C.cairo_font_options_get_hint_metrics(o.native)) +} diff --git a/vendor/github.com/gotk3/gotk3/cairo/fontoptions_since_1_16.go b/vendor/github.com/gotk3/gotk3/cairo/fontoptions_since_1_16.go new file mode 100644 index 0000000..9330471 --- /dev/null +++ b/vendor/github.com/gotk3/gotk3/cairo/fontoptions_since_1_16.go @@ -0,0 +1,28 @@ +// +build !cairo_1_9,!cairo_1_10,!cairo_1_11,!cairo_1_12,!cairo_1_13,!cairo_1_14,!cairo_1_15 + +package cairo + +// #include +// #include +// #include +import "C" +import ( + "unsafe" +) + +// GetVariations is a wrapper around cairo_font_options_get_variations(). +func (o *FontOptions) GetVariations() string { + return C.GoString(C.cairo_font_options_get_variations(o.native)) +} + +// SetVariations is a wrapper around cairo_font_options_set_variations(). +func (o *FontOptions) SetVariations(variations string) { + var cvariations *C.char + if variations != "" { + cvariations = C.CString(variations) + // Cairo will call strdup on its own. + defer C.free(unsafe.Pointer(cvariations)) + } + + C.cairo_font_options_set_variations(o.native, cvariations) +} diff --git a/vendor/github.com/gotk3/gotk3/cairo/pattern.go b/vendor/github.com/gotk3/gotk3/cairo/pattern.go index 229567c..3b0df32 100644 --- a/vendor/github.com/gotk3/gotk3/cairo/pattern.go +++ b/vendor/github.com/gotk3/gotk3/cairo/pattern.go @@ -8,10 +8,29 @@ import "C" import ( "runtime" "unsafe" + + "github.com/gotk3/gotk3/glib" ) //--------------------------------------------[ cairo_pattern_t == Pattern ]-- +// Filter is a representation of Cairo's cairo_filter_t. +type Filter int + +const ( + FILTER_FAST Filter = C.CAIRO_FILTER_FAST + FILTER_GOOD Filter = C.CAIRO_FILTER_GOOD + FILTER_BEST Filter = C.CAIRO_FILTER_BEST + FILTER_NEAREST Filter = C.CAIRO_FILTER_NEAREST + FILTER_BILINEAR Filter = C.CAIRO_FILTER_BILINEAR + FILTER_GAUSSIAN Filter = C.CAIRO_FILTER_GAUSSIAN +) + +func marshalFilter(p uintptr) (interface{}, error) { + c := C.g_value_get_enum((*C.GValue)(unsafe.Pointer(p))) + return Filter(c), nil +} + // Pattern is a representation of Cairo's cairo_pattern_t. type Pattern struct { pattern *C.cairo_pattern_t @@ -54,7 +73,7 @@ func newPatternFromNative(patternNative *C.cairo_pattern_t) (*Pattern, error) { if e != nil { return nil, e } - runtime.SetFinalizer(ptr, (*Pattern).destroy) + runtime.SetFinalizer(ptr, func(v *Pattern) { glib.FinalizerStrategy(v.destroy) }) return ptr, nil } @@ -110,3 +129,13 @@ func (v *Pattern) AddColorStopRGBA(offset, red, green, blue, alpha float64) erro C.double(red), C.double(green), C.double(blue), C.double(alpha)) return v.Status().ToError() } + +// PatternSetFilter is a wrapper around cairo_pattern_set_filter(). +func (v *Pattern) PatternSetFilter(filter Filter) { + C.cairo_pattern_set_filter(v.native(), C.cairo_filter_t(filter)) +} + +// PatternGetFilter is a wrapper around cairo_pattern_get_filter(). +func (v *Pattern) PatternGetFilter() Filter { + return Filter(C.cairo_pattern_get_filter(v.native())) +} diff --git a/vendor/github.com/gotk3/gotk3/cairo/region.go b/vendor/github.com/gotk3/gotk3/cairo/region.go index d3e36d0..82be8ed 100644 --- a/vendor/github.com/gotk3/gotk3/cairo/region.go +++ b/vendor/github.com/gotk3/gotk3/cairo/region.go @@ -112,7 +112,7 @@ func newRegionFromNative(regionNative *C.cairo_region_t) (*Region, error) { if e != nil { return nil, e } - runtime.SetFinalizer(ptr, (*Region).destroy) + runtime.SetFinalizer(ptr, func(v *Region) { glib.FinalizerStrategy(v.destroy) }) return ptr, nil } diff --git a/vendor/github.com/gotk3/gotk3/cairo/surface.go b/vendor/github.com/gotk3/gotk3/cairo/surface.go index 6137529..552b7e2 100644 --- a/vendor/github.com/gotk3/gotk3/cairo/surface.go +++ b/vendor/github.com/gotk3/gotk3/cairo/surface.go @@ -9,6 +9,8 @@ import "C" import ( "runtime" "unsafe" + + "github.com/gotk3/gotk3/glib" ) /* @@ -47,7 +49,7 @@ func CreateImageSurfaceForData(data []byte, format Format, width, height, stride s := wrapSurface(surfaceNative) - runtime.SetFinalizer(s, (*Surface).destroy) + runtime.SetFinalizer(s, func(v *Surface) { glib.FinalizerStrategy(v.destroy) }) return s, nil } @@ -57,7 +59,7 @@ func CreateImageSurface(format Format, width, height int) *Surface { c := C.cairo_image_surface_create(C.cairo_format_t(format), C.int(width), C.int(height)) s := wrapSurface(c) - runtime.SetFinalizer(s, (*Surface).destroy) + runtime.SetFinalizer(s, func(v *Surface) { glib.FinalizerStrategy(v.destroy) }) return s } @@ -75,7 +77,7 @@ func CreatePDFSurface(fileName string, width float64, height float64) (*Surface, s := wrapSurface(surfaceNative) - runtime.SetFinalizer(s, (*Surface).destroy) + runtime.SetFinalizer(s, func(v *Surface) { glib.FinalizerStrategy(v.destroy) }) return s, nil } @@ -114,7 +116,7 @@ func NewSurface(s uintptr, needsRef bool) *Surface { if needsRef { surface.reference() } - runtime.SetFinalizer(surface, (*Surface).destroy) + runtime.SetFinalizer(surface, func(v *Surface) { glib.FinalizerStrategy(v.destroy) }) return surface } @@ -133,7 +135,7 @@ func (v *Surface) CreateSimilar(content Content, width, height int) *Surface { c := C.cairo_surface_create_similar(v.native(), C.cairo_content_t(content), C.int(width), C.int(height)) s := wrapSurface(c) - runtime.SetFinalizer(s, (*Surface).destroy) + runtime.SetFinalizer(s, func(v *Surface) { glib.FinalizerStrategy(v.destroy) }) return s } @@ -144,7 +146,7 @@ func (v *Surface) CreateForRectangle(x, y, width, height float64) *Surface { c := C.cairo_surface_create_for_rectangle(v.native(), C.double(x), C.double(y), C.double(width), C.double(height)) s := wrapSurface(c) - runtime.SetFinalizer(s, (*Surface).destroy) + runtime.SetFinalizer(s, func(v *Surface) { glib.FinalizerStrategy(v.destroy) }) return s } diff --git a/vendor/github.com/gotk3/gotk3/gdk/gdk.go b/vendor/github.com/gotk3/gotk3/gdk/gdk.go index e9382ae..44c9036 100644 --- a/vendor/github.com/gotk3/gotk3/gdk/gdk.go +++ b/vendor/github.com/gotk3/gotk3/gdk/gdk.go @@ -811,7 +811,7 @@ func (v *Display) GetEvent() (*Event, error) { //The finalizer is not on the glib.Object but on the event. e := &Event{c} - runtime.SetFinalizer(e, (*Event).free) + runtime.SetFinalizer(e, func(v *Event) { glib.FinalizerStrategy(v.free) }) return e, nil } @@ -824,7 +824,7 @@ func (v *Display) PeekEvent() (*Event, error) { //The finalizer is not on the glib.Object but on the event. e := &Event{c} - runtime.SetFinalizer(e, (*Event).free) + runtime.SetFinalizer(e, func(v *Event) { glib.FinalizerStrategy(v.free) }) return e, nil } @@ -1153,9 +1153,6 @@ func (v *Keymap) GetModifierState() uint { * GDK Keyval */ -// TODO: -// gdk_keyval_name(). - // KeyvalFromName() is a wrapper around gdk_keyval_from_name(). func KeyvalFromName(keyvalName string) uint { str := (*C.gchar)(C.CString(keyvalName)) @@ -1202,6 +1199,11 @@ func UnicodeToKeyval(v rune) uint { return uint(C.gdk_unicode_to_keyval(C.guint32(v))) } +// KeyValName is a wrapper around gdk_keyval_name(). +func KeyValName(keyval uint) string { + return C.GoString(C.gdk_keyval_name(C.guint(keyval))) +} + /* * GdkDragContext */ @@ -1362,6 +1364,91 @@ func (v *EventButton) MotionValRoot() (float64, float64) { return float64(x), float64(y) } +/* + * GdkEventTouch + */ + +// EventTouch is a representation of GDK's GdkEventTouch +type EventTouch struct { + *Event +} + +func EventTouchNew() *EventTouch { + ee := (*C.GdkEvent)(unsafe.Pointer(&C.GdkEventTouch{})) + ev := Event{ee} + return &EventTouch{&ev} +} + +// EventTouchNewFromEvent returns an EventTouch from an Event. +// +// Using widget.Connect() for a key related signal such as +// "touch-event" results in a *Event being passed as +// the callback's second argument. The argument is actually a +// *EventTouch. EventTouchNewFromEvent provides a means of creating +// an EventTouch from the Event. +func EventTouchNewFromEvent(event *Event) *EventTouch { + ee := (*C.GdkEvent)(unsafe.Pointer(event.native())) + ev := Event{ee} + return &EventTouch{&ev} +} + +// Native returns a pointer to the underlying GdkEventTouch. +func (v *EventTouch) Native() uintptr { + return uintptr(unsafe.Pointer(v.native())) +} + +func (v *EventTouch) native() *C.GdkEventTouch { + return (*C.GdkEventTouch)(unsafe.Pointer(v.Event.native())) +} + +func (v *EventTouch) Type() EventType { + c := v.native()._type + return EventType(c) +} + +/*TODO GdkWindow *window */ + +func (v *EventTouch) Time() uint32 { + c := v.native().time + return uint32(c) +} + +func (v *EventTouch) X() float64 { + c := v.native().x + return float64(c) +} + +func (v *EventTouch) Y() float64 { + c := v.native().y + return float64(c) +} + +/*TODO gdouble *axes */ + +func (v *EventTouch) State() uint { + c := v.native().state + return uint(c) +} + +/*TODO GdkEventSequence *sequence */ + +func (v *EventTouch) EmulatingPointer() uint { + c := v.native().emulating_pointer + return uint(c) +} + +/*TODO GdkDevice *device */ + +func (v *EventTouch) XRoot() float64 { + c := v.native().x_root + return float64(c) +} + +func (v *EventTouch) YRoot() float64 { + c := v.native().y_root + return float64(c) +} + /* * GdkEventKey */ @@ -1927,7 +2014,7 @@ func (c *RGBA) Copy() (*RGBA, error) { } obj := wrapRGBA(cRgba) - runtime.SetFinalizer(obj, (*RGBA).free) + runtime.SetFinalizer(obj, func(v *RGBA) { glib.FinalizerStrategy(v.free) }) return obj, nil } @@ -2420,7 +2507,7 @@ func (v *Window) PixbufGetFromWindow(x, y, w, h int) (*Pixbuf, error) { obj := &glib.Object{glib.ToGObject(unsafe.Pointer(c))} p := &Pixbuf{obj} //obj.Ref() - runtime.SetFinalizer(p, func(_ interface{}) { obj.Unref() }) + runtime.SetFinalizer(p, func(_ interface{}) { glib.FinalizerStrategy(obj.Unref) }) return p, nil } @@ -2432,10 +2519,15 @@ func (v *Window) GetDevicePosition(d *Device) (*Window, int, int, ModifierType) underneathWindow := C.gdk_window_get_device_position(v.native(), d.native(), &x, &y, &mt) obj := &glib.Object{glib.ToGObject(unsafe.Pointer(underneathWindow))} rw := &Window{obj} - runtime.SetFinalizer(rw, func(_ interface{}) { obj.Unref() }) + runtime.SetFinalizer(rw, func(_ interface{}) { glib.FinalizerStrategy(obj.Unref) }) return rw, int(x), int(y), ModifierType(mt) } +// SetOverrideRedirect is a wrapper around gdk_window_set_override_redirect(). +func (v *Window) SetOverrideRedirect(overrideRedirect bool) { + C.gdk_window_set_override_redirect(v.native(), gbool(overrideRedirect)) +} + func PixbufGetFromSurface(surface *cairo.Surface, src_x, src_y, width, height int) (*Pixbuf, error) { c := C.gdk_pixbuf_get_from_surface((*C.cairo_surface_t)(unsafe.Pointer(surface.Native())), C.gint(src_x), C.gint(src_y), C.gint(width), C.gint(height)) if c == nil { @@ -2445,7 +2537,7 @@ func PixbufGetFromSurface(surface *cairo.Surface, src_x, src_y, width, height in obj := &glib.Object{glib.ToGObject(unsafe.Pointer(c))} p := &Pixbuf{obj} //obj.Ref() - runtime.SetFinalizer(p, func(_ interface{}) { obj.Unref() }) + runtime.SetFinalizer(p, func(_ interface{}) { glib.FinalizerStrategy(obj.Unref) }) return p, nil } diff --git a/vendor/github.com/gotk3/gotk3/gdk/gdk_deprecated_since_3_20.go b/vendor/github.com/gotk3/gotk3/gdk/gdk_deprecated_since_3_20.go index 07fc74a..9be441f 100644 --- a/vendor/github.com/gotk3/gotk3/gdk/gdk_deprecated_since_3_20.go +++ b/vendor/github.com/gotk3/gotk3/gdk/gdk_deprecated_since_3_20.go @@ -48,7 +48,7 @@ func (v *DeviceManager) ListDevices(tp DeviceType) *glib.List { return &Device{&glib.Object{glib.ToGObject(ptr)}} }) runtime.SetFinalizer(glist, func(glist *glib.List) { - glist.Free() + glib.FinalizerStrategy(glist.Free) }) return glist } diff --git a/vendor/github.com/gotk3/gotk3/gdk/gdk_since_3_10.go b/vendor/github.com/gotk3/gotk3/gdk/gdk_since_3_10.go index f941b0a..ee04711 100644 --- a/vendor/github.com/gotk3/gotk3/gdk/gdk_since_3_10.go +++ b/vendor/github.com/gotk3/gotk3/gdk/gdk_since_3_10.go @@ -12,6 +12,7 @@ import ( "unsafe" "github.com/gotk3/gotk3/cairo" + "github.com/gotk3/gotk3/glib" ) // TODO: @@ -44,7 +45,7 @@ func CairoSurfaceCreateFromPixbuf(pixbuf *Pixbuf, scale int, window *Window) (*c } surface := cairo.WrapSurface(uintptr(unsafe.Pointer(v))) - runtime.SetFinalizer(surface, (*cairo.Surface).Close) + runtime.SetFinalizer(surface, func(v *cairo.Surface) { glib.FinalizerStrategy(v.Close) }) return surface, nil } diff --git a/vendor/github.com/gotk3/gotk3/gdk/pixbuf.go b/vendor/github.com/gotk3/gotk3/gdk/pixbuf.go index a803e8a..1fdddcb 100644 --- a/vendor/github.com/gotk3/gotk3/gdk/pixbuf.go +++ b/vendor/github.com/gotk3/gotk3/gdk/pixbuf.go @@ -113,7 +113,7 @@ func PixbufNew(colorspace Colorspace, hasAlpha bool, bitsPerSample, width, heigh obj := &glib.Object{glib.ToGObject(unsafe.Pointer(c))} p := &Pixbuf{obj} //obj.Ref() - runtime.SetFinalizer(p, func(_ interface{}) { obj.Unref() }) + runtime.SetFinalizer(p, func(_ interface{}) { glib.FinalizerStrategy(obj.Unref) }) return p, nil } @@ -134,7 +134,7 @@ func PixbufNewFromFile(filename string) (*Pixbuf, error) { obj := &glib.Object{glib.ToGObject(unsafe.Pointer(c))} p := &Pixbuf{obj} //obj.Ref() - runtime.SetFinalizer(p, func(_ interface{}) { obj.Unref() }) + runtime.SetFinalizer(p, func(_ interface{}) { glib.FinalizerStrategy(obj.Unref) }) return p, nil } @@ -163,7 +163,7 @@ func PixbufNewFromData(pixbufData []byte, cs Colorspace, hasAlpha bool, bitsPerS obj := &glib.Object{glib.ToGObject(unsafe.Pointer(c))} p := &Pixbuf{obj} //obj.Ref() - runtime.SetFinalizer(p, func(_ interface{}) { obj.Unref() }) + runtime.SetFinalizer(p, func(_ interface{}) { glib.FinalizerStrategy(obj.Unref) }) return p, nil } @@ -235,7 +235,7 @@ func PixbufCopy(v *Pixbuf) (*Pixbuf, error) { obj := &glib.Object{glib.ToGObject(unsafe.Pointer(c))} p := &Pixbuf{obj} //obj.Ref() - runtime.SetFinalizer(p, func(_ interface{}) { obj.Unref() }) + runtime.SetFinalizer(p, func(_ interface{}) { glib.FinalizerStrategy(obj.Unref) }) return p, nil } @@ -279,7 +279,7 @@ func (v *Pixbuf) GetPixels() (channels []byte) { // To make sure the slice doesn't outlive the Pixbuf, add a reference v.Ref() runtime.SetFinalizer(&channels, func(_ *[]byte) { - v.Unref() + glib.FinalizerStrategy(v.Unref) }) return } @@ -327,7 +327,7 @@ func (v *Pixbuf) ScaleSimple(destWidth, destHeight int, interpType InterpType) ( obj := &glib.Object{glib.ToGObject(unsafe.Pointer(c))} p := &Pixbuf{obj} //obj.Ref() - runtime.SetFinalizer(p, func(_ interface{}) { obj.Unref() }) + runtime.SetFinalizer(p, func(_ interface{}) { glib.FinalizerStrategy(obj.Unref) }) return p, nil } @@ -388,7 +388,7 @@ func (v *Pixbuf) AddAlpha(substituteColor bool, r, g, b uint8) *Pixbuf { obj := &glib.Object{glib.ToGObject(unsafe.Pointer(c))} p := &Pixbuf{obj} - runtime.SetFinalizer(p, func(_ interface{}) { obj.Unref() }) + runtime.SetFinalizer(p, func(_ interface{}) { glib.FinalizerStrategy(obj.Unref) }) return p } @@ -494,7 +494,7 @@ func (v *PixbufAnimation) GetStaticImage() *Pixbuf { // Add a reference so the pixbuf doesn't outlive the parent pixbuf // animation. v.Ref() - runtime.SetFinalizer(p, func(*Pixbuf) { v.Unref() }) + runtime.SetFinalizer(p, func(*Pixbuf) { glib.FinalizerStrategy(v.Unref) }) return p } @@ -519,7 +519,7 @@ func PixbufAnimationNewFromFile(filename string) (*PixbufAnimation, error) { obj := &glib.Object{glib.ToGObject(unsafe.Pointer(c))} p := &PixbufAnimation{obj} - runtime.SetFinalizer(p, func(_ interface{}) { obj.Unref() }) + runtime.SetFinalizer(p, func(_ interface{}) { glib.FinalizerStrategy(obj.Unref) }) return p, nil } diff --git a/vendor/github.com/gotk3/gotk3/gdk/pixbuf_since_2_12.go b/vendor/github.com/gotk3/gotk3/gdk/pixbuf_since_2_12.go index 1c67505..9428703 100644 --- a/vendor/github.com/gotk3/gotk3/gdk/pixbuf_since_2_12.go +++ b/vendor/github.com/gotk3/gotk3/gdk/pixbuf_since_2_12.go @@ -28,6 +28,6 @@ func (v *Pixbuf) ApplyEmbeddedOrientation() (*Pixbuf, error) { obj := &glib.Object{glib.ToGObject(unsafe.Pointer(c))} p := &Pixbuf{obj} //obj.Ref() - runtime.SetFinalizer(p, func(_ interface{}) { obj.Unref() }) + runtime.SetFinalizer(p, func(_ interface{}) { glib.FinalizerStrategy(obj.Unref) }) return p, nil } diff --git a/vendor/github.com/gotk3/gotk3/gdk/pixbuf_since_2_32.go b/vendor/github.com/gotk3/gotk3/gdk/pixbuf_since_2_32.go index 2fced1f..ab6cf55 100644 --- a/vendor/github.com/gotk3/gotk3/gdk/pixbuf_since_2_32.go +++ b/vendor/github.com/gotk3/gotk3/gdk/pixbuf_since_2_32.go @@ -40,7 +40,7 @@ func PixbufNewFromBytes(pixbufData []byte, cs Colorspace, hasAlpha bool, bitsPer obj := &glib.Object{glib.ToGObject(unsafe.Pointer(c))} p := &Pixbuf{obj} //obj.Ref() - runtime.SetFinalizer(p, func(_ interface{}) { obj.Unref() }) + runtime.SetFinalizer(p, func(_ interface{}) { glib.FinalizerStrategy(obj.Unref) }) return p, nil } diff --git a/vendor/github.com/gotk3/gotk3/gdk/pixbuf_since_2_4.go b/vendor/github.com/gotk3/gotk3/gdk/pixbuf_since_2_4.go index b0e90cf..99acc05 100644 --- a/vendor/github.com/gotk3/gotk3/gdk/pixbuf_since_2_4.go +++ b/vendor/github.com/gotk3/gotk3/gdk/pixbuf_since_2_4.go @@ -125,7 +125,7 @@ func PixbufNewFromFileAtSize(filename string, width, height int) (*Pixbuf, error obj := &glib.Object{glib.ToGObject(unsafe.Pointer(c))} p := &Pixbuf{obj} //obj.Ref() - runtime.SetFinalizer(p, func(_ interface{}) { obj.Unref() }) + runtime.SetFinalizer(p, func(_ interface{}) { glib.FinalizerStrategy(obj.Unref) }) return p, nil } diff --git a/vendor/github.com/gotk3/gotk3/gdk/pixbuf_since_2_6.go b/vendor/github.com/gotk3/gotk3/gdk/pixbuf_since_2_6.go index f52ade5..d5c43e2 100644 --- a/vendor/github.com/gotk3/gotk3/gdk/pixbuf_since_2_6.go +++ b/vendor/github.com/gotk3/gotk3/gdk/pixbuf_since_2_6.go @@ -39,7 +39,7 @@ func PixbufNewFromFileAtScale(filename string, width, height int, preserveAspect obj := &glib.Object{glib.ToGObject(unsafe.Pointer(c))} p := &Pixbuf{obj} //obj.Ref() - runtime.SetFinalizer(p, func(_ interface{}) { obj.Unref() }) + runtime.SetFinalizer(p, func(_ interface{}) { glib.FinalizerStrategy(obj.Unref) }) return p, nil } @@ -55,7 +55,7 @@ func (v *Pixbuf) RotateSimple(angle PixbufRotation) (*Pixbuf, error) { obj := &glib.Object{glib.ToGObject(unsafe.Pointer(c))} p := &Pixbuf{obj} //obj.Ref() - runtime.SetFinalizer(p, func(_ interface{}) { obj.Unref() }) + runtime.SetFinalizer(p, func(_ interface{}) { glib.FinalizerStrategy(obj.Unref) }) return p, nil } @@ -69,6 +69,6 @@ func (v *Pixbuf) Flip(horizontal bool) (*Pixbuf, error) { obj := &glib.Object{glib.ToGObject(unsafe.Pointer(c))} p := &Pixbuf{obj} //obj.Ref() - runtime.SetFinalizer(p, func(_ interface{}) { obj.Unref() }) + runtime.SetFinalizer(p, func(_ interface{}) { glib.FinalizerStrategy(obj.Unref) }) return p, nil } diff --git a/vendor/github.com/gotk3/gotk3/glib/finalizers.go b/vendor/github.com/gotk3/gotk3/glib/finalizers.go new file mode 100644 index 0000000..27739e8 --- /dev/null +++ b/vendor/github.com/gotk3/gotk3/glib/finalizers.go @@ -0,0 +1,14 @@ +package glib + +// Finalizer is a function that when called will finalize an object +type Finalizer func() + +// FinalizerStrategy will be called by every runtime finalizer in gotk3 +// The simple version will just call the finalizer given as an argument +// but in larger programs this might cause problems with the UI thread. +// The FinalizerStrategy function will always be called in the goroutine that +// `runtime.SetFinalizer` uses. It is a `var` to explicitly allow clients to +// change the strategy to something more advanced. +var FinalizerStrategy = func(f Finalizer) { + f() +} diff --git a/vendor/github.com/gotk3/gotk3/glib/gbinding.go b/vendor/github.com/gotk3/gotk3/glib/gbinding.go index 133ce12..e622472 100644 --- a/vendor/github.com/gotk3/gotk3/glib/gbinding.go +++ b/vendor/github.com/gotk3/gotk3/glib/gbinding.go @@ -59,31 +59,6 @@ func (v *Binding) Unbind() { C.g_binding_unbind(v.native()) } -// Retrieves the GObject instance used as the source of the binding -func (v *Binding) GetSource() *Object { - obj := C.g_binding_get_source(v.native()) - if obj == nil { - return nil - } - return wrapObject(unsafe.Pointer(obj)) -} - -// Retrieves the name of the property of “source” used as the source of -// the binding. -func (v *Binding) GetSourceProperty() string { - s := C.g_binding_get_source_property(v.native()) - return C.GoString((*C.char)(s)) -} - -// Retrieves the GObject instance used as the target of the binding. -func (v *Binding) GetTarget() *Object { - obj := C.g_binding_get_target(v.native()) - if obj == nil { - return nil - } - return wrapObject(unsafe.Pointer(obj)) -} - // Retrieves the name of the property of “target” used as the target of // the binding. func (v *Binding) GetTargetProperty() string { diff --git a/vendor/github.com/gotk3/gotk3/glib/gbinding_deprecated_since_2_68.go b/vendor/github.com/gotk3/gotk3/glib/gbinding_deprecated_since_2_68.go new file mode 100644 index 0000000..01c66ad --- /dev/null +++ b/vendor/github.com/gotk3/gotk3/glib/gbinding_deprecated_since_2_68.go @@ -0,0 +1,28 @@ +// +build glib_deprecated + +package glib + +// #include +// #include +// #include +// #include "glib.go.h" +import "C" +import "unsafe" + +// GetSource is a wrapper around g_binding_get_source(). +func (v *Binding) GetSource() *Object { + obj := C.g_binding_get_source(v.native()) + if obj == nil { + return nil + } + return wrapObject(unsafe.Pointer(obj)) +} + +// GetTarget is a wrapper around g_binding_get_target(). +func (v *Binding) GetTarget() *Object { + obj := C.g_binding_get_target(v.native()) + if obj == nil { + return nil + } + return wrapObject(unsafe.Pointer(obj)) +} diff --git a/vendor/github.com/gotk3/gotk3/glib/gbinding_since_2_68.go b/vendor/github.com/gotk3/gotk3/glib/gbinding_since_2_68.go new file mode 100644 index 0000000..d7beec7 --- /dev/null +++ b/vendor/github.com/gotk3/gotk3/glib/gbinding_since_2_68.go @@ -0,0 +1,29 @@ +//go:build !glib_deprecated && !glib_2_40 && !glib_2_42 && !glib_2_44 && !glib_2_46 && !glib_2_48 && !glib_2_50 && !glib_2_52 && !glib_2_54 && !glib_2_56 && !glib_2_58 && !glib_2_60 && !glib_2_62 && !glib_2_64 && !glib_2_66 +// +build !glib_deprecated,!glib_2_40,!glib_2_42,!glib_2_44,!glib_2_46,!glib_2_48,!glib_2_50,!glib_2_52,!glib_2_54,!glib_2_56,!glib_2_58,!glib_2_60,!glib_2_62,!glib_2_64,!glib_2_66 + +package glib + +// #include +// #include +// #include +// #include "glib.go.h" +import "C" +import "unsafe" + +// DupSource is a wrapper around g_binding_dup_source(). +func (v *Binding) DupSource() *Object { + obj := C.g_binding_dup_source(v.native()) + if obj == nil { + return nil + } + return wrapObject(unsafe.Pointer(obj)) +} + +// DupTarget is a wrapper around g_binding_dup_target(). +func (v *Binding) DupTarget() *Object { + obj := C.g_binding_dup_target(v.native()) + if obj == nil { + return nil + } + return wrapObject(unsafe.Pointer(obj)) +} diff --git a/vendor/github.com/gotk3/gotk3/glib/gcancellable.go b/vendor/github.com/gotk3/gotk3/glib/gcancellable.go index 097df4f..9e04c91 100644 --- a/vendor/github.com/gotk3/gotk3/glib/gcancellable.go +++ b/vendor/github.com/gotk3/gotk3/glib/gcancellable.go @@ -81,3 +81,13 @@ func (v *Cancellable) SourceNew() *Source { c := C.g_cancellable_source_new(v.native()) return wrapSource(c) } + +// Reset is a wrapper around g_cancellable_reset(). +func (v *Cancellable) Reset() { + C.g_cancellable_reset(v.native()) +} + +// Cancel is a wrapper around g_cancellable_cancel(). +func (v *Cancellable) Cancel() { + C.g_cancellable_cancel(v.native()) +} diff --git a/vendor/github.com/gotk3/gotk3/glib/gicon.go b/vendor/github.com/gotk3/gotk3/glib/gicon.go index 0f178af..0c0cfcd 100644 --- a/vendor/github.com/gotk3/gotk3/glib/gicon.go +++ b/vendor/github.com/gotk3/gotk3/glib/gicon.go @@ -101,7 +101,7 @@ func IconNewForString(str string) (*Icon, error) { obj := &Object{ToGObject(unsafe.Pointer(c))} i := &Icon{obj} - runtime.SetFinalizer(i, func(_ interface{}) { obj.Unref() }) + runtime.SetFinalizer(i, func(_ interface{}) { FinalizerStrategy(obj.Unref) }) return i, nil } diff --git a/vendor/github.com/gotk3/gotk3/glib/glib.go b/vendor/github.com/gotk3/gotk3/glib/glib.go index 1354163..97c2400 100644 --- a/vendor/github.com/gotk3/gotk3/glib/glib.go +++ b/vendor/github.com/gotk3/gotk3/glib/glib.go @@ -494,7 +494,6 @@ const ( FORMAT_SIZE_DEFAULT FormatSizeFlags = C.G_FORMAT_SIZE_DEFAULT FORMAT_SIZE_LONG_FORMAT FormatSizeFlags = C.G_FORMAT_SIZE_LONG_FORMAT FORMAT_SIZE_IEC_UNITS FormatSizeFlags = C.G_FORMAT_SIZE_IEC_UNITS - FORMAT_SIZE_BITS FormatSizeFlags = C.G_FORMAT_SIZE_BITS ) // FormatSizeFull is a wrapper around g_format_size_full(). @@ -588,7 +587,7 @@ func Take(ptr unsafe.Pointer) *Object { } obj.RefSink() - runtime.SetFinalizer(obj, (*Object).Unref) + runtime.SetFinalizer(obj, func(v *Object) { FinalizerStrategy(v.Unref) }) return obj } @@ -603,7 +602,7 @@ func Take(ptr unsafe.Pointer) *Object { // mark as such. func AssumeOwnership(ptr unsafe.Pointer) *Object { obj := newObject(ToGObject(ptr)) - runtime.SetFinalizer(obj, (*Object).Unref) + runtime.SetFinalizer(obj, func(v *Object) { FinalizerStrategy(v.Unref) }) return obj } @@ -858,13 +857,14 @@ func ValueAlloc() (*Value, error) { //We need to double check before unsetting, to prevent: //`g_value_unset: assertion 'G_IS_VALUE (value)' failed` runtime.SetFinalizer(v, func(f *Value) { + FinalizerStrategy(func() { + if !f.IsValue() { + C.g_free(C.gpointer(f.native())) + return + } - if !f.IsValue() { - C.g_free(C.gpointer(f.native())) - return - } - - f.unset() + f.unset() + }) }) return v, nil @@ -882,7 +882,7 @@ func ValueInit(t Type) (*Value, error) { v := &Value{c} - runtime.SetFinalizer(v, (*Value).unset) + runtime.SetFinalizer(v, func(vv *Value) { FinalizerStrategy(vv.unset) }) return v, nil } @@ -1339,18 +1339,67 @@ type Signal struct { signalId C.guint } -func SignalNew(s string) (*Signal, error) { - cstr := C.CString(s) +func SignalNew(signalName string) (*Signal, error) { + cstr := C.CString(signalName) defer C.free(unsafe.Pointer(cstr)) signalId := C._g_signal_new((*C.gchar)(cstr)) if signalId == 0 { - return nil, fmt.Errorf("invalid signal name: %s", s) + return nil, fmt.Errorf("invalid signal name: %s", signalName) } return &Signal{ - name: s, + name: signalName, + signalId: signalId, + }, nil +} + +// SignalNewV is a wrapper around g_signal_newv(). +// +// Parameters: +// - signalName : The name for the signal. +// - returnType : The type of return value, or TYPE_NONE for a signal without a return value. +// - nParams : Amount of extra parameters the signal is going to recieve (the object who emits the signal does not count). +// - paramsTypes... : Datatypes of the parameters (amount of elements must match nParams, except when nParams is 0). +// If nParams is 0 then paramsTypes has to be TYPE_NONE. +// If nParams is 1 then paramsTypes has to be different from TYPE_NONE. +func SignalNewV( + signalName string, + returnType Type, + nParams uint, + paramsTypes ...Type, +) (*Signal, error) { + if nParams == 0 { + if paramsTypes[0] != TYPE_NONE || len(paramsTypes) != 1 { + return nil, fmt.Errorf("invalid Types: the amount of parameters is %d, paramsTypes must be TYPE_NONE", nParams) + } + } else if nParams == 1 { + if paramsTypes[0] == TYPE_NONE || len(paramsTypes) != 1 { + return nil, fmt.Errorf("invalid Types: the amount of parameters is %d, paramsTypes must be different from TYPE_NONE", nParams) + } + } else { + if len(paramsTypes) != int(nParams) { + return nil, fmt.Errorf("invalid Types: The amount of elements of paramsTypes has to be equal to %d", nParams) + } + } + + cstr := C.CString(signalName) + defer C.free(unsafe.Pointer(cstr)) + + var sliceOfGTypes []C.GType + for _, paramType := range paramsTypes { + sliceOfGTypes = append(sliceOfGTypes, C.gsize(paramType)) + } + + signalId := C._g_signal_newv((*C.gchar)(cstr), C.gsize(returnType), C.guint(nParams), (*C.GType)(&sliceOfGTypes[0])) + + if signalId == 0 { + return nil, fmt.Errorf("invalid signal name: %s", signalName) + } + + return &Signal{ + name: signalName, signalId: signalId, }, nil } @@ -1409,3 +1458,11 @@ func Local(input string) string { return C.GoString(C.localize(cstr)) } + +// MarkupEscapeText will escape the given text +func MarkupEscapeText(input string) string { + cstr := C.CString(input) + defer C.free(unsafe.Pointer(cstr)) + + return C.GoString(C.g_markup_escape_text(cstr, -1)) +} diff --git a/vendor/github.com/gotk3/gotk3/glib/glib.go.h b/vendor/github.com/gotk3/gotk3/glib/glib.go.h index e9e672b..e66b913 100644 --- a/vendor/github.com/gotk3/gotk3/glib/glib.go.h +++ b/vendor/github.com/gotk3/gotk3/glib/glib.go.h @@ -160,6 +160,13 @@ static inline guint _g_signal_new(const gchar *name) { G_TYPE_NONE, 0); } +static inline guint _g_signal_newv(const gchar *name, const GType return_type, + const guint n_params, GType *const param_types) { + return g_signal_newv(name, G_TYPE_OBJECT, G_SIGNAL_RUN_FIRST | G_SIGNAL_ACTION, + NULL, NULL, NULL, g_cclosure_marshal_VOID__POINTER, + return_type, n_params, param_types); +} + static void init_i18n(const char *domain, const char *dir) { setlocale(LC_ALL, ""); bindtextdomain(domain, dir); diff --git a/vendor/github.com/gotk3/gotk3/glib/glib_since_2_58.go b/vendor/github.com/gotk3/gotk3/glib/glib_since_2_58.go new file mode 100644 index 0000000..11975f1 --- /dev/null +++ b/vendor/github.com/gotk3/gotk3/glib/glib_since_2_58.go @@ -0,0 +1,15 @@ +// Same copyright and license as the rest of the files in this project + +// +build !glib_2_40,!glib_2_42,!glib_2_44,!glib_2_46,!glib_2_48,!glib_2_50,!glib_2_52,!glib_2_54,!glib_2_56 + +package glib + +// #include +// #include +// #include +// #include "glib.go.h" +import "C" + +const ( + FORMAT_SIZE_BITS FormatSizeFlags = C.G_FORMAT_SIZE_BITS +) diff --git a/vendor/github.com/gotk3/gotk3/glib/gmain_loop.go b/vendor/github.com/gotk3/gotk3/glib/gmain_loop.go new file mode 100644 index 0000000..024b36a --- /dev/null +++ b/vendor/github.com/gotk3/gotk3/glib/gmain_loop.go @@ -0,0 +1,41 @@ +package glib + +// #include +// #include +// #include +// #include "glib.go.h" +import "C" + +type MainLoop C.GMainLoop + +// native returns a pointer to the underlying GMainContext. +func (v *MainLoop) native() *C.GMainLoop { + if v == nil { + return nil + } + return (*C.GMainLoop)(v) +} + +// MainLoopNew is a wrapper around g_main_loop_new(). +func MainLoopNew(ctx *MainContext, isRunning bool) *MainLoop { + c := C.g_main_loop_new(ctx.native(), gbool(isRunning)) + if c == nil { + return nil + } + return (*MainLoop)(c) +} + +// IsRunning is a wrapper around g_main_loop_is_running() +func (v *MainLoop) IsRunning() bool { + return gobool(C.g_main_loop_is_running(v.native())) +} + +// Run is a wrapper around g_main_loop_run() +func (v *MainLoop) Run() { + C.g_main_loop_run(v.native()) +} + +// Quit is a wrapper around g_main_loop_quit() +func (v *MainLoop) Quit() { + C.g_main_loop_quit(v.native()) +} diff --git a/vendor/github.com/gotk3/gotk3/glib/gvariant.go b/vendor/github.com/gotk3/gotk3/glib/gvariant.go index dacbcae..bf4c39a 100644 --- a/vendor/github.com/gotk3/gotk3/glib/gvariant.go +++ b/vendor/github.com/gotk3/gotk3/glib/gvariant.go @@ -88,7 +88,7 @@ func takeVariant(p *C.GVariant) *Variant { obj.Ref() } - runtime.SetFinalizer(obj, (*Variant).Unref) + runtime.SetFinalizer(obj, func(v *Variant) { FinalizerStrategy(v.Unref) }) return obj } @@ -234,7 +234,7 @@ func (v *Variant) GetVariant() *Variant { // The returned value is returned with full ownership transfer, // only Unref(), don't Ref(). obj := newVariant(c) - runtime.SetFinalizer(obj, (*Variant).Unref) + runtime.SetFinalizer(obj, func(v *Variant) { FinalizerStrategy(v.Unref) }) return obj } diff --git a/vendor/github.com/gotk3/gotk3/glib/gvarianttype.go b/vendor/github.com/gotk3/gotk3/glib/gvarianttype.go index 3723f43..ec776ea 100644 --- a/vendor/github.com/gotk3/gotk3/glib/gvarianttype.go +++ b/vendor/github.com/gotk3/gotk3/glib/gvarianttype.go @@ -52,7 +52,7 @@ func takeVariantType(v *C.GVariantType) *VariantType { return nil } obj := &VariantType{v} - runtime.SetFinalizer(obj, (*VariantType).Free) + runtime.SetFinalizer(obj, func(v *VariantType) { FinalizerStrategy(v.Free) }) return obj } diff --git a/vendor/github.com/gotk3/gotk3/gtk/application.go b/vendor/github.com/gotk3/gotk3/gtk/application.go index 7e39156..b3318e0 100644 --- a/vendor/github.com/gotk3/gotk3/gtk/application.go +++ b/vendor/github.com/gotk3/gotk3/gtk/application.go @@ -165,8 +165,6 @@ func (v *Application) GetWindows() *glib.List { glist.DataWrapper(func(ptr unsafe.Pointer) interface{} { return wrapWindow(glib.Take(ptr)) }) - runtime.SetFinalizer(glist, func(l *glib.List) { - l.Free() - }) + runtime.SetFinalizer(glist, func(v *glib.List) { glib.FinalizerStrategy(v.Free) }) return glist } diff --git a/vendor/github.com/gotk3/gotk3/gtk/color_chooser.go b/vendor/github.com/gotk3/gotk3/gtk/color_chooser.go index 28e824e..20ac65c 100644 --- a/vendor/github.com/gotk3/gotk3/gtk/color_chooser.go +++ b/vendor/github.com/gotk3/gotk3/gtk/color_chooser.go @@ -119,7 +119,7 @@ type ColorChooserDialog struct { ColorChooser } -// native returns a pointer to the underlying GtkColorChooserButton. +// native returns a pointer to the underlying GtkColorChooserDialog. func (v *ColorChooserDialog) native() *C.GtkColorChooserDialog { if v == nil || v.GObject == nil { return nil diff --git a/vendor/github.com/gotk3/gotk3/gtk/font_chooser.go b/vendor/github.com/gotk3/gotk3/gtk/font_chooser.go index 622e986..3d9916a 100644 --- a/vendor/github.com/gotk3/gotk3/gtk/font_chooser.go +++ b/vendor/github.com/gotk3/gotk3/gtk/font_chooser.go @@ -213,6 +213,61 @@ func (v *FontButton) GetTitle() string { return goString(c) } +/* + * GtkFontChooserDialog + */ + +// FontChooserDialog is a representation of GTK's GtkFontChooserDialog. +type FontChooserDialog struct { + Dialog + + // Interfaces + FontChooser +} + +// native returns a pointer to the underlying GtkFontChooserDialog. +func (v *FontChooserDialog) native() *C.GtkFontChooserDialog { + if v == nil || v.GObject == nil { + return nil + } + + p := unsafe.Pointer(v.GObject) + return C.toGtkFontChooserDialog(p) +} + +func marshalFontChooserDialog(p uintptr) (interface{}, error) { + c := C.g_value_get_object((*C.GValue)(unsafe.Pointer(p))) + return wrapFontChooserDialog(glib.Take(unsafe.Pointer(c))), nil +} + +func wrapFontChooserDialog(obj *glib.Object) *FontChooserDialog { + if obj == nil { + return nil + } + + dialog := wrapDialog(obj) + cc := wrapFontChooser(obj) + return &FontChooserDialog{*dialog, *cc} +} + +// FontChooserDialogNew() is a wrapper around gtk_font_chooser_dialog_new(). +func FontChooserDialogNew(title string, parent IWindow) (*FontChooserDialog, error) { + + cstr := C.CString(title) + defer C.free(unsafe.Pointer(cstr)) + + var w *C.GtkWindow = nil + if parent != nil { + w = parent.toWindow() + } + + c := C.gtk_font_chooser_dialog_new((*C.gchar)(cstr), w) + if c == nil { + return nil, nilPtrErr + } + return wrapFontChooserDialog(glib.Take(unsafe.Pointer(c))), nil +} + /* * GtkFontChooserWidget */ diff --git a/vendor/github.com/gotk3/gotk3/gtk/gtk.go b/vendor/github.com/gotk3/gotk3/gtk/gtk.go index 4153c76..6f9e951 100644 --- a/vendor/github.com/gotk3/gotk3/gtk/gtk.go +++ b/vendor/github.com/gotk3/gotk3/gtk/gtk.go @@ -216,6 +216,7 @@ func init() { {glib.Type(C.gtk_cell_area_get_type()), marshalCellArea}, {glib.Type(C.gtk_cell_area_context_get_type()), marshalCellAreaContext}, {glib.Type(C.gtk_cell_area_box_get_type()), marshalCellAreaBox}, + {glib.Type(C.gtk_viewport_get_type()), marshalViewport}, {glib.Type(C.gtk_volume_button_get_type()), marshalVolumeButton}, {glib.Type(C.gtk_widget_get_type()), marshalWidget}, {glib.Type(C.gtk_window_get_type()), marshalWindow}, @@ -3189,7 +3190,7 @@ func (v *Clipboard) WaitForContents(target gdk.Atom) (*SelectionData, error) { return nil, nilPtrErr } p := &SelectionData{c} - runtime.SetFinalizer(p, (*SelectionData).free) + runtime.SetFinalizer(p, func(l *SelectionData) { glib.FinalizerStrategy(l.free) }) return p, nil } @@ -4189,7 +4190,7 @@ func (v *Entry) GetIconGIcon(iconPos EntryIconPosition) (*glib.Icon, error) { } obj := &glib.Object{glib.ToGObject(unsafe.Pointer(c))} i := &glib.Icon{obj} - runtime.SetFinalizer(i, func(_ interface{}) { obj.Unref() }) + runtime.SetFinalizer(i, func(_ interface{}) { glib.FinalizerStrategy(obj.Unref) }) return i, nil } @@ -4853,6 +4854,16 @@ func (v *FileChooser) GetDoOverwriteConfirmation() bool { return gobool(c) } +// SetAction is a wrapper around gtk_file_chooser_set_action(). +func (v *FileChooser) SetAction(action FileChooserAction) { + C.gtk_file_chooser_set_action(v.native(), C.GtkFileChooserAction(action)) +} + +// GetAction is a wrapper around gtk_file_chooser_get_action(). +func (v *FileChooser) GetAction() FileChooserAction { + return FileChooserAction(C.gtk_file_chooser_get_action(v.native())) +} + // SetCreateFolders is a wrapper around gtk_file_chooser_set_create_folders(). func (v *FileChooser) SetCreateFolders(value bool) { C.gtk_file_chooser_set_create_folders(v.native(), gbool(value)) @@ -4895,11 +4906,26 @@ func (v *FileChooser) SetPreviewWidget(widget IWidget) { C.gtk_file_chooser_set_preview_widget(v.native(), widget.toWidget()) } +// GetPreviewWidget is a wrapper around gtk_file_chooser_get_preview_widget(). +func (v *FileChooser) GetPreviewWidget() (IWidget, error) { + c := C.gtk_file_chooser_get_preview_widget(v.native()) + if c == nil { + return nil, nilPtrErr + } + return castWidget(c) +} + // SetPreviewWidgetActive is a wrapper around gtk_file_chooser_set_preview_widget_active(). func (v *FileChooser) SetPreviewWidgetActive(active bool) { C.gtk_file_chooser_set_preview_widget_active(v.native(), gbool(active)) } +// GetPreviewWidgetActive is a wrapper around gtk_file_chooser_get_preview_widget_active(). +func (v *FileChooser) GetPreviewWidgetActive() bool { + c := C.gtk_file_chooser_get_preview_widget_active(v.native()) + return gobool(c) +} + // GetPreviewFilename is a wrapper around gtk_file_chooser_get_preview_filename(). func (v *FileChooser) GetPreviewFilename() string { c := C.gtk_file_chooser_get_preview_filename(v.native()) @@ -4960,6 +4986,20 @@ func (v *FileChooser) GetSelectMultiple() bool { return gobool(c) } +// SetExtraWidget is a wrapper around gtk_file_chooser_set_extra_widget(). +func (v *FileChooser) SetExtraWidget(widget IWidget) { + C.gtk_file_chooser_set_extra_widget(v.native(), widget.toWidget()) +} + +// GetExtraWidget is a wrapper around gtk_file_chooser_get_extra_widget(). +func (v *FileChooser) GetExtraWidget() (IWidget, error) { + c := C.gtk_file_chooser_get_extra_widget(v.native()) + if c == nil { + return nil, nilPtrErr + } + return castWidget(c) +} + /* * GtkFileChooserButton */ @@ -5551,6 +5591,15 @@ type IconTheme struct { Theme *C.GtkIconTheme } +// IconThemeNew is a wrapper around gtk_icon_theme_new(). +func IconThemeNew() (*IconTheme, error) { + c := C.gtk_icon_theme_new() + if c == nil { + return nil, nilPtrErr + } + return &IconTheme{c}, nil +} + // IconThemeGetDefault is a wrapper around gtk_icon_theme_get_default(). func IconThemeGetDefault() (*IconTheme, error) { c := C.gtk_icon_theme_get_default() @@ -5592,6 +5641,22 @@ func (v *IconTheme) HasIcon(iconName string) bool { return gobool(c) } +// AddResourcePath is a wrapper around gtk_icon_theme_add_resource_path(). +func (v *IconTheme) AddResourcePath(path string) { + cstr := C.CString(path) + defer C.free(unsafe.Pointer(cstr)) + + C.gtk_icon_theme_add_resource_path(v.Theme, (*C.gchar)(cstr)) +} + +// AppendSearchPath is a wrapper around gtk_icon_theme_append_search_path(). +func (v *IconTheme) AppendSearchPath(path string) { + cstr := C.CString(path) + defer C.free(unsafe.Pointer(cstr)) + + C.gtk_icon_theme_append_search_path(v.Theme, (*C.gchar)(cstr)) +} + /* * GtkImage */ @@ -5806,7 +5871,7 @@ func (v *Image) GetGIcon() (*glib.Icon, IconSize, error) { obj := &glib.Object{glib.ToGObject(unsafe.Pointer(gicon))} i := &glib.Icon{obj} - runtime.SetFinalizer(i, func(_ interface{}) { obj.Unref() }) + runtime.SetFinalizer(i, func(_ interface{}) { glib.FinalizerStrategy(obj.Unref) }) return i, IconSize(*size), nil } @@ -8583,7 +8648,7 @@ func (v *SelectionData) GetPixbuf() *gdk.Pixbuf { obj := &glib.Object{glib.ToGObject(unsafe.Pointer(c))} p := &gdk.Pixbuf{obj} - runtime.SetFinalizer(p, func(_ interface{}) { obj.Unref() }) + runtime.SetFinalizer(p, func(_ interface{}) { glib.FinalizerStrategy(obj.Unref) }) return p } @@ -9215,7 +9280,7 @@ func TargetEntryNew(target string, flags TargetFlags, info uint) (*TargetEntry, } t := (*TargetEntry)(unsafe.Pointer(c)) // causes setFinilizer error - // runtime.SetFinalizer(t, (*TargetEntry).free) + // runtime.SetFinalizer(t, func(v *TargetEntry) { glib.FinalizerStrategy(v.free) }) return t, nil } @@ -10493,7 +10558,7 @@ func (v *TreeIter) Copy() (*TreeIter, error) { return nil, nilPtrErr } t := &TreeIter{*c} - runtime.SetFinalizer(t, (*TreeIter).free) + runtime.SetFinalizer(t, func(v *TreeIter) { glib.FinalizerStrategy(v.free) }) return t, nil } @@ -10613,7 +10678,7 @@ func (v *TreeModel) GetPath(iter *TreeIter) (*TreePath, error) { return nil, nilPtrErr } p := &TreePath{c} - runtime.SetFinalizer(p, (*TreePath).free) + runtime.SetFinalizer(p, func(v *TreePath) { glib.FinalizerStrategy(v.free) }) return p, nil } @@ -10766,7 +10831,7 @@ func (v *TreeModelFilter) ConvertChildPathToPath(childPath *TreePath) *TreePath return nil } p := &TreePath{path} - runtime.SetFinalizer(p, (*TreePath).free) + runtime.SetFinalizer(p, func(v *TreePath) { glib.FinalizerStrategy(v.free) }) return p } @@ -10793,7 +10858,7 @@ func (v *TreeModelFilter) ConvertPathToChildPath(filterPath *TreePath) *TreePath return nil } p := &TreePath{path} - runtime.SetFinalizer(p, (*TreePath).free) + runtime.SetFinalizer(p, func(v *TreePath) { glib.FinalizerStrategy(v.free) }) return p } @@ -10890,7 +10955,7 @@ func TreePathNewFromString(path string) (*TreePath, error) { return nil, nilPtrErr } t := &TreePath{c} - runtime.SetFinalizer(t, (*TreePath).free) + runtime.SetFinalizer(t, func(v *TreePath) { glib.FinalizerStrategy(v.free) }) return t, nil } @@ -10916,7 +10981,7 @@ func TreePathNewFirst() (*TreePath, error) { return nil, nilPtrErr } t := &TreePath{c} - runtime.SetFinalizer(t, (*TreePath).free) + runtime.SetFinalizer(t, func(v *TreePath) { glib.FinalizerStrategy(v.free) }) return t, nil } @@ -10942,7 +11007,7 @@ func (v *TreePath) Copy() (*TreePath, error) { return nil, nilPtrErr } t := &TreePath{c} - runtime.SetFinalizer(t, (*TreePath).free) + runtime.SetFinalizer(t, func(v *TreePath) { glib.FinalizerStrategy(v.free) }) return t, nil } @@ -11028,9 +11093,11 @@ func (v *TreeSelection) GetSelectedRows(model ITreeModel) *glib.List { return &TreePath{(*C.GtkTreePath)(ptr)} }) runtime.SetFinalizer(glist, func(glist *glib.List) { - glist.FreeFull(func(item interface{}) { - path := item.(*TreePath) - C.gtk_tree_path_free(path.GtkTreePath) + glib.FinalizerStrategy(func() { + glist.FreeFull(func(item interface{}) { + path := item.(*TreePath) + C.gtk_tree_path_free(path.GtkTreePath) + }) }) }) @@ -11140,7 +11207,7 @@ func TreeRowReferenceNew(model *TreeModel, path *TreePath) (*TreeRowReference, e return nil, nilPtrErr } r := &TreeRowReference{c} - runtime.SetFinalizer(r, (*TreeRowReference).free) + runtime.SetFinalizer(r, func(v *TreeRowReference) { glib.FinalizerStrategy(v.free) }) return r, nil } @@ -11151,7 +11218,7 @@ func (v *TreeRowReference) GetPath() *TreePath { return nil } t := &TreePath{c} - runtime.SetFinalizer(t, (*TreePath).free) + runtime.SetFinalizer(t, func(v *TreePath) { glib.FinalizerStrategy(v.free) }) return t } @@ -11331,7 +11398,7 @@ func (v *TreeModelSort) ConvertChildPathToPath(childPath *TreePath) *TreePath { return nil } p := &TreePath{path} - runtime.SetFinalizer(p, (*TreePath).free) + runtime.SetFinalizer(p, func(v *TreePath) { glib.FinalizerStrategy(v.free) }) return p } @@ -11350,7 +11417,7 @@ func (v *TreeModelSort) ConvertPathToChildPath(sortPath *TreePath) *TreePath { return nil } p := &TreePath{path} - runtime.SetFinalizer(p, (*TreePath).free) + runtime.SetFinalizer(p, func(v *TreePath) { glib.FinalizerStrategy(v.free) }) return p } @@ -11651,6 +11718,12 @@ func wrapViewport(obj *glib.Object) *Viewport { } } +func marshalViewport(p uintptr) (interface{}, error) { + c := C.g_value_get_object((*C.GValue)(unsafe.Pointer(p))) + obj := glib.Take(unsafe.Pointer(c)) + return wrapViewport(obj), nil +} + func (v *Viewport) toViewport() *C.GtkViewport { if v == nil { return nil diff --git a/vendor/github.com/gotk3/gotk3/gtk/gtk.go.h b/vendor/github.com/gotk3/gotk3/gtk/gtk.go.h index 9e11052..05d185b 100644 --- a/vendor/github.com/gotk3/gotk3/gtk/gtk.go.h +++ b/vendor/github.com/gotk3/gotk3/gtk/gtk.go.h @@ -59,6 +59,10 @@ static GtkColorChooserDialog *toGtkColorChooserDialog(void *p) { return (GTK_COLOR_CHOOSER_DIALOG(p)); } +static GtkFontChooserDialog *toGtkFontChooserDialog(void *p) { + return (GTK_FONT_CHOOSER_DIALOG(p)); +} + static GtkDrawingArea *toGtkDrawingArea(void *p) { return (GTK_DRAWING_AREA(p)); } diff --git a/vendor/github.com/gotk3/gotk3/gtk/gtk_since_3_10.go b/vendor/github.com/gotk3/gotk3/gtk/gtk_since_3_10.go index dae8a75..953c9bf 100644 --- a/vendor/github.com/gotk3/gotk3/gtk/gtk_since_3_10.go +++ b/vendor/github.com/gotk3/gotk3/gtk/gtk_since_3_10.go @@ -916,3 +916,14 @@ func BuilderNewFromString(resource string) (*Builder, error) { // gtk_builder_lookup_callback_symbol // gtk_builder_set_application // gtk_builder_get_application + +/* + * GtkFileChooser + */ + +// GetCurrentName is a wrapper around gtk_file_chooser_get_current_name(). +func (v *FileChooser) GetCurrentName() string { + c := C.gtk_file_chooser_get_current_name(v.native()) + defer C.free(unsafe.Pointer(c)) + return goString(c) +} diff --git a/vendor/github.com/gotk3/gotk3/gtk/gtk_since_3_12.go b/vendor/github.com/gotk3/gotk3/gtk/gtk_since_3_12.go index ad13a24..f03e312 100644 --- a/vendor/github.com/gotk3/gotk3/gtk/gtk_since_3_12.go +++ b/vendor/github.com/gotk3/gotk3/gtk/gtk_since_3_12.go @@ -569,6 +569,6 @@ func TreePathNewFromIndicesv(indices []int) (*TreePath, error) { return nil, nilPtrErr } t := &TreePath{c} - runtime.SetFinalizer(t, (*TreePath).free) + runtime.SetFinalizer(t, func(l *TreePath) { glib.FinalizerStrategy(l.free) }) return t, nil } diff --git a/vendor/github.com/gotk3/gotk3/gtk/gtk_since_3_22.go b/vendor/github.com/gotk3/gotk3/gtk/gtk_since_3_22.go index ff1e3bf..768793e 100644 --- a/vendor/github.com/gotk3/gotk3/gtk/gtk_since_3_22.go +++ b/vendor/github.com/gotk3/gotk3/gtk/gtk_since_3_22.go @@ -5,7 +5,11 @@ package gtk // #include +// #include "gtk.go.h" import "C" +import ( + "unsafe" +) // Popup is a wrapper around gtk_popover_popup(). func (v *Popover) Popup() { @@ -17,6 +21,66 @@ func (v *Popover) Popdown() { C.gtk_popover_popdown(v.native()) } +/* + * GtkFileChooser + */ + +// AddChoice is a wrapper around gtk_file_chooser_add_choice(). +func (v *FileChooser) AddChoice(id, label string, options, optionLabels []string) { + cId := C.CString(id) + defer C.free(unsafe.Pointer(cId)) + + cLabel := C.CString(label) + defer C.free(unsafe.Pointer(cLabel)) + + if options == nil || optionLabels == nil { + C.gtk_file_chooser_add_choice(v.native(), (*C.gchar)(cId), (*C.gchar)(cLabel), nil, nil) + return + } + + cOptions := C.make_strings(C.int(len(options) + 1)) + for i, option := range options { + cstr := C.CString(option) + defer C.free(unsafe.Pointer(cstr)) + C.set_string(cOptions, C.int(i), (*C.gchar)(cstr)) + } + C.set_string(cOptions, C.int(len(options)), nil) + + cOptionLabels := C.make_strings(C.int(len(optionLabels) + 1)) + for i, optionLabel := range optionLabels { + cstr := C.CString(optionLabel) + defer C.free(unsafe.Pointer(cstr)) + C.set_string(cOptionLabels, C.int(i), (*C.gchar)(cstr)) + } + C.set_string(cOptionLabels, C.int(len(optionLabels)), nil) + + C.gtk_file_chooser_add_choice(v.native(), (*C.gchar)(cId), (*C.gchar)(cLabel), cOptions, cOptionLabels) +} + +// RemoveChoice is a wrapper around gtk_file_chooser_remove_choice(). +func (v *FileChooser) RemoveChoice(id string) { + cId := C.CString(id) + defer C.free(unsafe.Pointer(cId)) + C.gtk_file_chooser_remove_choice(v.native(), (*C.gchar)(cId)) +} + +// SetChoice is a wrapper around gtk_file_chooser_set_choice(). +func (v *FileChooser) SetChoice(id, option string) { + cId := C.CString(id) + defer C.free(unsafe.Pointer(cId)) + cOption := C.CString(option) + defer C.free(unsafe.Pointer(cOption)) + C.gtk_file_chooser_set_choice(v.native(), (*C.gchar)(cId), (*C.gchar)(cOption)) +} + +// GetChoice is a wrapper around gtk_file_chooser_get_choice(). +func (v *FileChooser) GetChoice(id string) string { + cId := C.CString(id) + defer C.free(unsafe.Pointer(cId)) + c := C.gtk_file_chooser_get_choice(v.native(), (*C.gchar)(cId)) + return C.GoString(c) +} + /* * GtkScrolledWindow */ diff --git a/vendor/github.com/gotk3/gotk3/gtk/icon_view.go b/vendor/github.com/gotk3/gotk3/gtk/icon_view.go index 3508c1f..149a4ec 100644 --- a/vendor/github.com/gotk3/gotk3/gtk/icon_view.go +++ b/vendor/github.com/gotk3/gotk3/gtk/icon_view.go @@ -125,7 +125,7 @@ func (v *IconView) GetPathAtPos(x, y int) *TreePath { if cpath != nil { path = &TreePath{cpath} - runtime.SetFinalizer(path, (*TreePath).free) + runtime.SetFinalizer(path, func(v *TreePath) { glib.FinalizerStrategy(v.free) }) } return path @@ -144,7 +144,7 @@ func (v *IconView) GetItemAtPos(x, y int) (*TreePath, *CellRenderer) { if cpath != nil { path = &TreePath{cpath} - runtime.SetFinalizer(path, (*TreePath).free) + runtime.SetFinalizer(path, func(v *TreePath) { glib.FinalizerStrategy(v.free) }) } if ccell != nil { @@ -181,7 +181,7 @@ func (v *IconView) GetCursor() (*TreePath, *CellRenderer) { if cpath != nil { path = &TreePath{cpath} - runtime.SetFinalizer(path, (*TreePath).free) + runtime.SetFinalizer(path, func(v *TreePath) { glib.FinalizerStrategy(v.free) }) } if ccell != nil { @@ -331,9 +331,11 @@ func (v *IconView) GetSelectedItems() *glib.List { return &TreePath{(*C.GtkTreePath)(ptr)} }) runtime.SetFinalizer(glist, func(glist *glib.List) { - glist.FreeFull(func(item interface{}) { - path := item.(*TreePath) - C.gtk_tree_path_free(path.GtkTreePath) + glib.FinalizerStrategy(func() { + glist.FreeFull(func(item interface{}) { + path := item.(*TreePath) + C.gtk_tree_path_free(path.GtkTreePath) + }) }) }) @@ -372,12 +374,12 @@ func (v *IconView) GetVisibleRange() (*TreePath, *TreePath) { if cpathStart != nil { pathStart = &TreePath{cpathStart} - runtime.SetFinalizer(pathStart, (*TreePath).free) + runtime.SetFinalizer(pathStart, func(v *TreePath) { glib.FinalizerStrategy(v.free) }) } if cpathEnd != nil { pathEnd = &TreePath{cpathEnd} - runtime.SetFinalizer(pathEnd, (*TreePath).free) + runtime.SetFinalizer(pathEnd, func(v *TreePath) { glib.FinalizerStrategy(v.free) }) } return pathStart, pathEnd @@ -423,12 +425,12 @@ func (v *IconView) GetTooltipContext(x, y int, keyboardTip bool) (*TreeModel, *T if cpath != nil { path = &TreePath{cpath} - runtime.SetFinalizer(path, (*TreePath).free) + runtime.SetFinalizer(path, func(v *TreePath) { glib.FinalizerStrategy(v.free) }) } if citer != nil { iter = &TreeIter{*citer} - runtime.SetFinalizer(iter, (*TreeIter).free) + runtime.SetFinalizer(iter, func(v *TreeIter) { glib.FinalizerStrategy(v.free) }) } return model, path, iter diff --git a/vendor/github.com/gotk3/gotk3/gtk/label.go b/vendor/github.com/gotk3/gotk3/gtk/label.go index c8a0846..a1f98a8 100644 --- a/vendor/github.com/gotk3/gotk3/gtk/label.go +++ b/vendor/github.com/gotk3/gotk3/gtk/label.go @@ -73,11 +73,22 @@ func (v *Label) SetText(str string) { // TODO: // gtk_label_set_text_with_mnemonic(). -// gtk_label_get_attributes(). + +// SetAttributes is a wrapper around "gtk_label_set_attributes". func (v *Label) SetAttributes(attributes *pango.AttrList) { C.gtk_label_set_attributes(v.native(), (*C.PangoAttrList)(unsafe.Pointer(attributes.Native()))) } +// GetAttributes is a wrapper around "gtk_label_get_attributes". +func (v *Label) GetAttributes() (*pango.AttrList, error) { + ptr := C.gtk_label_get_attributes(v.native()) + if ptr == nil { + return nil, nilPtrErr + } + + return pango.WrapAttrList(unsafe.Pointer(ptr)), nil +} + // SetMarkup is a wrapper around gtk_label_set_markup(). func (v *Label) SetMarkup(str string) { cstr := C.CString(str) diff --git a/vendor/github.com/gotk3/gotk3/gtk/print.go b/vendor/github.com/gotk3/gotk3/gtk/print.go index e65d04c..4b1b368 100644 --- a/vendor/github.com/gotk3/gotk3/gtk/print.go +++ b/vendor/github.com/gotk3/gotk3/gtk/print.go @@ -291,7 +291,7 @@ func (ps *PageSetup) SetOrientation(orientation PageOrientation) { func (ps *PageSetup) GetPaperSize() *PaperSize { c := C.gtk_page_setup_get_paper_size(ps.native()) p := &PaperSize{c} - runtime.SetFinalizer(p, (*PaperSize).free) + runtime.SetFinalizer(p, func(v *PaperSize) { glib.FinalizerStrategy(v.free) }) return p } @@ -471,7 +471,7 @@ func PaperSizeNew(name string) (*PaperSize, error) { } t := &PaperSize{c} - runtime.SetFinalizer(t, (*PaperSize).free) + runtime.SetFinalizer(t, func(v *PaperSize) { glib.FinalizerStrategy(v.free) }) return t, nil } @@ -487,7 +487,7 @@ func PaperSizeNewFromPPD(name, displayName string, width, height float64) (*Pape return nil, nilPtrErr } t := &PaperSize{c} - runtime.SetFinalizer(t, (*PaperSize).free) + runtime.SetFinalizer(t, func(v *PaperSize) { glib.FinalizerStrategy(v.free) }) return t, nil } @@ -503,7 +503,7 @@ func PaperSizeNewCustom(name, displayName string, width, height float64, unit Un return nil, nilPtrErr } t := &PaperSize{c} - runtime.SetFinalizer(t, (*PaperSize).free) + runtime.SetFinalizer(t, func(v *PaperSize) { glib.FinalizerStrategy(v.free) }) return t, nil } @@ -514,7 +514,7 @@ func (ps *PaperSize) Copy() (*PaperSize, error) { return nil, nilPtrErr } t := &PaperSize{c} - runtime.SetFinalizer(t, (*PaperSize).free) + runtime.SetFinalizer(t, func(v *PaperSize) { glib.FinalizerStrategy(v.free) }) return t, nil } @@ -542,9 +542,11 @@ func PaperSizeGetPaperSizes(includeCustom bool) *glib.List { }) runtime.SetFinalizer(glist, func(glist *glib.List) { - glist.FreeFull(func(item interface{}) { - ps := item.(*PaperSize) - C.gtk_paper_size_free(ps.GtkPaperSize) + glib.FinalizerStrategy(func() { + glist.FreeFull(func(item interface{}) { + ps := item.(*PaperSize) + C.gtk_paper_size_free(ps.GtkPaperSize) + }) }) }) @@ -1294,7 +1296,7 @@ func (ps *PrintSettings) GetPaperSize() (*PaperSize, error) { return nil, nilPtrErr } p := &PaperSize{c} - runtime.SetFinalizer(p, (*PaperSize).free) + runtime.SetFinalizer(p, func(v *PaperSize) { glib.FinalizerStrategy(v.free) }) return p, nil } diff --git a/vendor/github.com/gotk3/gotk3/gtk/print_since_3_16.go b/vendor/github.com/gotk3/gotk3/gtk/print_since_3_16.go index 486026d..3e5e098 100644 --- a/vendor/github.com/gotk3/gotk3/gtk/print_since_3_16.go +++ b/vendor/github.com/gotk3/gotk3/gtk/print_since_3_16.go @@ -10,6 +10,8 @@ import "C" import ( "runtime" "unsafe" + + "github.com/gotk3/gotk3/glib" ) // PaperSizeNewFromIpp is a wrapper around gtk_paper_size_new_from_ipp(). @@ -23,7 +25,7 @@ func PaperSizeNewFromIPP(name string, width, height float64) (*PaperSize, error) } t := &PaperSize{c} - runtime.SetFinalizer(t, (*PaperSize).free) + runtime.SetFinalizer(t, func(v *PaperSize) { glib.FinalizerStrategy(v.free) }) return t, nil } diff --git a/vendor/github.com/gotk3/gotk3/gtk/style.go b/vendor/github.com/gotk3/gotk3/gtk/style.go index c750152..fed1dd2 100644 --- a/vendor/github.com/gotk3/gotk3/gtk/style.go +++ b/vendor/github.com/gotk3/gotk3/gtk/style.go @@ -9,6 +9,7 @@ import "C" import ( "unsafe" + "github.com/gotk3/gotk3/cairo" "github.com/gotk3/gotk3/gdk" "github.com/gotk3/gotk3/glib" ) @@ -23,6 +24,18 @@ const ( STYLE_PROVIDER_PRIORITY_USER = C.GTK_STYLE_PROVIDER_PRIORITY_USER ) +// RenderBackground is a wrapper around gtk_render_background(). +func RenderBackground(context *StyleContext, cr *cairo.Context, x, y, w, h float64) { + C.gtk_render_background( + context.native(), + (*C.cairo_t)(unsafe.Pointer(cr.Native())), + C.gdouble(x), + C.gdouble(y), + C.gdouble(w), + C.gdouble(h), + ) +} + /* * GtkStyleContext */ diff --git a/vendor/github.com/gotk3/gotk3/gtk/text_view.go b/vendor/github.com/gotk3/gotk3/gtk/text_view.go index 5450304..9eba8fa 100644 --- a/vendor/github.com/gotk3/gotk3/gtk/text_view.go +++ b/vendor/github.com/gotk3/gotk3/gtk/text_view.go @@ -246,7 +246,7 @@ func (v *TextView) GetTabs() (*pango.TabArray, error) { return nil, nilPtrErr } ta := pango.WrapTabArray(uintptr(unsafe.Pointer(c))) - runtime.SetFinalizer(ta, (*pango.TabArray).Free) + runtime.SetFinalizer(ta, func(v *pango.TabArray) { glib.FinalizerStrategy(v.Free) }) return ta, nil } diff --git a/vendor/github.com/gotk3/gotk3/gtk/tree_view.go b/vendor/github.com/gotk3/gotk3/gtk/tree_view.go index 96817f7..20dc6be 100644 --- a/vendor/github.com/gotk3/gotk3/gtk/tree_view.go +++ b/vendor/github.com/gotk3/gotk3/gtk/tree_view.go @@ -121,7 +121,7 @@ func (v *TreeView) GetPathAtPos(x, y int) (*TreePath, *TreeViewColumn, int, int, if cpath != nil { path = &TreePath{cpath} - runtime.SetFinalizer(path, (*TreePath).free) + runtime.SetFinalizer(path, func(v *TreePath) { glib.FinalizerStrategy(v.free) }) } if ccol != nil { column = wrapTreeViewColumn(glib.Take(unsafe.Pointer(ccol))) @@ -237,9 +237,7 @@ func (v *TreeView) GetColumns() *glib.List { list.DataWrapper(func(ptr unsafe.Pointer) interface{} { return wrapTreeViewColumn(glib.Take(unsafe.Pointer(ptr))) }) - runtime.SetFinalizer(list, func(glist *glib.List) { - glist.Free() - }) + runtime.SetFinalizer(list, func(glist *glib.List) { glib.FinalizerStrategy(glist.Free) }) return list } @@ -287,7 +285,7 @@ func (v *TreeView) GetCursor() (p *TreePath, c *TreeViewColumn) { if path != nil { p = &TreePath{path} - runtime.SetFinalizer(p, (*TreePath).free) + runtime.SetFinalizer(p, func(v *TreePath) { glib.FinalizerStrategy(v.free) }) } if col != nil { @@ -530,7 +528,7 @@ func (v *TreeView) IsBlankAtPos(x, y int) (*TreePath, *TreeViewColumn, int, int, if cpath != nil { path = &TreePath{cpath} - runtime.SetFinalizer(path, (*TreePath).free) + runtime.SetFinalizer(path, func(v *TreePath) { glib.FinalizerStrategy(v.free) }) } if ccol != nil { column = wrapTreeViewColumn(glib.Take(unsafe.Pointer(ccol))) @@ -630,7 +628,7 @@ func (v *TreeView) GetDragDestRow() (path *TreePath, pos TreeViewDropPosition) { if cpath != nil { path = &TreePath{cpath} - runtime.SetFinalizer(path, (*TreePath).free) + runtime.SetFinalizer(path, func(v *TreePath) { glib.FinalizerStrategy(v.free) }) } return @@ -650,7 +648,7 @@ func (v *TreeView) GetDestRowAtPos(dragX, dragY int) (path *TreePath, pos TreeVi if cpath != nil { path = &TreePath{cpath} - runtime.SetFinalizer(path, (*TreePath).free) + runtime.SetFinalizer(path, func(v *TreePath) { glib.FinalizerStrategy(v.free) }) } return diff --git a/vendor/github.com/gotk3/gotk3/gtk/widget.go b/vendor/github.com/gotk3/gotk3/gtk/widget.go index 8842dc0..df92761 100644 --- a/vendor/github.com/gotk3/gotk3/gtk/widget.go +++ b/vendor/github.com/gotk3/gotk3/gtk/widget.go @@ -506,13 +506,21 @@ func (v *Widget) Unmap() { } // TODO: -//void gtk_widget_realize(GtkWidget *widget); -//void gtk_widget_unrealize(GtkWidget *widget); //void gtk_widget_draw(GtkWidget *widget, cairo_t *cr); //void gtk_widget_queue_resize(GtkWidget *widget); //void gtk_widget_queue_resize_no_redraw(GtkWidget *widget); // gtk_widget_queue_allocate(). +// Realize is a wrapper around gtk_widget_realize(). +func (v *Widget) Realize() { + C.gtk_widget_realize(v.native()) +} + +// Unrealize is a wrapper around gtk_widget_unrealize(). +func (v *Widget) Unrealize() { + C.gtk_widget_unrealize(v.native()) +} + // Event() is a wrapper around gtk_widget_event(). func (v *Widget) Event(event *gdk.Event) bool { c := C.gtk_widget_event(v.native(), @@ -906,7 +914,7 @@ func requisitionFromNative(requisitionNative *C.GtkRequisition) (*Requisition, e if requisition == nil { return nil, nilPtrErr } - runtime.SetFinalizer(requisition, (*Requisition).free) + runtime.SetFinalizer(requisition, func(l *Requisition) { glib.FinalizerStrategy(l.free) }) return requisition, nil } diff --git a/vendor/github.com/gotk3/gotk3/gtk/window.go b/vendor/github.com/gotk3/gotk3/gtk/window.go index 7e56e39..7e54b82 100644 --- a/vendor/github.com/gotk3/gotk3/gtk/window.go +++ b/vendor/github.com/gotk3/gotk3/gtk/window.go @@ -653,9 +653,7 @@ func WindowListToplevels() *glib.List { glist.DataWrapper(func(ptr unsafe.Pointer) interface{} { return wrapWindow(glib.Take(ptr)) }) - runtime.SetFinalizer(glist, func(l *glib.List) { - l.Free() - }) + runtime.SetFinalizer(glist, func(v *glib.List) { glib.FinalizerStrategy(v.Free) }) return glist } @@ -670,9 +668,7 @@ func WindowGetDefaultIconList() *glib.List { glist.DataWrapper(func(ptr unsafe.Pointer) interface{} { return &gdk.Pixbuf{glib.Take(ptr)} }) - runtime.SetFinalizer(glist, func(l *glib.List) { - l.Free() - }) + runtime.SetFinalizer(glist, func(v *glib.List) { glib.FinalizerStrategy(v.Free) }) return glist } @@ -687,9 +683,7 @@ func (v *Window) GetIconList() *glib.List { glist.DataWrapper(func(ptr unsafe.Pointer) interface{} { return &gdk.Pixbuf{glib.Take(ptr)} }) - runtime.SetFinalizer(glist, func(l *glib.List) { - l.Free() - }) + runtime.SetFinalizer(glist, func(v *glib.List) { glib.FinalizerStrategy(v.Free) }) return glist } diff --git a/vendor/github.com/gotk3/gotk3/gtk/windowgroup.go b/vendor/github.com/gotk3/gotk3/gtk/windowgroup.go index 1f60b9c..d65f4d2 100644 --- a/vendor/github.com/gotk3/gotk3/gtk/windowgroup.go +++ b/vendor/github.com/gotk3/gotk3/gtk/windowgroup.go @@ -83,9 +83,7 @@ func (v *WindowGroup) ListWindows() *glib.List { glist.DataWrapper(func(ptr unsafe.Pointer) interface{} { return wrapWindow(glib.Take(ptr)) }) - runtime.SetFinalizer(glist, func(l *glib.List) { - l.Free() - }) + runtime.SetFinalizer(glist, func(l *glib.List) { glib.FinalizerStrategy(l.Free) }) return glist } diff --git a/vendor/github.com/gotk3/gotk3/pango/pango-attributes.go b/vendor/github.com/gotk3/gotk3/pango/pango-attributes.go index 75ac4bb..9ed9d4e 100644 --- a/vendor/github.com/gotk3/gotk3/pango/pango-attributes.go +++ b/vendor/github.com/gotk3/gotk3/pango/pango-attributes.go @@ -52,30 +52,31 @@ func (v *Color) native() *C.PangoColor { return (*C.PangoColor)(unsafe.Pointer(v.pangoColor)) } +// Set sets the new values for the red, green, and blue color properties. func (v *Color) Set(red, green, blue uint16) { v.native().red = C.guint16(red) v.native().green = C.guint16(green) v.native().blue = C.guint16(blue) } +// Get returns the red, green, and blue color values. func (v *Color) Get() (red, green, blue uint16) { return uint16(v.native().red), uint16(v.native().green), uint16(v.native().blue) } -//PangoColor *pango_color_copy (const PangoColor *src); +// Copy is a wrapper around "pango_color_copy". func (v *Color) Copy(c *Color) *Color { w := new(Color) w.pangoColor = C.pango_color_copy(v.native()) return w } -//void pango_color_free (PangoColor *color); +// Free is a wrapper around "pango_color_free". func (v *Color) Free() { C.pango_color_free(v.native()) } -//gboolean pango_color_parse (PangoColor *color, -// const char *spec); +// Parse is a wrapper around "pango_color_parse". func (v *Color) Parse(spec string) bool { cstr := C.CString(spec) defer C.free(unsafe.Pointer(cstr)) @@ -83,7 +84,7 @@ func (v *Color) Parse(spec string) bool { return gobool(c) } -//gchar *pango_color_to_string(const PangoColor *color); +// ToString is a wrapper around "pango_color_to_string". func (v *Color) ToString() string { c := C.pango_color_to_string(v.native()) return C.GoString((*C.char)(c)) @@ -93,7 +94,7 @@ func (v *Color) ToString() string { // AttrList is a representation of PangoAttrList. type AttrList struct { - pangoAttrList *C.PangoAttrList + internal *C.PangoAttrList } // Native returns a pointer to the underlying PangoLayout. @@ -102,18 +103,56 @@ func (v *AttrList) Native() uintptr { } func (v *AttrList) native() *C.PangoAttrList { - return (*C.PangoAttrList)(unsafe.Pointer(v.pangoAttrList)) + return C.toPangoAttrList(unsafe.Pointer(v.internal)) } +func wrapAttrList(c *C.PangoAttrList) *AttrList { + if c == nil { + return nil + } + + return &AttrList{c} +} + +// WrapAttrList wraps a unsafe.Pointer as a AttrList. +// This function is exported for visibility in other gotk3 packages and +// is not meant to be used by applications. +func WrapAttrList(ptr unsafe.Pointer) *AttrList { + internal := C.toPangoAttrList(ptr) + if internal == nil { + return nil + } + + return &AttrList{internal} +} + +// Insert is a wrapper around "pango_attr_list_insert". func (v *AttrList) Insert(attribute *Attribute) { - C.pango_attr_list_insert(v.pangoAttrList, attribute.native()) + C.pango_attr_list_insert(v.internal, attribute.native()) +} + +// GetAttributes is a wrapper around "pango_attr_list_get_attributes". +func (v *AttrList) GetAttributes() (*glib.SList, error) { + orig := C.pango_attr_list_get_iterator(v.internal) + iter := C.pango_attr_iterator_copy(orig) + + gslist := (*C.struct__GSList)(C.pango_attr_iterator_get_attrs(iter)) + list := glib.WrapSList(uintptr(unsafe.Pointer(gslist))) + if list == nil { + return nil, nilPtrErr + } + + list.DataWrapper(func(ptr unsafe.Pointer) interface{} { + return &Attribute{(*C.PangoAttribute)(ptr)} + }) + + return list, nil } +// AttrListNew is a wrapper around "pango_attr_list_new". func AttrListNew() *AttrList { c := C.pango_attr_list_new() - attrList := new(AttrList) - attrList.pangoAttrList = c - return attrList + return wrapAttrList(c) } // AttrType is a representation of Pango's PangoAttrType. @@ -174,8 +213,7 @@ const ( // Attribute is a representation of Pango's PangoAttribute. type Attribute struct { - pangoAttribute *C.PangoAttribute - //start_index, end_index uint + internal *C.PangoAttribute } // Native returns a pointer to the underlying PangoColor. @@ -184,7 +222,27 @@ func (v *Attribute) Native() uintptr { } func (v *Attribute) native() *C.PangoAttribute { - return (*C.PangoAttribute)(unsafe.Pointer(v.pangoAttribute)) + return (*C.PangoAttribute)(unsafe.Pointer(v.internal)) +} + +// GetStartIndex returns the index of the start of the attribute application in the text. +func (v *Attribute) GetStartIndex() uint { + return uint(v.internal.start_index) +} + +// SetStartIndex sets the index of the start of the attribute application in the text. +func (v *Attribute) SetStartIndex(setting uint) { + v.internal.start_index = C.guint(setting) +} + +// GetEndIndex returns the index of the end of the attribute application in the text. +func (v *Attribute) GetEndIndex() uint { + return uint(v.internal.end_index) +} + +// SetEndIndex the index of the end of the attribute application in the text. +func (v *Attribute) SetEndIndex(setting uint) { + v.internal.end_index = C.guint(setting) } /* diff --git a/vendor/github.com/gotk3/gotk3/pango/pango-attributes.go.h b/vendor/github.com/gotk3/gotk3/pango/pango-attributes.go.h index 5f77732..1603751 100644 --- a/vendor/github.com/gotk3/gotk3/pango/pango-attributes.go.h +++ b/vendor/github.com/gotk3/gotk3/pango/pango-attributes.go.h @@ -20,4 +20,6 @@ #include #include -static PangoColor *toPangoColor(void *p) { return ((PangoColor *)(p)); } +static PangoColor * toPangoColor(void *p) { return ((PangoColor *)(p)); } + +static PangoAttrList * toPangoAttrList(void *p) { return ((PangoAttrList *)(p)); } diff --git a/vendor/github.com/gotk3/gotk3/pango/pango-attributes_since_1_44.go b/vendor/github.com/gotk3/gotk3/pango/pango-attributes_since_1_44.go index 3dd44f0..7f57815 100644 --- a/vendor/github.com/gotk3/gotk3/pango/pango-attributes_since_1_44.go +++ b/vendor/github.com/gotk3/gotk3/pango/pango-attributes_since_1_44.go @@ -1,4 +1,4 @@ -// +build !pango_1_42 +// +build !pango_1_36,!pango_1_38,!pango_1_40,!pango_1_42 package pango @@ -13,6 +13,6 @@ var ( func AttrInsertHyphensNew(insertHyphens bool) *Attribute { c := C.pango_attr_insert_hyphens_new(gbool(insertHyphens)) attr := new(Attribute) - attr.pangoAttribute = c + attr.internal = c return attr } diff --git a/vendor/github.com/gotk3/gotk3/pango/pango-layout.go b/vendor/github.com/gotk3/gotk3/pango/pango-layout.go index 6ac05c6..e017ccc 100644 --- a/vendor/github.com/gotk3/gotk3/pango/pango-layout.go +++ b/vendor/github.com/gotk3/gotk3/pango/pango-layout.go @@ -188,11 +188,7 @@ func (v *Layout) SetAttributes(attrs *AttrList) { // GetAttributes is a wrapper around pango_layout_get_attributes(). func (v *Layout) GetAttributes() *AttrList { c := C.pango_layout_get_attributes(v.native()) - - attrList := new(AttrList) - attrList.pangoAttrList = (*C.PangoAttrList)(c) - - return attrList + return wrapAttrList(c) } // SetText is a wrapper around pango_layout_set_text(). @@ -312,7 +308,7 @@ func (v *Layout) GetTabs() (*TabArray, error) { return nil, nilPtrErr } ta := wrapTabArray(c) - runtime.SetFinalizer(ta, (*TabArray).free) + runtime.SetFinalizer(ta, func(v *TabArray) { glib.FinalizerStrategy(v.free) }) return ta, nil } @@ -359,7 +355,7 @@ func TabArrayNew(initialSize int, positionsInPixels bool) *TabArray { c := C.pango_tab_array_new(C.gint(initialSize), gbool(positionsInPixels)) tabArray := new(TabArray) - runtime.SetFinalizer(tabArray, (*TabArray).free) + runtime.SetFinalizer(tabArray, func(v *TabArray) { glib.FinalizerStrategy(v.free) }) tabArray.pangoTabArray = (*C.PangoTabArray)(c) return tabArray } @@ -369,7 +365,7 @@ func TabArrayNew(initialSize int, positionsInPixels bool) *TabArray { // c := C.pango_tab_array_new_with_positions(C.gint(size), gbool(positionsInPixels), ...) // tabArray := new(TabArray) -// runtime.SetFinalizer(e, (*TabArray).free) +// runtime.SetFinalizer(e, func(v *TabArray) { glib.FinalizerStrategy(v.free) }) // tabArray.pangoTabArray = (*C.PangoTabArray)(c) // return tabArray // } @@ -381,7 +377,7 @@ func (v *TabArray) Copy() (*TabArray, error) { return nil, nilPtrErr } ta := wrapTabArray(c) - runtime.SetFinalizer(ta, (*TabArray).free) + runtime.SetFinalizer(ta, func(v *TabArray) { glib.FinalizerStrategy(v.free) }) return ta, nil } diff --git a/vendor/golang.org/x/sys/unix/asm_bsd_ppc64.s b/vendor/golang.org/x/sys/unix/asm_bsd_ppc64.s new file mode 100644 index 0000000..e5b9a84 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/asm_bsd_ppc64.s @@ -0,0 +1,31 @@ +// Copyright 2022 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build (darwin || freebsd || netbsd || openbsd) && gc +// +build darwin freebsd netbsd openbsd +// +build gc + +#include "textflag.h" + +// +// System call support for ppc64, BSD +// + +// Just jump to package syscall's implementation for all these functions. +// The runtime may know about them. + +TEXT ·Syscall(SB),NOSPLIT,$0-56 + JMP syscall·Syscall(SB) + +TEXT ·Syscall6(SB),NOSPLIT,$0-80 + JMP syscall·Syscall6(SB) + +TEXT ·Syscall9(SB),NOSPLIT,$0-104 + JMP syscall·Syscall9(SB) + +TEXT ·RawSyscall(SB),NOSPLIT,$0-56 + JMP syscall·RawSyscall(SB) + +TEXT ·RawSyscall6(SB),NOSPLIT,$0-80 + JMP syscall·RawSyscall6(SB) diff --git a/vendor/golang.org/x/sys/unix/dirent.go b/vendor/golang.org/x/sys/unix/dirent.go index e74e5ea..2499f97 100644 --- a/vendor/golang.org/x/sys/unix/dirent.go +++ b/vendor/golang.org/x/sys/unix/dirent.go @@ -2,8 +2,8 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris +//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos +// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos package unix diff --git a/vendor/golang.org/x/sys/unix/gccgo.go b/vendor/golang.org/x/sys/unix/gccgo.go index 0dee232..b06f52d 100644 --- a/vendor/golang.org/x/sys/unix/gccgo.go +++ b/vendor/golang.org/x/sys/unix/gccgo.go @@ -2,8 +2,8 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build gccgo && !aix -// +build gccgo,!aix +//go:build gccgo && !aix && !hurd +// +build gccgo,!aix,!hurd package unix diff --git a/vendor/golang.org/x/sys/unix/gccgo_c.c b/vendor/golang.org/x/sys/unix/gccgo_c.c index 2cb1fef..f98a1c5 100644 --- a/vendor/golang.org/x/sys/unix/gccgo_c.c +++ b/vendor/golang.org/x/sys/unix/gccgo_c.c @@ -2,8 +2,8 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -// +build gccgo -// +build !aix +//go:build gccgo && !aix && !hurd +// +build gccgo,!aix,!hurd #include #include diff --git a/vendor/golang.org/x/sys/unix/ioctl_linux.go b/vendor/golang.org/x/sys/unix/ioctl_linux.go index 884430b..0d12c08 100644 --- a/vendor/golang.org/x/sys/unix/ioctl_linux.go +++ b/vendor/golang.org/x/sys/unix/ioctl_linux.go @@ -4,9 +4,7 @@ package unix -import ( - "unsafe" -) +import "unsafe" // IoctlRetInt performs an ioctl operation specified by req on a device // associated with opened file descriptor fd, and returns a non-negative @@ -217,3 +215,19 @@ func IoctlKCMAttach(fd int, info KCMAttach) error { func IoctlKCMUnattach(fd int, info KCMUnattach) error { return ioctlPtr(fd, SIOCKCMUNATTACH, unsafe.Pointer(&info)) } + +// IoctlLoopGetStatus64 gets the status of the loop device associated with the +// file descriptor fd using the LOOP_GET_STATUS64 operation. +func IoctlLoopGetStatus64(fd int) (*LoopInfo64, error) { + var value LoopInfo64 + if err := ioctlPtr(fd, LOOP_GET_STATUS64, unsafe.Pointer(&value)); err != nil { + return nil, err + } + return &value, nil +} + +// IoctlLoopSetStatus64 sets the status of the loop device associated with the +// file descriptor fd using the LOOP_SET_STATUS64 operation. +func IoctlLoopSetStatus64(fd int, value *LoopInfo64) error { + return ioctlPtr(fd, LOOP_SET_STATUS64, unsafe.Pointer(value)) +} diff --git a/vendor/golang.org/x/sys/unix/ioctl_signed.go b/vendor/golang.org/x/sys/unix/ioctl_signed.go new file mode 100644 index 0000000..7def958 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/ioctl_signed.go @@ -0,0 +1,70 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build aix || solaris +// +build aix solaris + +package unix + +import ( + "unsafe" +) + +// ioctl itself should not be exposed directly, but additional get/set +// functions for specific types are permissible. + +// IoctlSetInt performs an ioctl operation which sets an integer value +// on fd, using the specified request number. +func IoctlSetInt(fd int, req int, value int) error { + return ioctl(fd, req, uintptr(value)) +} + +// IoctlSetPointerInt performs an ioctl operation which sets an +// integer value on fd, using the specified request number. The ioctl +// argument is called with a pointer to the integer value, rather than +// passing the integer value directly. +func IoctlSetPointerInt(fd int, req int, value int) error { + v := int32(value) + return ioctlPtr(fd, req, unsafe.Pointer(&v)) +} + +// IoctlSetWinsize performs an ioctl on fd with a *Winsize argument. +// +// To change fd's window size, the req argument should be TIOCSWINSZ. +func IoctlSetWinsize(fd int, req int, value *Winsize) error { + // TODO: if we get the chance, remove the req parameter and + // hardcode TIOCSWINSZ. + return ioctlPtr(fd, req, unsafe.Pointer(value)) +} + +// IoctlSetTermios performs an ioctl on fd with a *Termios. +// +// The req value will usually be TCSETA or TIOCSETA. +func IoctlSetTermios(fd int, req int, value *Termios) error { + // TODO: if we get the chance, remove the req parameter. + return ioctlPtr(fd, req, unsafe.Pointer(value)) +} + +// IoctlGetInt performs an ioctl operation which gets an integer value +// from fd, using the specified request number. +// +// A few ioctl requests use the return value as an output parameter; +// for those, IoctlRetInt should be used instead of this function. +func IoctlGetInt(fd int, req int) (int, error) { + var value int + err := ioctlPtr(fd, req, unsafe.Pointer(&value)) + return value, err +} + +func IoctlGetWinsize(fd int, req int) (*Winsize, error) { + var value Winsize + err := ioctlPtr(fd, req, unsafe.Pointer(&value)) + return &value, err +} + +func IoctlGetTermios(fd int, req int) (*Termios, error) { + var value Termios + err := ioctlPtr(fd, req, unsafe.Pointer(&value)) + return &value, err +} diff --git a/vendor/golang.org/x/sys/unix/ioctl.go b/vendor/golang.org/x/sys/unix/ioctl_unsigned.go similarity index 77% rename from vendor/golang.org/x/sys/unix/ioctl.go rename to vendor/golang.org/x/sys/unix/ioctl_unsigned.go index 6c7ad05..649913d 100644 --- a/vendor/golang.org/x/sys/unix/ioctl.go +++ b/vendor/golang.org/x/sys/unix/ioctl_unsigned.go @@ -2,13 +2,12 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris +//go:build darwin || dragonfly || freebsd || hurd || linux || netbsd || openbsd +// +build darwin dragonfly freebsd hurd linux netbsd openbsd package unix import ( - "runtime" "unsafe" ) @@ -27,7 +26,7 @@ func IoctlSetInt(fd int, req uint, value int) error { // passing the integer value directly. func IoctlSetPointerInt(fd int, req uint, value int) error { v := int32(value) - return ioctl(fd, req, uintptr(unsafe.Pointer(&v))) + return ioctlPtr(fd, req, unsafe.Pointer(&v)) } // IoctlSetWinsize performs an ioctl on fd with a *Winsize argument. @@ -36,9 +35,7 @@ func IoctlSetPointerInt(fd int, req uint, value int) error { func IoctlSetWinsize(fd int, req uint, value *Winsize) error { // TODO: if we get the chance, remove the req parameter and // hardcode TIOCSWINSZ. - err := ioctl(fd, req, uintptr(unsafe.Pointer(value))) - runtime.KeepAlive(value) - return err + return ioctlPtr(fd, req, unsafe.Pointer(value)) } // IoctlSetTermios performs an ioctl on fd with a *Termios. @@ -46,9 +43,7 @@ func IoctlSetWinsize(fd int, req uint, value *Winsize) error { // The req value will usually be TCSETA or TIOCSETA. func IoctlSetTermios(fd int, req uint, value *Termios) error { // TODO: if we get the chance, remove the req parameter. - err := ioctl(fd, req, uintptr(unsafe.Pointer(value))) - runtime.KeepAlive(value) - return err + return ioctlPtr(fd, req, unsafe.Pointer(value)) } // IoctlGetInt performs an ioctl operation which gets an integer value @@ -58,18 +53,18 @@ func IoctlSetTermios(fd int, req uint, value *Termios) error { // for those, IoctlRetInt should be used instead of this function. func IoctlGetInt(fd int, req uint) (int, error) { var value int - err := ioctl(fd, req, uintptr(unsafe.Pointer(&value))) + err := ioctlPtr(fd, req, unsafe.Pointer(&value)) return value, err } func IoctlGetWinsize(fd int, req uint) (*Winsize, error) { var value Winsize - err := ioctl(fd, req, uintptr(unsafe.Pointer(&value))) + err := ioctlPtr(fd, req, unsafe.Pointer(&value)) return &value, err } func IoctlGetTermios(fd int, req uint) (*Termios, error) { var value Termios - err := ioctl(fd, req, uintptr(unsafe.Pointer(&value))) + err := ioctlPtr(fd, req, unsafe.Pointer(&value)) return &value, err } diff --git a/vendor/golang.org/x/sys/unix/ioctl_zos.go b/vendor/golang.org/x/sys/unix/ioctl_zos.go index 5384e7d..cdc21bf 100644 --- a/vendor/golang.org/x/sys/unix/ioctl_zos.go +++ b/vendor/golang.org/x/sys/unix/ioctl_zos.go @@ -17,25 +17,23 @@ import ( // IoctlSetInt performs an ioctl operation which sets an integer value // on fd, using the specified request number. -func IoctlSetInt(fd int, req uint, value int) error { +func IoctlSetInt(fd int, req int, value int) error { return ioctl(fd, req, uintptr(value)) } // IoctlSetWinsize performs an ioctl on fd with a *Winsize argument. // // To change fd's window size, the req argument should be TIOCSWINSZ. -func IoctlSetWinsize(fd int, req uint, value *Winsize) error { +func IoctlSetWinsize(fd int, req int, value *Winsize) error { // TODO: if we get the chance, remove the req parameter and // hardcode TIOCSWINSZ. - err := ioctl(fd, req, uintptr(unsafe.Pointer(value))) - runtime.KeepAlive(value) - return err + return ioctlPtr(fd, req, unsafe.Pointer(value)) } // IoctlSetTermios performs an ioctl on fd with a *Termios. // // The req value is expected to be TCSETS, TCSETSW, or TCSETSF -func IoctlSetTermios(fd int, req uint, value *Termios) error { +func IoctlSetTermios(fd int, req int, value *Termios) error { if (req != TCSETS) && (req != TCSETSW) && (req != TCSETSF) { return ENOSYS } @@ -49,22 +47,22 @@ func IoctlSetTermios(fd int, req uint, value *Termios) error { // // A few ioctl requests use the return value as an output parameter; // for those, IoctlRetInt should be used instead of this function. -func IoctlGetInt(fd int, req uint) (int, error) { +func IoctlGetInt(fd int, req int) (int, error) { var value int - err := ioctl(fd, req, uintptr(unsafe.Pointer(&value))) + err := ioctlPtr(fd, req, unsafe.Pointer(&value)) return value, err } -func IoctlGetWinsize(fd int, req uint) (*Winsize, error) { +func IoctlGetWinsize(fd int, req int) (*Winsize, error) { var value Winsize - err := ioctl(fd, req, uintptr(unsafe.Pointer(&value))) + err := ioctlPtr(fd, req, unsafe.Pointer(&value)) return &value, err } // IoctlGetTermios performs an ioctl on fd with a *Termios. // // The req value is expected to be TCGETS -func IoctlGetTermios(fd int, req uint) (*Termios, error) { +func IoctlGetTermios(fd int, req int) (*Termios, error) { var value Termios if req != TCGETS { return &value, ENOSYS diff --git a/vendor/golang.org/x/sys/unix/mkall.sh b/vendor/golang.org/x/sys/unix/mkall.sh index dcef4de..e6f31d3 100644 --- a/vendor/golang.org/x/sys/unix/mkall.sh +++ b/vendor/golang.org/x/sys/unix/mkall.sh @@ -50,7 +50,7 @@ if [[ "$GOOS" = "linux" ]]; then # Use the Docker-based build system # Files generated through docker (use $cmd so you can Ctl-C the build or run) $cmd docker build --tag generate:$GOOS $GOOS - $cmd docker run --interactive --tty --volume $(cd -- "$(dirname -- "$0")/.." && /bin/pwd):/build generate:$GOOS + $cmd docker run --interactive --tty --volume $(cd -- "$(dirname -- "$0")/.." && pwd):/build generate:$GOOS exit fi @@ -73,12 +73,12 @@ aix_ppc64) darwin_amd64) mkerrors="$mkerrors -m64" mktypes="GOARCH=$GOARCH go tool cgo -godefs" - mkasm="go run mkasm_darwin.go" + mkasm="go run mkasm.go" ;; darwin_arm64) mkerrors="$mkerrors -m64" mktypes="GOARCH=$GOARCH go tool cgo -godefs" - mkasm="go run mkasm_darwin.go" + mkasm="go run mkasm.go" ;; dragonfly_amd64) mkerrors="$mkerrors -m64" @@ -142,42 +142,60 @@ netbsd_arm64) mktypes="GOARCH=$GOARCH go tool cgo -godefs" ;; openbsd_386) + mkasm="go run mkasm.go" mkerrors="$mkerrors -m32" - mksyscall="go run mksyscall.go -l32 -openbsd" + mksyscall="go run mksyscall.go -l32 -openbsd -libc" mksysctl="go run mksysctl_openbsd.go" - mksysnum="go run mksysnum.go 'https://cvsweb.openbsd.org/cgi-bin/cvsweb/~checkout~/src/sys/kern/syscalls.master'" mktypes="GOARCH=$GOARCH go tool cgo -godefs" ;; openbsd_amd64) + mkasm="go run mkasm.go" mkerrors="$mkerrors -m64" - mksyscall="go run mksyscall.go -openbsd" + mksyscall="go run mksyscall.go -openbsd -libc" mksysctl="go run mksysctl_openbsd.go" - mksysnum="go run mksysnum.go 'https://cvsweb.openbsd.org/cgi-bin/cvsweb/~checkout~/src/sys/kern/syscalls.master'" mktypes="GOARCH=$GOARCH go tool cgo -godefs" ;; openbsd_arm) + mkasm="go run mkasm.go" mkerrors="$mkerrors" - mksyscall="go run mksyscall.go -l32 -openbsd -arm" + mksyscall="go run mksyscall.go -l32 -openbsd -arm -libc" mksysctl="go run mksysctl_openbsd.go" - mksysnum="go run mksysnum.go 'https://cvsweb.openbsd.org/cgi-bin/cvsweb/~checkout~/src/sys/kern/syscalls.master'" # Let the type of C char be signed for making the bare syscall # API consistent across platforms. mktypes="GOARCH=$GOARCH go tool cgo -godefs -- -fsigned-char" ;; openbsd_arm64) + mkasm="go run mkasm.go" mkerrors="$mkerrors -m64" - mksyscall="go run mksyscall.go -openbsd" + mksyscall="go run mksyscall.go -openbsd -libc" mksysctl="go run mksysctl_openbsd.go" - mksysnum="go run mksysnum.go 'https://cvsweb.openbsd.org/cgi-bin/cvsweb/~checkout~/src/sys/kern/syscalls.master'" # Let the type of C char be signed for making the bare syscall # API consistent across platforms. mktypes="GOARCH=$GOARCH go tool cgo -godefs -- -fsigned-char" ;; openbsd_mips64) + mkasm="go run mkasm.go" mkerrors="$mkerrors -m64" - mksyscall="go run mksyscall.go -openbsd" + mksyscall="go run mksyscall.go -openbsd -libc" + mksysctl="go run mksysctl_openbsd.go" + # Let the type of C char be signed for making the bare syscall + # API consistent across platforms. + mktypes="GOARCH=$GOARCH go tool cgo -godefs -- -fsigned-char" + ;; +openbsd_ppc64) + mkasm="go run mkasm.go" + mkerrors="$mkerrors -m64" + mksyscall="go run mksyscall.go -openbsd -libc" + mksysctl="go run mksysctl_openbsd.go" + # Let the type of C char be signed for making the bare syscall + # API consistent across platforms. + mktypes="GOARCH=$GOARCH go tool cgo -godefs -- -fsigned-char" + ;; +openbsd_riscv64) + mkasm="go run mkasm.go" + mkerrors="$mkerrors -m64" + mksyscall="go run mksyscall.go -openbsd -libc" mksysctl="go run mksysctl_openbsd.go" - mksysnum="go run mksysnum.go 'https://cvsweb.openbsd.org/cgi-bin/cvsweb/~checkout~/src/sys/kern/syscalls.master'" # Let the type of C char be signed for making the bare syscall # API consistent across platforms. mktypes="GOARCH=$GOARCH go tool cgo -godefs -- -fsigned-char" @@ -214,11 +232,6 @@ esac if [ "$GOOSARCH" == "aix_ppc64" ]; then # aix/ppc64 script generates files instead of writing to stdin. echo "$mksyscall -tags $GOOS,$GOARCH $syscall_goos $GOOSARCH_in && gofmt -w zsyscall_$GOOSARCH.go && gofmt -w zsyscall_"$GOOSARCH"_gccgo.go && gofmt -w zsyscall_"$GOOSARCH"_gc.go " ; - elif [ "$GOOS" == "darwin" ]; then - # 1.12 and later, syscalls via libSystem - echo "$mksyscall -tags $GOOS,$GOARCH,go1.12 $syscall_goos $GOOSARCH_in |gofmt >zsyscall_$GOOSARCH.go"; - # 1.13 and later, syscalls via libSystem (including syscallPtr) - echo "$mksyscall -tags $GOOS,$GOARCH,go1.13 syscall_darwin.1_13.go |gofmt >zsyscall_$GOOSARCH.1_13.go"; elif [ "$GOOS" == "illumos" ]; then # illumos code generation requires a --illumos switch echo "$mksyscall -illumos -tags illumos,$GOARCH syscall_illumos.go |gofmt > zsyscall_illumos_$GOARCH.go"; @@ -232,5 +245,5 @@ esac if [ -n "$mksysctl" ]; then echo "$mksysctl |gofmt >$zsysctl"; fi if [ -n "$mksysnum" ]; then echo "$mksysnum |gofmt >zsysnum_$GOOSARCH.go"; fi if [ -n "$mktypes" ]; then echo "$mktypes types_$GOOS.go | go run mkpost.go > ztypes_$GOOSARCH.go"; fi - if [ -n "$mkasm" ]; then echo "$mkasm $GOARCH"; fi + if [ -n "$mkasm" ]; then echo "$mkasm $GOOS $GOARCH"; fi ) | $run diff --git a/vendor/golang.org/x/sys/unix/mkerrors.sh b/vendor/golang.org/x/sys/unix/mkerrors.sh index 2ab44aa..0c4d149 100644 --- a/vendor/golang.org/x/sys/unix/mkerrors.sh +++ b/vendor/golang.org/x/sys/unix/mkerrors.sh @@ -66,6 +66,7 @@ includes_Darwin=' #include #include #include +#include #include #include #include @@ -203,6 +204,7 @@ struct ltchars { #include #include #include +#include #include #include #include @@ -517,10 +519,11 @@ ccflags="$@" $2 ~ /^LOCK_(SH|EX|NB|UN)$/ || $2 ~ /^LO_(KEY|NAME)_SIZE$/ || $2 ~ /^LOOP_(CLR|CTL|GET|SET)_/ || - $2 ~ /^(AF|SOCK|SO|SOL|IPPROTO|IP|IPV6|TCP|MCAST|EVFILT|NOTE|SHUT|PROT|MAP|MFD|T?PACKET|MSG|SCM|MCL|DT|MADV|PR|LOCAL|TCPOPT)_/ || + $2 ~ /^(AF|SOCK|SO|SOL|IPPROTO|IP|IPV6|TCP|MCAST|EVFILT|NOTE|SHUT|PROT|MAP|MREMAP|MFD|T?PACKET|MSG|SCM|MCL|DT|MADV|PR|LOCAL|TCPOPT|UDP)_/ || $2 ~ /^NFC_(GENL|PROTO|COMM|RF|SE|DIRECTION|LLCP|SOCKPROTO)_/ || $2 ~ /^NFC_.*_(MAX)?SIZE$/ || $2 ~ /^RAW_PAYLOAD_/ || + $2 ~ /^[US]F_/ || $2 ~ /^TP_STATUS_/ || $2 ~ /^FALLOC_/ || $2 ~ /^ICMPV?6?_(FILTER|SEC)/ || @@ -642,7 +645,7 @@ errors=$( signals=$( echo '#include ' | $CC -x c - -E -dM $ccflags | awk '$1=="#define" && $2 ~ /^SIG[A-Z0-9]+$/ { print $2 }' | - egrep -v '(SIGSTKSIZE|SIGSTKSZ|SIGRT|SIGMAX64)' | + grep -v 'SIGSTKSIZE\|SIGSTKSZ\|SIGRT\|SIGMAX64' | sort ) @@ -652,7 +655,7 @@ echo '#include ' | $CC -x c - -E -dM $ccflags | sort >_error.grep echo '#include ' | $CC -x c - -E -dM $ccflags | awk '$1=="#define" && $2 ~ /^SIG[A-Z0-9]+$/ { print "^\t" $2 "[ \t]*=" }' | - egrep -v '(SIGSTKSIZE|SIGSTKSZ|SIGRT|SIGMAX64)' | + grep -v 'SIGSTKSIZE\|SIGSTKSZ\|SIGRT\|SIGMAX64' | sort >_signal.grep echo '// mkerrors.sh' "$@" @@ -738,7 +741,8 @@ main(void) e = errors[i].num; if(i > 0 && errors[i-1].num == e) continue; - strcpy(buf, strerror(e)); + strncpy(buf, strerror(e), sizeof(buf) - 1); + buf[sizeof(buf) - 1] = '\0'; // lowercase first letter: Bad -> bad, but STREAM -> STREAM. if(A <= buf[0] && buf[0] <= Z && a <= buf[1] && buf[1] <= z) buf[0] += a - A; @@ -757,7 +761,8 @@ main(void) e = signals[i].num; if(i > 0 && signals[i-1].num == e) continue; - strcpy(buf, strsignal(e)); + strncpy(buf, strsignal(e), sizeof(buf) - 1); + buf[sizeof(buf) - 1] = '\0'; // lowercase first letter: Bad -> bad, but STREAM -> STREAM. if(A <= buf[0] && buf[0] <= Z && a <= buf[1] && buf[1] <= z) buf[0] += a - A; diff --git a/vendor/golang.org/x/sys/unix/mremap.go b/vendor/golang.org/x/sys/unix/mremap.go new file mode 100644 index 0000000..86213c0 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/mremap.go @@ -0,0 +1,40 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build linux +// +build linux + +package unix + +import "unsafe" + +type mremapMmapper struct { + mmapper + mremap func(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (xaddr uintptr, err error) +} + +func (m *mremapMmapper) Mremap(oldData []byte, newLength int, flags int) (data []byte, err error) { + if newLength <= 0 || len(oldData) == 0 || len(oldData) != cap(oldData) || flags&MREMAP_FIXED != 0 { + return nil, EINVAL + } + + pOld := &oldData[cap(oldData)-1] + m.Lock() + defer m.Unlock() + bOld := m.active[pOld] + if bOld == nil || &bOld[0] != &oldData[0] { + return nil, EINVAL + } + newAddr, errno := m.mremap(uintptr(unsafe.Pointer(&bOld[0])), uintptr(len(bOld)), uintptr(newLength), flags, 0) + if errno != nil { + return nil, errno + } + bNew := unsafe.Slice((*byte)(unsafe.Pointer(newAddr)), newLength) + pNew := &bNew[cap(bNew)-1] + if flags&MREMAP_DONTUNMAP == 0 { + delete(m.active, pOld) + } + m.active[pNew] = bNew + return bNew, nil +} diff --git a/vendor/golang.org/x/sys/unix/ptrace_darwin.go b/vendor/golang.org/x/sys/unix/ptrace_darwin.go index 463c3ef..39dba6c 100644 --- a/vendor/golang.org/x/sys/unix/ptrace_darwin.go +++ b/vendor/golang.org/x/sys/unix/ptrace_darwin.go @@ -7,6 +7,12 @@ package unix +import "unsafe" + func ptrace(request int, pid int, addr uintptr, data uintptr) error { return ptrace1(request, pid, addr, data) } + +func ptracePtr(request int, pid int, addr uintptr, data unsafe.Pointer) error { + return ptrace1Ptr(request, pid, addr, data) +} diff --git a/vendor/golang.org/x/sys/unix/ptrace_ios.go b/vendor/golang.org/x/sys/unix/ptrace_ios.go index ed0509a..9ea6633 100644 --- a/vendor/golang.org/x/sys/unix/ptrace_ios.go +++ b/vendor/golang.org/x/sys/unix/ptrace_ios.go @@ -7,6 +7,12 @@ package unix +import "unsafe" + func ptrace(request int, pid int, addr uintptr, data uintptr) (err error) { return ENOTSUP } + +func ptracePtr(request int, pid int, addr uintptr, data unsafe.Pointer) (err error) { + return ENOTSUP +} diff --git a/vendor/golang.org/x/sys/unix/sockcmsg_unix.go b/vendor/golang.org/x/sys/unix/sockcmsg_unix.go index 453a942..3865943 100644 --- a/vendor/golang.org/x/sys/unix/sockcmsg_unix.go +++ b/vendor/golang.org/x/sys/unix/sockcmsg_unix.go @@ -52,6 +52,20 @@ func ParseSocketControlMessage(b []byte) ([]SocketControlMessage, error) { return msgs, nil } +// ParseOneSocketControlMessage parses a single socket control message from b, returning the message header, +// message data (a slice of b), and the remainder of b after that single message. +// When there are no remaining messages, len(remainder) == 0. +func ParseOneSocketControlMessage(b []byte) (hdr Cmsghdr, data []byte, remainder []byte, err error) { + h, dbuf, err := socketControlMessageHeaderAndData(b) + if err != nil { + return Cmsghdr{}, nil, nil, err + } + if i := cmsgAlignOf(int(h.Len)); i < len(b) { + remainder = b[i:] + } + return *h, dbuf, remainder, nil +} + func socketControlMessageHeaderAndData(b []byte) (*Cmsghdr, []byte, error) { h := (*Cmsghdr)(unsafe.Pointer(&b[0])) if h.Len < SizeofCmsghdr || uint64(h.Len) > uint64(len(b)) { diff --git a/vendor/golang.org/x/sys/unix/str.go b/vendor/golang.org/x/sys/unix/str.go deleted file mode 100644 index 8ba89ed..0000000 --- a/vendor/golang.org/x/sys/unix/str.go +++ /dev/null @@ -1,27 +0,0 @@ -// Copyright 2009 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris - -package unix - -func itoa(val int) string { // do it here rather than with fmt to avoid dependency - if val < 0 { - return "-" + uitoa(uint(-val)) - } - return uitoa(uint(val)) -} - -func uitoa(val uint) string { - var buf [32]byte // big enough for int64 - i := len(buf) - 1 - for val >= 10 { - buf[i] = byte(val%10 + '0') - i-- - val /= 10 - } - buf[i] = byte(val + '0') - return string(buf[i:]) -} diff --git a/vendor/golang.org/x/sys/unix/syscall.go b/vendor/golang.org/x/sys/unix/syscall.go index 649fa87..63e8c83 100644 --- a/vendor/golang.org/x/sys/unix/syscall.go +++ b/vendor/golang.org/x/sys/unix/syscall.go @@ -29,8 +29,6 @@ import ( "bytes" "strings" "unsafe" - - "golang.org/x/sys/internal/unsafeheader" ) // ByteSliceFromString returns a NUL-terminated slice of bytes @@ -82,13 +80,7 @@ func BytePtrToString(p *byte) string { ptr = unsafe.Pointer(uintptr(ptr) + 1) } - var s []byte - h := (*unsafeheader.Slice)(unsafe.Pointer(&s)) - h.Data = unsafe.Pointer(p) - h.Len = n - h.Cap = n - - return string(s) + return string(unsafe.Slice(p, n)) } // Single-word zero for use when we need a valid pointer to 0 bytes. diff --git a/vendor/golang.org/x/sys/unix/syscall_aix.go b/vendor/golang.org/x/sys/unix/syscall_aix.go index ac579c6..c406ae0 100644 --- a/vendor/golang.org/x/sys/unix/syscall_aix.go +++ b/vendor/golang.org/x/sys/unix/syscall_aix.go @@ -218,13 +218,62 @@ func Accept(fd int) (nfd int, sa Sockaddr, err error) { } func recvmsgRaw(fd int, iov []Iovec, oob []byte, flags int, rsa *RawSockaddrAny) (n, oobn int, recvflags int, err error) { - // Recvmsg not implemented on AIX - return -1, -1, -1, ENOSYS + var msg Msghdr + msg.Name = (*byte)(unsafe.Pointer(rsa)) + msg.Namelen = uint32(SizeofSockaddrAny) + var dummy byte + if len(oob) > 0 { + // receive at least one normal byte + if emptyIovecs(iov) { + var iova [1]Iovec + iova[0].Base = &dummy + iova[0].SetLen(1) + iov = iova[:] + } + msg.Control = (*byte)(unsafe.Pointer(&oob[0])) + msg.SetControllen(len(oob)) + } + if len(iov) > 0 { + msg.Iov = &iov[0] + msg.SetIovlen(len(iov)) + } + if n, err = recvmsg(fd, &msg, flags); n == -1 { + return + } + oobn = int(msg.Controllen) + recvflags = int(msg.Flags) + return } func sendmsgN(fd int, iov []Iovec, oob []byte, ptr unsafe.Pointer, salen _Socklen, flags int) (n int, err error) { - // SendmsgN not implemented on AIX - return -1, ENOSYS + var msg Msghdr + msg.Name = (*byte)(unsafe.Pointer(ptr)) + msg.Namelen = uint32(salen) + var dummy byte + var empty bool + if len(oob) > 0 { + // send at least one normal byte + empty = emptyIovecs(iov) + if empty { + var iova [1]Iovec + iova[0].Base = &dummy + iova[0].SetLen(1) + iov = iova[:] + } + msg.Control = (*byte)(unsafe.Pointer(&oob[0])) + msg.SetControllen(len(oob)) + } + if len(iov) > 0 { + msg.Iov = &iov[0] + msg.SetIovlen(len(iov)) + } + if n, err = sendmsg(fd, &msg, flags); err != nil { + return 0, err + } + if len(oob) > 0 && empty { + n = 0 + } + return n, nil } func anyToSockaddr(fd int, rsa *RawSockaddrAny) (Sockaddr, error) { @@ -243,9 +292,7 @@ func anyToSockaddr(fd int, rsa *RawSockaddrAny) (Sockaddr, error) { break } } - - bytes := (*[len(pp.Path)]byte)(unsafe.Pointer(&pp.Path[0]))[0:n] - sa.Name = string(bytes) + sa.Name = string(unsafe.Slice((*byte)(unsafe.Pointer(&pp.Path[0])), n)) return sa, nil case AF_INET: @@ -361,7 +408,8 @@ func (w WaitStatus) CoreDump() bool { return w&0x80 == 0x80 } func (w WaitStatus) TrapCause() int { return -1 } -//sys ioctl(fd int, req uint, arg uintptr) (err error) +//sys ioctl(fd int, req int, arg uintptr) (err error) +//sys ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) = ioctl // fcntl must never be called with cmd=F_DUP2FD because it doesn't work on AIX // There is no way to create a custom fcntl and to keep //sys fcntl easily, diff --git a/vendor/golang.org/x/sys/unix/syscall_aix_ppc.go b/vendor/golang.org/x/sys/unix/syscall_aix_ppc.go index e92a0be..f2871fa 100644 --- a/vendor/golang.org/x/sys/unix/syscall_aix_ppc.go +++ b/vendor/golang.org/x/sys/unix/syscall_aix_ppc.go @@ -8,7 +8,6 @@ package unix //sysnb Getrlimit(resource int, rlim *Rlimit) (err error) = getrlimit64 -//sysnb Setrlimit(resource int, rlim *Rlimit) (err error) = setrlimit64 //sys Seek(fd int, offset int64, whence int) (off int64, err error) = lseek64 //sys mmap(addr uintptr, length uintptr, prot int, flags int, fd int, offset int64) (xaddr uintptr, err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_aix_ppc64.go b/vendor/golang.org/x/sys/unix/syscall_aix_ppc64.go index 16eed17..75718ec 100644 --- a/vendor/golang.org/x/sys/unix/syscall_aix_ppc64.go +++ b/vendor/golang.org/x/sys/unix/syscall_aix_ppc64.go @@ -8,7 +8,6 @@ package unix //sysnb Getrlimit(resource int, rlim *Rlimit) (err error) -//sysnb Setrlimit(resource int, rlim *Rlimit) (err error) //sys Seek(fd int, offset int64, whence int) (off int64, err error) = lseek //sys mmap(addr uintptr, length uintptr, prot int, flags int, fd int, offset int64) (xaddr uintptr, err error) = mmap64 diff --git a/vendor/golang.org/x/sys/unix/syscall_bsd.go b/vendor/golang.org/x/sys/unix/syscall_bsd.go index c437fc5..7705c32 100644 --- a/vendor/golang.org/x/sys/unix/syscall_bsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_bsd.go @@ -245,8 +245,7 @@ func anyToSockaddr(fd int, rsa *RawSockaddrAny) (Sockaddr, error) { break } } - bytes := (*[len(pp.Path)]byte)(unsafe.Pointer(&pp.Path[0]))[0:n] - sa.Name = string(bytes) + sa.Name = string(unsafe.Slice((*byte)(unsafe.Pointer(&pp.Path[0])), n)) return sa, nil case AF_INET: @@ -363,7 +362,7 @@ func sendmsgN(fd int, iov []Iovec, oob []byte, ptr unsafe.Pointer, salen _Sockle var empty bool if len(oob) > 0 { // send at least one normal byte - empty := emptyIovecs(iov) + empty = emptyIovecs(iov) if empty { var iova [1]Iovec iova[0].Base = &dummy diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin.1_12.go b/vendor/golang.org/x/sys/unix/syscall_darwin.1_12.go deleted file mode 100644 index b009860..0000000 --- a/vendor/golang.org/x/sys/unix/syscall_darwin.1_12.go +++ /dev/null @@ -1,32 +0,0 @@ -// Copyright 2019 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build darwin && go1.12 && !go1.13 -// +build darwin,go1.12,!go1.13 - -package unix - -import ( - "unsafe" -) - -const _SYS_GETDIRENTRIES64 = 344 - -func Getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) { - // To implement this using libSystem we'd need syscall_syscallPtr for - // fdopendir. However, syscallPtr was only added in Go 1.13, so we fall - // back to raw syscalls for this func on Go 1.12. - var p unsafe.Pointer - if len(buf) > 0 { - p = unsafe.Pointer(&buf[0]) - } else { - p = unsafe.Pointer(&_zero) - } - r0, _, e1 := Syscall6(_SYS_GETDIRENTRIES64, uintptr(fd), uintptr(p), uintptr(len(buf)), uintptr(unsafe.Pointer(basep)), 0, 0) - n = int(r0) - if e1 != 0 { - return n, errnoErr(e1) - } - return n, nil -} diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin.1_13.go b/vendor/golang.org/x/sys/unix/syscall_darwin.1_13.go deleted file mode 100644 index 1596426..0000000 --- a/vendor/golang.org/x/sys/unix/syscall_darwin.1_13.go +++ /dev/null @@ -1,108 +0,0 @@ -// Copyright 2019 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build darwin && go1.13 -// +build darwin,go1.13 - -package unix - -import ( - "unsafe" - - "golang.org/x/sys/internal/unsafeheader" -) - -//sys closedir(dir uintptr) (err error) -//sys readdir_r(dir uintptr, entry *Dirent, result **Dirent) (res Errno) - -func fdopendir(fd int) (dir uintptr, err error) { - r0, _, e1 := syscall_syscallPtr(libc_fdopendir_trampoline_addr, uintptr(fd), 0, 0) - dir = uintptr(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_fdopendir_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_fdopendir fdopendir "/usr/lib/libSystem.B.dylib" - -func Getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) { - // Simulate Getdirentries using fdopendir/readdir_r/closedir. - // We store the number of entries to skip in the seek - // offset of fd. See issue #31368. - // It's not the full required semantics, but should handle the case - // of calling Getdirentries or ReadDirent repeatedly. - // It won't handle assigning the results of lseek to *basep, or handle - // the directory being edited underfoot. - skip, err := Seek(fd, 0, 1 /* SEEK_CUR */) - if err != nil { - return 0, err - } - - // We need to duplicate the incoming file descriptor - // because the caller expects to retain control of it, but - // fdopendir expects to take control of its argument. - // Just Dup'ing the file descriptor is not enough, as the - // result shares underlying state. Use Openat to make a really - // new file descriptor referring to the same directory. - fd2, err := Openat(fd, ".", O_RDONLY, 0) - if err != nil { - return 0, err - } - d, err := fdopendir(fd2) - if err != nil { - Close(fd2) - return 0, err - } - defer closedir(d) - - var cnt int64 - for { - var entry Dirent - var entryp *Dirent - e := readdir_r(d, &entry, &entryp) - if e != 0 { - return n, errnoErr(e) - } - if entryp == nil { - break - } - if skip > 0 { - skip-- - cnt++ - continue - } - - reclen := int(entry.Reclen) - if reclen > len(buf) { - // Not enough room. Return for now. - // The counter will let us know where we should start up again. - // Note: this strategy for suspending in the middle and - // restarting is O(n^2) in the length of the directory. Oh well. - break - } - - // Copy entry into return buffer. - var s []byte - hdr := (*unsafeheader.Slice)(unsafe.Pointer(&s)) - hdr.Data = unsafe.Pointer(&entry) - hdr.Cap = reclen - hdr.Len = reclen - copy(buf, s) - - buf = buf[reclen:] - n += reclen - cnt++ - } - // Set the seek offset of the input fd to record - // how many files we've already returned. - _, err = Seek(fd, cnt, 0 /* SEEK_SET */) - if err != nil { - return n, err - } - - return n, nil -} diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin.go b/vendor/golang.org/x/sys/unix/syscall_darwin.go index 4f87f16..2069215 100644 --- a/vendor/golang.org/x/sys/unix/syscall_darwin.go +++ b/vendor/golang.org/x/sys/unix/syscall_darwin.go @@ -14,11 +14,100 @@ package unix import ( "fmt" - "runtime" "syscall" "unsafe" ) +//sys closedir(dir uintptr) (err error) +//sys readdir_r(dir uintptr, entry *Dirent, result **Dirent) (res Errno) + +func fdopendir(fd int) (dir uintptr, err error) { + r0, _, e1 := syscall_syscallPtr(libc_fdopendir_trampoline_addr, uintptr(fd), 0, 0) + dir = uintptr(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fdopendir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fdopendir fdopendir "/usr/lib/libSystem.B.dylib" + +func Getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) { + // Simulate Getdirentries using fdopendir/readdir_r/closedir. + // We store the number of entries to skip in the seek + // offset of fd. See issue #31368. + // It's not the full required semantics, but should handle the case + // of calling Getdirentries or ReadDirent repeatedly. + // It won't handle assigning the results of lseek to *basep, or handle + // the directory being edited underfoot. + skip, err := Seek(fd, 0, 1 /* SEEK_CUR */) + if err != nil { + return 0, err + } + + // We need to duplicate the incoming file descriptor + // because the caller expects to retain control of it, but + // fdopendir expects to take control of its argument. + // Just Dup'ing the file descriptor is not enough, as the + // result shares underlying state. Use Openat to make a really + // new file descriptor referring to the same directory. + fd2, err := Openat(fd, ".", O_RDONLY, 0) + if err != nil { + return 0, err + } + d, err := fdopendir(fd2) + if err != nil { + Close(fd2) + return 0, err + } + defer closedir(d) + + var cnt int64 + for { + var entry Dirent + var entryp *Dirent + e := readdir_r(d, &entry, &entryp) + if e != 0 { + return n, errnoErr(e) + } + if entryp == nil { + break + } + if skip > 0 { + skip-- + cnt++ + continue + } + + reclen := int(entry.Reclen) + if reclen > len(buf) { + // Not enough room. Return for now. + // The counter will let us know where we should start up again. + // Note: this strategy for suspending in the middle and + // restarting is O(n^2) in the length of the directory. Oh well. + break + } + + // Copy entry into return buffer. + s := unsafe.Slice((*byte)(unsafe.Pointer(&entry)), reclen) + copy(buf, s) + + buf = buf[reclen:] + n += reclen + cnt++ + } + // Set the seek offset of the input fd to record + // how many files we've already returned. + _, err = Seek(fd, cnt, 0 /* SEEK_SET */) + if err != nil { + return n, err + } + + return n, nil +} + // SockaddrDatalink implements the Sockaddr interface for AF_LINK type sockets. type SockaddrDatalink struct { Len uint8 @@ -140,6 +229,7 @@ func direntNamlen(buf []byte) (uint64, bool) { func PtraceAttach(pid int) (err error) { return ptrace(PT_ATTACH, pid, 0, 0) } func PtraceDetach(pid int) (err error) { return ptrace(PT_DETACH, pid, 0, 0) } +func PtraceDenyAttach() (err error) { return ptrace(PT_DENY_ATTACH, 0, 0, 0) } //sysnb pipe(p *[2]int32) (err error) @@ -285,11 +375,10 @@ func Flistxattr(fd int, dest []byte) (sz int, err error) { func Kill(pid int, signum syscall.Signal) (err error) { return kill(pid, int(signum), 1) } //sys ioctl(fd int, req uint, arg uintptr) (err error) +//sys ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) = SYS_IOCTL func IoctlCtlInfo(fd int, ctlInfo *CtlInfo) error { - err := ioctl(fd, CTLIOCGINFO, uintptr(unsafe.Pointer(ctlInfo))) - runtime.KeepAlive(ctlInfo) - return err + return ioctlPtr(fd, CTLIOCGINFO, unsafe.Pointer(ctlInfo)) } // IfreqMTU is struct ifreq used to get or set a network device's MTU. @@ -303,16 +392,14 @@ type IfreqMTU struct { func IoctlGetIfreqMTU(fd int, ifname string) (*IfreqMTU, error) { var ifreq IfreqMTU copy(ifreq.Name[:], ifname) - err := ioctl(fd, SIOCGIFMTU, uintptr(unsafe.Pointer(&ifreq))) + err := ioctlPtr(fd, SIOCGIFMTU, unsafe.Pointer(&ifreq)) return &ifreq, err } // IoctlSetIfreqMTU performs the SIOCSIFMTU ioctl operation on fd to set the MTU // of the network device specified by ifreq.Name. func IoctlSetIfreqMTU(fd int, ifreq *IfreqMTU) error { - err := ioctl(fd, SIOCSIFMTU, uintptr(unsafe.Pointer(ifreq))) - runtime.KeepAlive(ifreq) - return err + return ioctlPtr(fd, SIOCSIFMTU, unsafe.Pointer(ifreq)) } //sys sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) = SYS_SYSCTL @@ -526,6 +613,7 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) { //sys Rmdir(path string) (err error) //sys Seek(fd int, offset int64, whence int) (newoffset int64, err error) = SYS_LSEEK //sys Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err error) +//sys Setattrlist(path string, attrlist *Attrlist, attrBuf []byte, options int) (err error) //sys Setegid(egid int) (err error) //sysnb Seteuid(euid int) (err error) //sysnb Setgid(gid int) (err error) @@ -535,7 +623,6 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) { //sys Setprivexec(flag int) (err error) //sysnb Setregid(rgid int, egid int) (err error) //sysnb Setreuid(ruid int, euid int) (err error) -//sysnb Setrlimit(which int, lim *Rlimit) (err error) //sysnb Setsid() (pid int, err error) //sysnb Settimeofday(tp *Timeval) (err error) //sysnb Setuid(uid int) (err error) @@ -589,7 +676,6 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) { // Kqueue_from_portset_np // Kqueue_portset // Getattrlist -// Setattrlist // Getdirentriesattr // Searchfs // Delete diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin_amd64.go b/vendor/golang.org/x/sys/unix/syscall_darwin_amd64.go index b37310c..9fa8798 100644 --- a/vendor/golang.org/x/sys/unix/syscall_darwin_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_darwin_amd64.go @@ -47,5 +47,6 @@ func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, //sys getfsstat(buf unsafe.Pointer, size uintptr, flags int) (n int, err error) = SYS_GETFSSTAT64 //sys Lstat(path string, stat *Stat_t) (err error) = SYS_LSTAT64 //sys ptrace1(request int, pid int, addr uintptr, data uintptr) (err error) = SYS_ptrace +//sys ptrace1Ptr(request int, pid int, addr unsafe.Pointer, data uintptr) (err error) = SYS_ptrace //sys Stat(path string, stat *Stat_t) (err error) = SYS_STAT64 //sys Statfs(path string, stat *Statfs_t) (err error) = SYS_STATFS64 diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin_arm64.go b/vendor/golang.org/x/sys/unix/syscall_darwin_arm64.go index d51ec99..f17b8c5 100644 --- a/vendor/golang.org/x/sys/unix/syscall_darwin_arm64.go +++ b/vendor/golang.org/x/sys/unix/syscall_darwin_arm64.go @@ -47,5 +47,6 @@ func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, //sys getfsstat(buf unsafe.Pointer, size uintptr, flags int) (n int, err error) = SYS_GETFSSTAT //sys Lstat(path string, stat *Stat_t) (err error) //sys ptrace1(request int, pid int, addr uintptr, data uintptr) (err error) = SYS_ptrace +//sys ptrace1Ptr(request int, pid int, addr unsafe.Pointer, data uintptr) (err error) = SYS_ptrace //sys Stat(path string, stat *Stat_t) (err error) //sys Statfs(path string, stat *Statfs_t) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_dragonfly.go b/vendor/golang.org/x/sys/unix/syscall_dragonfly.go index 61c0d0d..d4ce988 100644 --- a/vendor/golang.org/x/sys/unix/syscall_dragonfly.go +++ b/vendor/golang.org/x/sys/unix/syscall_dragonfly.go @@ -172,6 +172,7 @@ func Getfsstat(buf []Statfs_t, flags int) (n int, err error) { } //sys ioctl(fd int, req uint, arg uintptr) (err error) +//sys ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) = SYS_IOCTL //sys sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) = SYS___SYSCTL @@ -255,6 +256,7 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e //sys Chmod(path string, mode uint32) (err error) //sys Chown(path string, uid int, gid int) (err error) //sys Chroot(path string) (err error) +//sys ClockGettime(clockid int32, time *Timespec) (err error) //sys Close(fd int) (err error) //sys Dup(fd int) (nfd int, err error) //sys Dup2(from int, to int) (err error) @@ -324,7 +326,6 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e //sysnb Setreuid(ruid int, euid int) (err error) //sysnb Setresgid(rgid int, egid int, sgid int) (err error) //sysnb Setresuid(ruid int, euid int, suid int) (err error) -//sysnb Setrlimit(which int, lim *Rlimit) (err error) //sysnb Setsid() (pid int, err error) //sysnb Settimeofday(tp *Timeval) (err error) //sysnb Setuid(uid int) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd.go b/vendor/golang.org/x/sys/unix/syscall_freebsd.go index de7c23e..afb1010 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd.go @@ -161,7 +161,8 @@ func Getfsstat(buf []Statfs_t, flags int) (n int, err error) { return } -//sys ioctl(fd int, req uint, arg uintptr) (err error) +//sys ioctl(fd int, req uint, arg uintptr) (err error) = SYS_IOCTL +//sys ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) = SYS_IOCTL //sys sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) = SYS___SYSCTL @@ -253,6 +254,7 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e } //sys ptrace(request int, pid int, addr uintptr, data int) (err error) +//sys ptracePtr(request int, pid int, addr unsafe.Pointer, data int) (err error) = SYS_PTRACE func PtraceAttach(pid int) (err error) { return ptrace(PT_ATTACH, pid, 0, 0) @@ -267,19 +269,36 @@ func PtraceDetach(pid int) (err error) { } func PtraceGetFpRegs(pid int, fpregsout *FpReg) (err error) { - return ptrace(PT_GETFPREGS, pid, uintptr(unsafe.Pointer(fpregsout)), 0) + return ptracePtr(PT_GETFPREGS, pid, unsafe.Pointer(fpregsout), 0) } func PtraceGetRegs(pid int, regsout *Reg) (err error) { - return ptrace(PT_GETREGS, pid, uintptr(unsafe.Pointer(regsout)), 0) + return ptracePtr(PT_GETREGS, pid, unsafe.Pointer(regsout), 0) +} + +func PtraceIO(req int, pid int, offs uintptr, out []byte, countin int) (count int, err error) { + ioDesc := PtraceIoDesc{ + Op: int32(req), + Offs: offs, + } + if countin > 0 { + _ = out[:countin] // check bounds + ioDesc.Addr = &out[0] + } else if out != nil { + ioDesc.Addr = (*byte)(unsafe.Pointer(&_zero)) + } + ioDesc.SetLen(countin) + + err = ptracePtr(PT_IO, pid, unsafe.Pointer(&ioDesc), 0) + return int(ioDesc.Len), err } func PtraceLwpEvents(pid int, enable int) (err error) { return ptrace(PT_LWP_EVENTS, pid, 0, enable) } -func PtraceLwpInfo(pid int, info uintptr) (err error) { - return ptrace(PT_LWPINFO, pid, info, int(unsafe.Sizeof(PtraceLwpInfoStruct{}))) +func PtraceLwpInfo(pid int, info *PtraceLwpInfoStruct) (err error) { + return ptracePtr(PT_LWPINFO, pid, unsafe.Pointer(info), int(unsafe.Sizeof(*info))) } func PtracePeekData(pid int, addr uintptr, out []byte) (count int, err error) { @@ -299,13 +318,25 @@ func PtracePokeText(pid int, addr uintptr, data []byte) (count int, err error) { } func PtraceSetRegs(pid int, regs *Reg) (err error) { - return ptrace(PT_SETREGS, pid, uintptr(unsafe.Pointer(regs)), 0) + return ptracePtr(PT_SETREGS, pid, unsafe.Pointer(regs), 0) } func PtraceSingleStep(pid int) (err error) { return ptrace(PT_STEP, pid, 1, 0) } +func Dup3(oldfd, newfd, flags int) error { + if oldfd == newfd || flags&^O_CLOEXEC != 0 { + return EINVAL + } + how := F_DUP2FD + if flags&O_CLOEXEC != 0 { + how = F_DUP2FD_CLOEXEC + } + _, err := fcntl(oldfd, how, newfd) + return err +} + /* * Exposed directly */ @@ -319,6 +350,7 @@ func PtraceSingleStep(pid int) (err error) { //sys Chmod(path string, mode uint32) (err error) //sys Chown(path string, uid int, gid int) (err error) //sys Chroot(path string) (err error) +//sys ClockGettime(clockid int32, time *Timespec) (err error) //sys Close(fd int) (err error) //sys Dup(fd int) (nfd int, err error) //sys Dup2(from int, to int) (err error) @@ -401,7 +433,6 @@ func PtraceSingleStep(pid int) (err error) { //sysnb Setreuid(ruid int, euid int) (err error) //sysnb Setresgid(rgid int, egid int, sgid int) (err error) //sysnb Setresuid(ruid int, euid int, suid int) (err error) -//sysnb Setrlimit(which int, lim *Rlimit) (err error) //sysnb Setsid() (pid int, err error) //sysnb Settimeofday(tp *Timeval) (err error) //sysnb Setuid(uid int) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_386.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_386.go index c3c4c69..b8da510 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd_386.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_386.go @@ -42,6 +42,10 @@ func (cmsg *Cmsghdr) SetLen(length int) { cmsg.Len = uint32(length) } +func (d *PtraceIoDesc) SetLen(length int) { + d.Len = uint32(length) +} + func sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) { var writtenOut uint64 = 0 _, _, e1 := Syscall9(SYS_SENDFILE, uintptr(infd), uintptr(outfd), uintptr(*offset), uintptr((*offset)>>32), uintptr(count), 0, uintptr(unsafe.Pointer(&writtenOut)), 0, 0) @@ -57,11 +61,5 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, err syscall.Errno) func PtraceGetFsBase(pid int, fsbase *int64) (err error) { - return ptrace(PT_GETFSBASE, pid, uintptr(unsafe.Pointer(fsbase)), 0) -} - -func PtraceIO(req int, pid int, addr uintptr, out []byte, countin int) (count int, err error) { - ioDesc := PtraceIoDesc{Op: int32(req), Offs: (*byte)(unsafe.Pointer(addr)), Addr: (*byte)(unsafe.Pointer(&out[0])), Len: uint32(countin)} - err = ptrace(PT_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0) - return int(ioDesc.Len), err + return ptracePtr(PT_GETFSBASE, pid, unsafe.Pointer(fsbase), 0) } diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_amd64.go index 82be61a..47155c4 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_amd64.go @@ -42,6 +42,10 @@ func (cmsg *Cmsghdr) SetLen(length int) { cmsg.Len = uint32(length) } +func (d *PtraceIoDesc) SetLen(length int) { + d.Len = uint64(length) +} + func sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) { var writtenOut uint64 = 0 _, _, e1 := Syscall9(SYS_SENDFILE, uintptr(infd), uintptr(outfd), uintptr(*offset), uintptr(count), 0, uintptr(unsafe.Pointer(&writtenOut)), 0, 0, 0) @@ -57,11 +61,5 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, err syscall.Errno) func PtraceGetFsBase(pid int, fsbase *int64) (err error) { - return ptrace(PT_GETFSBASE, pid, uintptr(unsafe.Pointer(fsbase)), 0) -} - -func PtraceIO(req int, pid int, addr uintptr, out []byte, countin int) (count int, err error) { - ioDesc := PtraceIoDesc{Op: int32(req), Offs: (*byte)(unsafe.Pointer(addr)), Addr: (*byte)(unsafe.Pointer(&out[0])), Len: uint64(countin)} - err = ptrace(PT_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0) - return int(ioDesc.Len), err + return ptracePtr(PT_GETFSBASE, pid, unsafe.Pointer(fsbase), 0) } diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_arm.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_arm.go index cd58f10..0893209 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd_arm.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_arm.go @@ -42,6 +42,10 @@ func (cmsg *Cmsghdr) SetLen(length int) { cmsg.Len = uint32(length) } +func (d *PtraceIoDesc) SetLen(length int) { + d.Len = uint32(length) +} + func sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) { var writtenOut uint64 = 0 _, _, e1 := Syscall9(SYS_SENDFILE, uintptr(infd), uintptr(outfd), uintptr(*offset), uintptr((*offset)>>32), uintptr(count), 0, uintptr(unsafe.Pointer(&writtenOut)), 0, 0) @@ -55,9 +59,3 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e } func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, err syscall.Errno) - -func PtraceIO(req int, pid int, addr uintptr, out []byte, countin int) (count int, err error) { - ioDesc := PtraceIoDesc{Op: int32(req), Offs: (*byte)(unsafe.Pointer(addr)), Addr: (*byte)(unsafe.Pointer(&out[0])), Len: uint32(countin)} - err = ptrace(PT_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0) - return int(ioDesc.Len), err -} diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_arm64.go index d6f538f..d151a0d 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_arm64.go @@ -42,6 +42,10 @@ func (cmsg *Cmsghdr) SetLen(length int) { cmsg.Len = uint32(length) } +func (d *PtraceIoDesc) SetLen(length int) { + d.Len = uint64(length) +} + func sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) { var writtenOut uint64 = 0 _, _, e1 := Syscall9(SYS_SENDFILE, uintptr(infd), uintptr(outfd), uintptr(*offset), uintptr(count), 0, uintptr(unsafe.Pointer(&writtenOut)), 0, 0, 0) @@ -55,9 +59,3 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e } func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, err syscall.Errno) - -func PtraceIO(req int, pid int, addr uintptr, out []byte, countin int) (count int, err error) { - ioDesc := PtraceIoDesc{Op: int32(req), Offs: (*byte)(unsafe.Pointer(addr)), Addr: (*byte)(unsafe.Pointer(&out[0])), Len: uint64(countin)} - err = ptrace(PT_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0) - return int(ioDesc.Len), err -} diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_riscv64.go index 8ea6e96..d5cd64b 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_riscv64.go @@ -42,6 +42,10 @@ func (cmsg *Cmsghdr) SetLen(length int) { cmsg.Len = uint32(length) } +func (d *PtraceIoDesc) SetLen(length int) { + d.Len = uint64(length) +} + func sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) { var writtenOut uint64 = 0 _, _, e1 := Syscall9(SYS_SENDFILE, uintptr(infd), uintptr(outfd), uintptr(*offset), uintptr(count), 0, uintptr(unsafe.Pointer(&writtenOut)), 0, 0, 0) @@ -55,9 +59,3 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e } func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, err syscall.Errno) - -func PtraceIO(req int, pid int, addr uintptr, out []byte, countin int) (count int, err error) { - ioDesc := PtraceIoDesc{Op: int32(req), Offs: (*byte)(unsafe.Pointer(addr)), Addr: (*byte)(unsafe.Pointer(&out[0])), Len: uint64(countin)} - err = ptrace(PT_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0) - return int(ioDesc.Len), err -} diff --git a/vendor/golang.org/x/sys/unix/syscall_hurd.go b/vendor/golang.org/x/sys/unix/syscall_hurd.go new file mode 100644 index 0000000..381fd46 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/syscall_hurd.go @@ -0,0 +1,30 @@ +// Copyright 2022 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build hurd +// +build hurd + +package unix + +/* +#include +int ioctl(int, unsigned long int, uintptr_t); +*/ +import "C" + +func ioctl(fd int, req uint, arg uintptr) (err error) { + r0, er := C.ioctl(C.int(fd), C.ulong(req), C.uintptr_t(arg)) + if r0 == -1 && er != nil { + err = er + } + return +} + +func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { + r0, er := C.ioctl(C.int(fd), C.ulong(req), C.uintptr_t(uintptr(arg))) + if r0 == -1 && er != nil { + err = er + } + return +} diff --git a/vendor/golang.org/x/sys/unix/syscall_hurd_386.go b/vendor/golang.org/x/sys/unix/syscall_hurd_386.go new file mode 100644 index 0000000..7cf54a3 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/syscall_hurd_386.go @@ -0,0 +1,29 @@ +// Copyright 2022 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build 386 && hurd +// +build 386,hurd + +package unix + +const ( + TIOCGETA = 0x62251713 +) + +type Winsize struct { + Row uint16 + Col uint16 + Xpixel uint16 + Ypixel uint16 +} + +type Termios struct { + Iflag uint32 + Oflag uint32 + Cflag uint32 + Lflag uint32 + Cc [20]uint8 + Ispeed int32 + Ospeed int32 +} diff --git a/vendor/golang.org/x/sys/unix/syscall_illumos.go b/vendor/golang.org/x/sys/unix/syscall_illumos.go index e48244a..87db5a6 100644 --- a/vendor/golang.org/x/sys/unix/syscall_illumos.go +++ b/vendor/golang.org/x/sys/unix/syscall_illumos.go @@ -10,8 +10,6 @@ package unix import ( - "fmt" - "runtime" "unsafe" ) @@ -79,107 +77,3 @@ func Accept4(fd int, flags int) (nfd int, sa Sockaddr, err error) { } return } - -//sys putmsg(fd int, clptr *strbuf, dataptr *strbuf, flags int) (err error) - -func Putmsg(fd int, cl []byte, data []byte, flags int) (err error) { - var clp, datap *strbuf - if len(cl) > 0 { - clp = &strbuf{ - Len: int32(len(cl)), - Buf: (*int8)(unsafe.Pointer(&cl[0])), - } - } - if len(data) > 0 { - datap = &strbuf{ - Len: int32(len(data)), - Buf: (*int8)(unsafe.Pointer(&data[0])), - } - } - return putmsg(fd, clp, datap, flags) -} - -//sys getmsg(fd int, clptr *strbuf, dataptr *strbuf, flags *int) (err error) - -func Getmsg(fd int, cl []byte, data []byte) (retCl []byte, retData []byte, flags int, err error) { - var clp, datap *strbuf - if len(cl) > 0 { - clp = &strbuf{ - Maxlen: int32(len(cl)), - Buf: (*int8)(unsafe.Pointer(&cl[0])), - } - } - if len(data) > 0 { - datap = &strbuf{ - Maxlen: int32(len(data)), - Buf: (*int8)(unsafe.Pointer(&data[0])), - } - } - - if err = getmsg(fd, clp, datap, &flags); err != nil { - return nil, nil, 0, err - } - - if len(cl) > 0 { - retCl = cl[:clp.Len] - } - if len(data) > 0 { - retData = data[:datap.Len] - } - return retCl, retData, flags, nil -} - -func IoctlSetIntRetInt(fd int, req uint, arg int) (int, error) { - return ioctlRet(fd, req, uintptr(arg)) -} - -func IoctlSetString(fd int, req uint, val string) error { - bs := make([]byte, len(val)+1) - copy(bs[:len(bs)-1], val) - err := ioctl(fd, req, uintptr(unsafe.Pointer(&bs[0]))) - runtime.KeepAlive(&bs[0]) - return err -} - -// Lifreq Helpers - -func (l *Lifreq) SetName(name string) error { - if len(name) >= len(l.Name) { - return fmt.Errorf("name cannot be more than %d characters", len(l.Name)-1) - } - for i := range name { - l.Name[i] = int8(name[i]) - } - return nil -} - -func (l *Lifreq) SetLifruInt(d int) { - *(*int)(unsafe.Pointer(&l.Lifru[0])) = d -} - -func (l *Lifreq) GetLifruInt() int { - return *(*int)(unsafe.Pointer(&l.Lifru[0])) -} - -func (l *Lifreq) SetLifruUint(d uint) { - *(*uint)(unsafe.Pointer(&l.Lifru[0])) = d -} - -func (l *Lifreq) GetLifruUint() uint { - return *(*uint)(unsafe.Pointer(&l.Lifru[0])) -} - -func IoctlLifreq(fd int, req uint, l *Lifreq) error { - return ioctl(fd, req, uintptr(unsafe.Pointer(l))) -} - -// Strioctl Helpers - -func (s *Strioctl) SetInt(i int) { - s.Len = int32(unsafe.Sizeof(i)) - s.Dp = (*int8)(unsafe.Pointer(&i)) -} - -func IoctlSetStrioctlRetInt(fd int, req uint, s *Strioctl) (int, error) { - return ioctlRet(fd, req, uintptr(unsafe.Pointer(s))) -} diff --git a/vendor/golang.org/x/sys/unix/syscall_linux.go b/vendor/golang.org/x/sys/unix/syscall_linux.go index 5e4a94f..39de5f1 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux.go @@ -13,6 +13,7 @@ package unix import ( "encoding/binary" + "strconv" "syscall" "time" "unsafe" @@ -233,7 +234,7 @@ func Futimesat(dirfd int, path string, tv []Timeval) error { func Futimes(fd int, tv []Timeval) (err error) { // Believe it or not, this is the best we can do on Linux // (and is what glibc does). - return Utimes("/proc/self/fd/"+itoa(fd), tv) + return Utimes("/proc/self/fd/"+strconv.Itoa(fd), tv) } const ImplementsGetwd = true @@ -1014,8 +1015,7 @@ func anyToSockaddr(fd int, rsa *RawSockaddrAny) (Sockaddr, error) { for n < len(pp.Path) && pp.Path[n] != 0 { n++ } - bytes := (*[len(pp.Path)]byte)(unsafe.Pointer(&pp.Path[0]))[0:n] - sa.Name = string(bytes) + sa.Name = string(unsafe.Slice((*byte)(unsafe.Pointer(&pp.Path[0])), n)) return sa, nil case AF_INET: @@ -1364,6 +1364,10 @@ func SetsockoptTCPRepairOpt(fd, level, opt int, o []TCPRepairOpt) (err error) { return setsockopt(fd, level, opt, unsafe.Pointer(&o[0]), uintptr(SizeofTCPRepairOpt*len(o))) } +func SetsockoptTCPMD5Sig(fd, level, opt int, s *TCPMD5Sig) error { + return setsockopt(fd, level, opt, unsafe.Pointer(s), unsafe.Sizeof(*s)) +} + // Keyctl Commands (http://man7.org/linux/man-pages/man2/keyctl.2.html) // KeyctlInt calls keyctl commands in which each argument is an int. @@ -1541,7 +1545,7 @@ func sendmsgN(fd int, iov []Iovec, oob []byte, ptr unsafe.Pointer, salen _Sockle var dummy byte var empty bool if len(oob) > 0 { - empty := emptyIovecs(iov) + empty = emptyIovecs(iov) if empty { var sockType int sockType, err = GetsockoptInt(fd, SOL_SOCKET, SO_TYPE) @@ -1553,6 +1557,7 @@ func sendmsgN(fd int, iov []Iovec, oob []byte, ptr unsafe.Pointer, salen _Sockle var iova [1]Iovec iova[0].Base = &dummy iova[0].SetLen(1) + iov = iova[:] } } msg.Control = &oob[0] @@ -1577,6 +1582,7 @@ func BindToDevice(fd int, device string) (err error) { } //sys ptrace(request int, pid int, addr uintptr, data uintptr) (err error) +//sys ptracePtr(request int, pid int, addr uintptr, data unsafe.Pointer) (err error) = SYS_PTRACE func ptracePeek(req int, pid int, addr uintptr, out []byte) (count int, err error) { // The peek requests are machine-size oriented, so we wrap it @@ -1594,7 +1600,7 @@ func ptracePeek(req int, pid int, addr uintptr, out []byte) (count int, err erro // boundary. n := 0 if addr%SizeofPtr != 0 { - err = ptrace(req, pid, addr-addr%SizeofPtr, uintptr(unsafe.Pointer(&buf[0]))) + err = ptracePtr(req, pid, addr-addr%SizeofPtr, unsafe.Pointer(&buf[0])) if err != nil { return 0, err } @@ -1606,7 +1612,7 @@ func ptracePeek(req int, pid int, addr uintptr, out []byte) (count int, err erro for len(out) > 0 { // We use an internal buffer to guarantee alignment. // It's not documented if this is necessary, but we're paranoid. - err = ptrace(req, pid, addr+uintptr(n), uintptr(unsafe.Pointer(&buf[0]))) + err = ptracePtr(req, pid, addr+uintptr(n), unsafe.Pointer(&buf[0])) if err != nil { return n, err } @@ -1638,7 +1644,7 @@ func ptracePoke(pokeReq int, peekReq int, pid int, addr uintptr, data []byte) (c n := 0 if addr%SizeofPtr != 0 { var buf [SizeofPtr]byte - err = ptrace(peekReq, pid, addr-addr%SizeofPtr, uintptr(unsafe.Pointer(&buf[0]))) + err = ptracePtr(peekReq, pid, addr-addr%SizeofPtr, unsafe.Pointer(&buf[0])) if err != nil { return 0, err } @@ -1665,7 +1671,7 @@ func ptracePoke(pokeReq int, peekReq int, pid int, addr uintptr, data []byte) (c // Trailing edge. if len(data) > 0 { var buf [SizeofPtr]byte - err = ptrace(peekReq, pid, addr+uintptr(n), uintptr(unsafe.Pointer(&buf[0]))) + err = ptracePtr(peekReq, pid, addr+uintptr(n), unsafe.Pointer(&buf[0])) if err != nil { return n, err } @@ -1693,12 +1699,23 @@ func PtracePokeUser(pid int, addr uintptr, data []byte) (count int, err error) { return ptracePoke(PTRACE_POKEUSR, PTRACE_PEEKUSR, pid, addr, data) } +// elfNT_PRSTATUS is a copy of the debug/elf.NT_PRSTATUS constant so +// x/sys/unix doesn't need to depend on debug/elf and thus +// compress/zlib, debug/dwarf, and other packages. +const elfNT_PRSTATUS = 1 + func PtraceGetRegs(pid int, regsout *PtraceRegs) (err error) { - return ptrace(PTRACE_GETREGS, pid, 0, uintptr(unsafe.Pointer(regsout))) + var iov Iovec + iov.Base = (*byte)(unsafe.Pointer(regsout)) + iov.SetLen(int(unsafe.Sizeof(*regsout))) + return ptracePtr(PTRACE_GETREGSET, pid, uintptr(elfNT_PRSTATUS), unsafe.Pointer(&iov)) } func PtraceSetRegs(pid int, regs *PtraceRegs) (err error) { - return ptrace(PTRACE_SETREGS, pid, 0, uintptr(unsafe.Pointer(regs))) + var iov Iovec + iov.Base = (*byte)(unsafe.Pointer(regs)) + iov.SetLen(int(unsafe.Sizeof(*regs))) + return ptracePtr(PTRACE_SETREGSET, pid, uintptr(elfNT_PRSTATUS), unsafe.Pointer(&iov)) } func PtraceSetOptions(pid int, options int) (err error) { @@ -1707,7 +1724,7 @@ func PtraceSetOptions(pid int, options int) (err error) { func PtraceGetEventMsg(pid int) (msg uint, err error) { var data _C_long - err = ptrace(PTRACE_GETEVENTMSG, pid, 0, uintptr(unsafe.Pointer(&data))) + err = ptracePtr(PTRACE_GETEVENTMSG, pid, 0, unsafe.Pointer(&data)) msg = uint(data) return } @@ -1798,6 +1815,7 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e //sysnb Capset(hdr *CapUserHeader, data *CapUserData) (err error) //sys Chdir(path string) (err error) //sys Chroot(path string) (err error) +//sys ClockAdjtime(clockid int32, buf *Timex) (state int, err error) //sys ClockGetres(clockid int32, res *Timespec) (err error) //sys ClockGettime(clockid int32, time *Timespec) (err error) //sys ClockNanosleep(clockid int32, flags int, request *Timespec, remain *Timespec) (err error) @@ -1866,7 +1884,6 @@ func Getpgrp() (pid int) { //sys OpenTree(dfd int, fileName string, flags uint) (r int, err error) //sys PerfEventOpen(attr *PerfEventAttr, pid int, cpu int, groupFd int, flags int) (fd int, err error) //sys PivotRoot(newroot string, putold string) (err error) = SYS_PIVOT_ROOT -//sysnb Prlimit(pid int, resource int, newlimit *Rlimit, old *Rlimit) (err error) = SYS_PRLIMIT64 //sys Prctl(option int, arg2 uintptr, arg3 uintptr, arg4 uintptr, arg5 uintptr) (err error) //sys Pselect(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *Sigset_t) (n int, err error) = SYS_PSELECT6 //sys read(fd int, p []byte) (n int, err error) @@ -1880,6 +1897,15 @@ func Getpgrp() (pid int) { //sysnb Settimeofday(tv *Timeval) (err error) //sys Setns(fd int, nstype int) (err error) +//go:linkname syscall_prlimit syscall.prlimit +func syscall_prlimit(pid, resource int, newlimit, old *syscall.Rlimit) error + +func Prlimit(pid, resource int, newlimit, old *Rlimit) error { + // Just call the syscall version, because as of Go 1.21 + // it will affect starting a new process. + return syscall_prlimit(pid, resource, (*syscall.Rlimit)(newlimit), (*syscall.Rlimit)(old)) +} + // PrctlRetInt performs a prctl operation specified by option and further // optional arguments arg2 through arg5 depending on option. It returns a // non-negative integer that is returned by the prctl syscall. @@ -1891,17 +1917,28 @@ func PrctlRetInt(option int, arg2 uintptr, arg3 uintptr, arg4 uintptr, arg5 uint return int(ret), nil } -// issue 1435. -// On linux Setuid and Setgid only affects the current thread, not the process. -// This does not match what most callers expect so we must return an error -// here rather than letting the caller think that the call succeeded. - func Setuid(uid int) (err error) { - return EOPNOTSUPP + return syscall.Setuid(uid) +} + +func Setgid(gid int) (err error) { + return syscall.Setgid(gid) +} + +func Setreuid(ruid, euid int) (err error) { + return syscall.Setreuid(ruid, euid) +} + +func Setregid(rgid, egid int) (err error) { + return syscall.Setregid(rgid, egid) +} + +func Setresuid(ruid, euid, suid int) (err error) { + return syscall.Setresuid(ruid, euid, suid) } -func Setgid(uid int) (err error) { - return EOPNOTSUPP +func Setresgid(rgid, egid, sgid int) (err error) { + return syscall.Setresgid(rgid, egid, sgid) } // SetfsgidRetGid sets fsgid for current thread and returns previous fsgid set. @@ -1960,36 +1997,46 @@ func Signalfd(fd int, sigmask *Sigset_t, flags int) (newfd int, err error) { //sys preadv2(fd int, iovs []Iovec, offs_l uintptr, offs_h uintptr, flags int) (n int, err error) = SYS_PREADV2 //sys pwritev2(fd int, iovs []Iovec, offs_l uintptr, offs_h uintptr, flags int) (n int, err error) = SYS_PWRITEV2 -func bytes2iovec(bs [][]byte) []Iovec { - iovecs := make([]Iovec, len(bs)) - for i, b := range bs { - iovecs[i].SetLen(len(b)) +// minIovec is the size of the small initial allocation used by +// Readv, Writev, etc. +// +// This small allocation gets stack allocated, which lets the +// common use case of len(iovs) <= minIovs avoid more expensive +// heap allocations. +const minIovec = 8 + +// appendBytes converts bs to Iovecs and appends them to vecs. +func appendBytes(vecs []Iovec, bs [][]byte) []Iovec { + for _, b := range bs { + var v Iovec + v.SetLen(len(b)) if len(b) > 0 { - iovecs[i].Base = &b[0] + v.Base = &b[0] } else { - iovecs[i].Base = (*byte)(unsafe.Pointer(&_zero)) + v.Base = (*byte)(unsafe.Pointer(&_zero)) } + vecs = append(vecs, v) } - return iovecs + return vecs } -// offs2lohi splits offs into its lower and upper unsigned long. On 64-bit -// systems, hi will always be 0. On 32-bit systems, offs will be split in half. -// preadv/pwritev chose this calling convention so they don't need to add a -// padding-register for alignment on ARM. +// offs2lohi splits offs into its low and high order bits. func offs2lohi(offs int64) (lo, hi uintptr) { - return uintptr(offs), uintptr(uint64(offs) >> SizeofLong) + const longBits = SizeofLong * 8 + return uintptr(offs), uintptr(uint64(offs) >> (longBits - 1) >> 1) // two shifts to avoid false positive in vet } func Readv(fd int, iovs [][]byte) (n int, err error) { - iovecs := bytes2iovec(iovs) + iovecs := make([]Iovec, 0, minIovec) + iovecs = appendBytes(iovecs, iovs) n, err = readv(fd, iovecs) readvRacedetect(iovecs, n, err) return n, err } func Preadv(fd int, iovs [][]byte, offset int64) (n int, err error) { - iovecs := bytes2iovec(iovs) + iovecs := make([]Iovec, 0, minIovec) + iovecs = appendBytes(iovecs, iovs) lo, hi := offs2lohi(offset) n, err = preadv(fd, iovecs, lo, hi) readvRacedetect(iovecs, n, err) @@ -1997,7 +2044,8 @@ func Preadv(fd int, iovs [][]byte, offset int64) (n int, err error) { } func Preadv2(fd int, iovs [][]byte, offset int64, flags int) (n int, err error) { - iovecs := bytes2iovec(iovs) + iovecs := make([]Iovec, 0, minIovec) + iovecs = appendBytes(iovecs, iovs) lo, hi := offs2lohi(offset) n, err = preadv2(fd, iovecs, lo, hi, flags) readvRacedetect(iovecs, n, err) @@ -2024,7 +2072,8 @@ func readvRacedetect(iovecs []Iovec, n int, err error) { } func Writev(fd int, iovs [][]byte) (n int, err error) { - iovecs := bytes2iovec(iovs) + iovecs := make([]Iovec, 0, minIovec) + iovecs = appendBytes(iovecs, iovs) if raceenabled { raceReleaseMerge(unsafe.Pointer(&ioSync)) } @@ -2034,7 +2083,8 @@ func Writev(fd int, iovs [][]byte) (n int, err error) { } func Pwritev(fd int, iovs [][]byte, offset int64) (n int, err error) { - iovecs := bytes2iovec(iovs) + iovecs := make([]Iovec, 0, minIovec) + iovecs = appendBytes(iovecs, iovs) if raceenabled { raceReleaseMerge(unsafe.Pointer(&ioSync)) } @@ -2045,7 +2095,8 @@ func Pwritev(fd int, iovs [][]byte, offset int64) (n int, err error) { } func Pwritev2(fd int, iovs [][]byte, offset int64, flags int) (n int, err error) { - iovecs := bytes2iovec(iovs) + iovecs := make([]Iovec, 0, minIovec) + iovecs = appendBytes(iovecs, iovs) if raceenabled { raceReleaseMerge(unsafe.Pointer(&ioSync)) } @@ -2073,11 +2124,15 @@ func writevRacedetect(iovecs []Iovec, n int) { // mmap varies by architecture; see syscall_linux_*.go. //sys munmap(addr uintptr, length uintptr) (err error) +//sys mremap(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (xaddr uintptr, err error) -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, +var mapper = &mremapMmapper{ + mmapper: mmapper{ + active: make(map[*byte][]byte), + mmap: mmap, + munmap: munmap, + }, + mremap: mremap, } func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { @@ -2088,6 +2143,10 @@ func Munmap(b []byte) (err error) { return mapper.Munmap(b) } +func Mremap(oldData []byte, newLength int, flags int) (data []byte, err error) { + return mapper.Mremap(oldData, newLength, flags) +} + //sys Madvise(b []byte, advice int) (err error) //sys Mprotect(b []byte, prot int) (err error) //sys Mlock(b []byte) (err error) @@ -2126,6 +2185,14 @@ func isGroupMember(gid int) bool { return false } +func isCapDacOverrideSet() bool { + hdr := CapUserHeader{Version: LINUX_CAPABILITY_VERSION_3} + data := [2]CapUserData{} + err := Capget(&hdr, &data[0]) + + return err == nil && data[0].Effective&(1< 0 { + clp = &strbuf{ + Len: int32(len(cl)), + Buf: (*int8)(unsafe.Pointer(&cl[0])), + } + } + if len(data) > 0 { + datap = &strbuf{ + Len: int32(len(data)), + Buf: (*int8)(unsafe.Pointer(&data[0])), + } + } + return putmsg(fd, clp, datap, flags) +} + +//sys getmsg(fd int, clptr *strbuf, dataptr *strbuf, flags *int) (err error) + +func Getmsg(fd int, cl []byte, data []byte) (retCl []byte, retData []byte, flags int, err error) { + var clp, datap *strbuf + if len(cl) > 0 { + clp = &strbuf{ + Maxlen: int32(len(cl)), + Buf: (*int8)(unsafe.Pointer(&cl[0])), + } } - return int(got), err + if len(data) > 0 { + datap = &strbuf{ + Maxlen: int32(len(data)), + Buf: (*int8)(unsafe.Pointer(&data[0])), + } + } + + if err = getmsg(fd, clp, datap, &flags); err != nil { + return nil, nil, 0, err + } + + if len(cl) > 0 { + retCl = cl[:clp.Len] + } + if len(data) > 0 { + retData = data[:datap.Len] + } + return retCl, retData, flags, nil +} + +func IoctlSetIntRetInt(fd int, req int, arg int) (int, error) { + return ioctlRet(fd, req, uintptr(arg)) +} + +func IoctlSetString(fd int, req int, val string) error { + bs := make([]byte, len(val)+1) + copy(bs[:len(bs)-1], val) + err := ioctlPtr(fd, req, unsafe.Pointer(&bs[0])) + runtime.KeepAlive(&bs[0]) + return err +} + +// Lifreq Helpers + +func (l *Lifreq) SetName(name string) error { + if len(name) >= len(l.Name) { + return fmt.Errorf("name cannot be more than %d characters", len(l.Name)-1) + } + for i := range name { + l.Name[i] = int8(name[i]) + } + return nil +} + +func (l *Lifreq) SetLifruInt(d int) { + *(*int)(unsafe.Pointer(&l.Lifru[0])) = d +} + +func (l *Lifreq) GetLifruInt() int { + return *(*int)(unsafe.Pointer(&l.Lifru[0])) +} + +func (l *Lifreq) SetLifruUint(d uint) { + *(*uint)(unsafe.Pointer(&l.Lifru[0])) = d +} + +func (l *Lifreq) GetLifruUint() uint { + return *(*uint)(unsafe.Pointer(&l.Lifru[0])) +} + +func IoctlLifreq(fd int, req int, l *Lifreq) error { + return ioctlPtr(fd, req, unsafe.Pointer(l)) +} + +// Strioctl Helpers + +func (s *Strioctl) SetInt(i int) { + s.Len = int32(unsafe.Sizeof(i)) + s.Dp = (*int8)(unsafe.Pointer(&i)) +} + +func IoctlSetStrioctlRetInt(fd int, req int, s *Strioctl) (int, error) { + return ioctlPtrRet(fd, req, unsafe.Pointer(s)) } diff --git a/vendor/golang.org/x/sys/unix/syscall_unix.go b/vendor/golang.org/x/sys/unix/syscall_unix.go index 1ff5060..8e48c29 100644 --- a/vendor/golang.org/x/sys/unix/syscall_unix.go +++ b/vendor/golang.org/x/sys/unix/syscall_unix.go @@ -13,8 +13,6 @@ import ( "sync" "syscall" "unsafe" - - "golang.org/x/sys/internal/unsafeheader" ) var ( @@ -117,11 +115,7 @@ func (m *mmapper) Mmap(fd int, offset int64, length int, prot int, flags int) (d } // Use unsafe to convert addr into a []byte. - var b []byte - hdr := (*unsafeheader.Slice)(unsafe.Pointer(&b)) - hdr.Data = unsafe.Pointer(addr) - hdr.Cap = length - hdr.Len = length + b := unsafe.Slice((*byte)(unsafe.Pointer(addr)), length) // Register mapping in m and return it. p := &b[cap(b)-1] @@ -337,6 +331,19 @@ func Recvfrom(fd int, p []byte, flags int) (n int, from Sockaddr, err error) { return } +// Recvmsg receives a message from a socket using the recvmsg system call. The +// received non-control data will be written to p, and any "out of band" +// control data will be written to oob. The flags are passed to recvmsg. +// +// The results are: +// - n is the number of non-control data bytes read into p +// - oobn is the number of control data bytes read into oob; this may be interpreted using [ParseSocketControlMessage] +// - recvflags is flags returned by recvmsg +// - from is the address of the sender +// +// If the underlying socket type is not SOCK_DGRAM, a received message +// containing oob data and a single '\0' of non-control data is treated as if +// the message contained only control data, i.e. n will be zero on return. func Recvmsg(fd int, p, oob []byte, flags int) (n, oobn int, recvflags int, from Sockaddr, err error) { var iov [1]Iovec if len(p) > 0 { @@ -352,13 +359,9 @@ func Recvmsg(fd int, p, oob []byte, flags int) (n, oobn int, recvflags int, from return } -// RecvmsgBuffers receives a message from a socket using the recvmsg -// system call. The flags are passed to recvmsg. Any non-control data -// read is scattered into the buffers slices. The results are: -// - n is the number of non-control data read into bufs -// - oobn is the number of control data read into oob; this may be interpreted using [ParseSocketControlMessage] -// - recvflags is flags returned by recvmsg -// - from is the address of the sender +// RecvmsgBuffers receives a message from a socket using the recvmsg system +// call. This function is equivalent to Recvmsg, but non-control data read is +// scattered into the buffers slices. func RecvmsgBuffers(fd int, buffers [][]byte, oob []byte, flags int) (n, oobn int, recvflags int, from Sockaddr, err error) { iov := make([]Iovec, len(buffers)) for i := range buffers { @@ -377,11 +380,38 @@ func RecvmsgBuffers(fd int, buffers [][]byte, oob []byte, flags int) (n, oobn in return } +// Sendmsg sends a message on a socket to an address using the sendmsg system +// call. This function is equivalent to SendmsgN, but does not return the +// number of bytes actually sent. func Sendmsg(fd int, p, oob []byte, to Sockaddr, flags int) (err error) { _, err = SendmsgN(fd, p, oob, to, flags) return } +// SendmsgN sends a message on a socket to an address using the sendmsg system +// call. p contains the non-control data to send, and oob contains the "out of +// band" control data. The flags are passed to sendmsg. The number of +// non-control bytes actually written to the socket is returned. +// +// Some socket types do not support sending control data without accompanying +// non-control data. If p is empty, and oob contains control data, and the +// underlying socket type is not SOCK_DGRAM, p will be treated as containing a +// single '\0' and the return value will indicate zero bytes sent. +// +// The Go function Recvmsg, if called with an empty p and a non-empty oob, +// will read and ignore this additional '\0'. If the message is received by +// code that does not use Recvmsg, or that does not use Go at all, that code +// will need to be written to expect and ignore the additional '\0'. +// +// If you need to send non-empty oob with p actually empty, and if the +// underlying socket type supports it, you can do so via a raw system call as +// follows: +// +// msg := &unix.Msghdr{ +// Control: &oob[0], +// } +// msg.SetControllen(len(oob)) +// n, _, errno := unix.Syscall(unix.SYS_SENDMSG, uintptr(fd), uintptr(unsafe.Pointer(msg)), flags) func SendmsgN(fd int, p, oob []byte, to Sockaddr, flags int) (n int, err error) { var iov [1]Iovec if len(p) > 0 { @@ -400,9 +430,8 @@ func SendmsgN(fd int, p, oob []byte, to Sockaddr, flags int) (n int, err error) } // SendmsgBuffers sends a message on a socket to an address using the sendmsg -// system call. The flags are passed to sendmsg. Any non-control data written -// is gathered from buffers. The function returns the number of bytes written -// to the socket. +// system call. This function is equivalent to SendmsgN, but the non-control +// data is gathered from buffers. func SendmsgBuffers(fd int, buffers [][]byte, oob []byte, to Sockaddr, flags int) (n int, err error) { iov := make([]Iovec, len(buffers)) for i := range buffers { @@ -429,11 +458,15 @@ func Send(s int, buf []byte, flags int) (err error) { } func Sendto(fd int, p []byte, flags int, to Sockaddr) (err error) { - ptr, n, err := to.sockaddr() - if err != nil { - return err + var ptr unsafe.Pointer + var salen _Socklen + if to != nil { + ptr, salen, err = to.sockaddr() + if err != nil { + return err + } } - return sendto(fd, p, flags, ptr, n) + return sendto(fd, p, flags, ptr, salen) } func SetsockoptByte(fd, level, opt int, value byte) (err error) { @@ -545,7 +578,7 @@ func Lutimes(path string, tv []Timeval) error { return UtimesNanoAt(AT_FDCWD, path, ts, AT_SYMLINK_NOFOLLOW) } -// emptyIovec reports whether there are no bytes in the slice of Iovec. +// emptyIovecs reports whether there are no bytes in the slice of Iovec. func emptyIovecs(iov []Iovec) bool { for i := range iov { if iov[i].Len > 0 { @@ -554,3 +587,10 @@ func emptyIovecs(iov []Iovec) bool { } return true } + +// Setrlimit sets a resource limit. +func Setrlimit(resource int, rlim *Rlimit) error { + // Just call the syscall version, because as of Go 1.21 + // it will affect starting a new process. + return syscall.Setrlimit(resource, (*syscall.Rlimit)(rlim)) +} diff --git a/vendor/golang.org/x/sys/unix/syscall_unix_gc.go b/vendor/golang.org/x/sys/unix/syscall_unix_gc.go index 5898e9a..b6919ca 100644 --- a/vendor/golang.org/x/sys/unix/syscall_unix_gc.go +++ b/vendor/golang.org/x/sys/unix/syscall_unix_gc.go @@ -2,11 +2,9 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build (darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris) && gc && !ppc64le && !ppc64 -// +build darwin dragonfly freebsd linux netbsd openbsd solaris +//go:build (darwin || dragonfly || freebsd || (linux && !ppc64 && !ppc64le) || netbsd || openbsd || solaris) && gc +// +build darwin dragonfly freebsd linux,!ppc64,!ppc64le netbsd openbsd solaris // +build gc -// +build !ppc64le -// +build !ppc64 package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go b/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go index f8616f4..d3d49ec 100644 --- a/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go @@ -9,8 +9,10 @@ package unix import ( "bytes" + "fmt" "runtime" "sort" + "strings" "sync" "syscall" "unsafe" @@ -55,7 +57,13 @@ func (d *Dirent) NameString() string { if d == nil { return "" } - return string(d.Name[:d.Namlen]) + s := string(d.Name[:]) + idx := strings.IndexByte(s, 0) + if idx == -1 { + return s + } else { + return s[:idx] + } } func (sa *SockaddrInet4) sockaddr() (unsafe.Pointer, _Socklen, error) { @@ -131,8 +139,7 @@ func anyToSockaddr(_ int, rsa *RawSockaddrAny) (Sockaddr, error) { for n < int(pp.Len) && pp.Path[n] != 0 { n++ } - bytes := (*[len(pp.Path)]byte)(unsafe.Pointer(&pp.Path[0]))[0:n] - sa.Name = string(bytes) + sa.Name = string(unsafe.Slice((*byte)(unsafe.Pointer(&pp.Path[0])), n)) return sa, nil case AF_INET: @@ -205,7 +212,8 @@ func (cmsg *Cmsghdr) SetLen(length int) { //sys sendmsg(s int, msg *Msghdr, flags int) (n int, err error) = SYS___SENDMSG_A //sys mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) = SYS_MMAP //sys munmap(addr uintptr, length uintptr) (err error) = SYS_MUNMAP -//sys ioctl(fd int, req uint, arg uintptr) (err error) = SYS_IOCTL +//sys ioctl(fd int, req int, arg uintptr) (err error) = SYS_IOCTL +//sys ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) = SYS_IOCTL //sys Access(path string, mode uint32) (err error) = SYS___ACCESS_A //sys Chdir(path string) (err error) = SYS___CHDIR_A @@ -1230,6 +1238,14 @@ func Readdir(dir uintptr) (*Dirent, error) { return &ent, err } +func readdir_r(dirp uintptr, entry *direntLE, result **direntLE) (err error) { + r0, _, e1 := syscall_syscall(SYS___READDIR_R_A, dirp, uintptr(unsafe.Pointer(entry)), uintptr(unsafe.Pointer(result))) + if int64(r0) == -1 { + err = errnoErr(Errno(e1)) + } + return +} + func Closedir(dir uintptr) error { _, _, e := syscall_syscall(SYS_CLOSEDIR, dir, 0, 0) if e != 0 { @@ -1821,3 +1837,158 @@ func Unmount(name string, mtm int) (err error) { } return err } + +func fdToPath(dirfd int) (path string, err error) { + var buffer [1024]byte + // w_ctrl() + ret := runtime.CallLeFuncByPtr(runtime.XplinkLibvec+SYS_W_IOCTL<<4, + []uintptr{uintptr(dirfd), 17, 1024, uintptr(unsafe.Pointer(&buffer[0]))}) + if ret == 0 { + zb := bytes.IndexByte(buffer[:], 0) + if zb == -1 { + zb = len(buffer) + } + // __e2a_l() + runtime.CallLeFuncByPtr(runtime.XplinkLibvec+SYS___E2A_L<<4, + []uintptr{uintptr(unsafe.Pointer(&buffer[0])), uintptr(zb)}) + return string(buffer[:zb]), nil + } + // __errno() + errno := int(*(*int32)(unsafe.Pointer(runtime.CallLeFuncByPtr(runtime.XplinkLibvec+SYS___ERRNO<<4, + []uintptr{})))) + // __errno2() + errno2 := int(runtime.CallLeFuncByPtr(runtime.XplinkLibvec+SYS___ERRNO2<<4, + []uintptr{})) + // strerror_r() + ret = runtime.CallLeFuncByPtr(runtime.XplinkLibvec+SYS_STRERROR_R<<4, + []uintptr{uintptr(errno), uintptr(unsafe.Pointer(&buffer[0])), 1024}) + if ret == 0 { + zb := bytes.IndexByte(buffer[:], 0) + if zb == -1 { + zb = len(buffer) + } + return "", fmt.Errorf("%s (errno2=0x%x)", buffer[:zb], errno2) + } else { + return "", fmt.Errorf("fdToPath errno %d (errno2=0x%x)", errno, errno2) + } +} + +func direntLeToDirentUnix(dirent *direntLE, dir uintptr, path string) (Dirent, error) { + var d Dirent + + d.Ino = uint64(dirent.Ino) + offset, err := Telldir(dir) + if err != nil { + return d, err + } + + d.Off = int64(offset) + s := string(bytes.Split(dirent.Name[:], []byte{0})[0]) + copy(d.Name[:], s) + + d.Reclen = uint16(24 + len(d.NameString())) + var st Stat_t + path = path + "/" + s + err = Lstat(path, &st) + if err != nil { + return d, err + } + + d.Type = uint8(st.Mode >> 24) + return d, err +} + +func Getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) { + // Simulation of Getdirentries port from the Darwin implementation. + // COMMENTS FROM DARWIN: + // It's not the full required semantics, but should handle the case + // of calling Getdirentries or ReadDirent repeatedly. + // It won't handle assigning the results of lseek to *basep, or handle + // the directory being edited underfoot. + + skip, err := Seek(fd, 0, 1 /* SEEK_CUR */) + if err != nil { + return 0, err + } + + // Get path from fd to avoid unavailable call (fdopendir) + path, err := fdToPath(fd) + if err != nil { + return 0, err + } + d, err := Opendir(path) + if err != nil { + return 0, err + } + defer Closedir(d) + + var cnt int64 + for { + var entryLE direntLE + var entrypLE *direntLE + e := readdir_r(d, &entryLE, &entrypLE) + if e != nil { + return n, e + } + if entrypLE == nil { + break + } + if skip > 0 { + skip-- + cnt++ + continue + } + + // Dirent on zos has a different structure + entry, e := direntLeToDirentUnix(&entryLE, d, path) + if e != nil { + return n, e + } + + reclen := int(entry.Reclen) + if reclen > len(buf) { + // Not enough room. Return for now. + // The counter will let us know where we should start up again. + // Note: this strategy for suspending in the middle and + // restarting is O(n^2) in the length of the directory. Oh well. + break + } + + // Copy entry into return buffer. + s := unsafe.Slice((*byte)(unsafe.Pointer(&entry)), reclen) + copy(buf, s) + + buf = buf[reclen:] + n += reclen + cnt++ + } + // Set the seek offset of the input fd to record + // how many files we've already returned. + _, err = Seek(fd, cnt, 0 /* SEEK_SET */) + if err != nil { + return n, err + } + + return n, nil +} + +func ReadDirent(fd int, buf []byte) (n int, err error) { + var base = (*uintptr)(unsafe.Pointer(new(uint64))) + return Getdirentries(fd, buf, base) +} + +func direntIno(buf []byte) (uint64, bool) { + return readInt(buf, unsafe.Offsetof(Dirent{}.Ino), unsafe.Sizeof(Dirent{}.Ino)) +} + +func direntReclen(buf []byte) (uint64, bool) { + return readInt(buf, unsafe.Offsetof(Dirent{}.Reclen), unsafe.Sizeof(Dirent{}.Reclen)) +} + +func direntNamlen(buf []byte) (uint64, bool) { + reclen, ok := direntReclen(buf) + if !ok { + return 0, false + } + return reclen - uint64(unsafe.Offsetof(Dirent{}.Name)), true +} diff --git a/vendor/golang.org/x/sys/unix/sysvshm_unix.go b/vendor/golang.org/x/sys/unix/sysvshm_unix.go index 0bb4c8d..5bb41d1 100644 --- a/vendor/golang.org/x/sys/unix/sysvshm_unix.go +++ b/vendor/golang.org/x/sys/unix/sysvshm_unix.go @@ -7,11 +7,7 @@ package unix -import ( - "unsafe" - - "golang.org/x/sys/internal/unsafeheader" -) +import "unsafe" // SysvShmAttach attaches the Sysv shared memory segment associated with the // shared memory identifier id. @@ -34,12 +30,7 @@ func SysvShmAttach(id int, addr uintptr, flag int) ([]byte, error) { } // Use unsafe to convert addr into a []byte. - // TODO: convert to unsafe.Slice once we can assume Go 1.17 - var b []byte - hdr := (*unsafeheader.Slice)(unsafe.Pointer(&b)) - hdr.Data = unsafe.Pointer(addr) - hdr.Cap = int(info.Segsz) - hdr.Len = int(info.Segsz) + b := unsafe.Slice((*byte)(unsafe.Pointer(addr)), int(info.Segsz)) return b, nil } diff --git a/vendor/golang.org/x/sys/unix/timestruct.go b/vendor/golang.org/x/sys/unix/timestruct.go index 3d89304..616b1b2 100644 --- a/vendor/golang.org/x/sys/unix/timestruct.go +++ b/vendor/golang.org/x/sys/unix/timestruct.go @@ -9,7 +9,7 @@ package unix import "time" -// TimespecToNSec returns the time stored in ts as nanoseconds. +// TimespecToNsec returns the time stored in ts as nanoseconds. func TimespecToNsec(ts Timespec) int64 { return ts.Nano() } // NsecToTimespec converts a number of nanoseconds into a Timespec. diff --git a/vendor/golang.org/x/sys/unix/xattr_bsd.go b/vendor/golang.org/x/sys/unix/xattr_bsd.go index 25df1e3..f5f8e9f 100644 --- a/vendor/golang.org/x/sys/unix/xattr_bsd.go +++ b/vendor/golang.org/x/sys/unix/xattr_bsd.go @@ -36,9 +36,14 @@ func xattrnamespace(fullattr string) (ns int, attr string, err error) { func initxattrdest(dest []byte, idx int) (d unsafe.Pointer) { if len(dest) > idx { return unsafe.Pointer(&dest[idx]) - } else { - return unsafe.Pointer(_zero) } + if dest != nil { + // extattr_get_file and extattr_list_file treat NULL differently from + // a non-NULL pointer of length zero. Preserve the property of nilness, + // even if we can't use dest directly. + return unsafe.Pointer(&_zero) + } + return nil } // FreeBSD and NetBSD implement their own syscalls to handle extended attributes @@ -160,13 +165,12 @@ func Lremovexattr(link string, attr string) (err error) { } func Listxattr(file string, dest []byte) (sz int, err error) { - d := initxattrdest(dest, 0) destsiz := len(dest) // FreeBSD won't allow you to list xattrs from multiple namespaces - s := 0 + s, pos := 0, 0 for _, nsid := range [...]int{EXTATTR_NAMESPACE_USER, EXTATTR_NAMESPACE_SYSTEM} { - stmp, e := ExtattrListFile(file, nsid, uintptr(d), destsiz) + stmp, e := ListxattrNS(file, nsid, dest[pos:]) /* Errors accessing system attrs are ignored so that * we can implement the Linux-like behavior of omitting errors that @@ -175,66 +179,102 @@ func Listxattr(file string, dest []byte) (sz int, err error) { * Linux will still error if we ask for user attributes on a file that * we don't have read permissions on, so don't ignore those errors */ - if e != nil && e == EPERM && nsid != EXTATTR_NAMESPACE_USER { - continue - } else if e != nil { + if e != nil { + if e == EPERM && nsid != EXTATTR_NAMESPACE_USER { + continue + } return s, e } s += stmp - destsiz -= s - if destsiz < 0 { - destsiz = 0 + pos = s + if pos > destsiz { + pos = destsiz } - d = initxattrdest(dest, s) } return s, nil } -func Flistxattr(fd int, dest []byte) (sz int, err error) { +func ListxattrNS(file string, nsid int, dest []byte) (sz int, err error) { d := initxattrdest(dest, 0) destsiz := len(dest) - s := 0 + s, e := ExtattrListFile(file, nsid, uintptr(d), destsiz) + if e != nil { + return 0, err + } + + return s, nil +} + +func Flistxattr(fd int, dest []byte) (sz int, err error) { + destsiz := len(dest) + + s, pos := 0, 0 for _, nsid := range [...]int{EXTATTR_NAMESPACE_USER, EXTATTR_NAMESPACE_SYSTEM} { - stmp, e := ExtattrListFd(fd, nsid, uintptr(d), destsiz) - if e != nil && e == EPERM && nsid != EXTATTR_NAMESPACE_USER { - continue - } else if e != nil { + stmp, e := FlistxattrNS(fd, nsid, dest[pos:]) + + if e != nil { + if e == EPERM && nsid != EXTATTR_NAMESPACE_USER { + continue + } return s, e } s += stmp - destsiz -= s - if destsiz < 0 { - destsiz = 0 + pos = s + if pos > destsiz { + pos = destsiz } - d = initxattrdest(dest, s) } return s, nil } -func Llistxattr(link string, dest []byte) (sz int, err error) { +func FlistxattrNS(fd int, nsid int, dest []byte) (sz int, err error) { d := initxattrdest(dest, 0) destsiz := len(dest) - s := 0 + s, e := ExtattrListFd(fd, nsid, uintptr(d), destsiz) + if e != nil { + return 0, err + } + + return s, nil +} + +func Llistxattr(link string, dest []byte) (sz int, err error) { + destsiz := len(dest) + + s, pos := 0, 0 for _, nsid := range [...]int{EXTATTR_NAMESPACE_USER, EXTATTR_NAMESPACE_SYSTEM} { - stmp, e := ExtattrListLink(link, nsid, uintptr(d), destsiz) - if e != nil && e == EPERM && nsid != EXTATTR_NAMESPACE_USER { - continue - } else if e != nil { + stmp, e := LlistxattrNS(link, nsid, dest[pos:]) + + if e != nil { + if e == EPERM && nsid != EXTATTR_NAMESPACE_USER { + continue + } return s, e } s += stmp - destsiz -= s - if destsiz < 0 { - destsiz = 0 + pos = s + if pos > destsiz { + pos = destsiz } - d = initxattrdest(dest, s) + } + + return s, nil +} + +func LlistxattrNS(link string, nsid int, dest []byte) (sz int, err error) { + d := initxattrdest(dest, 0) + destsiz := len(dest) + + s, e := ExtattrListLink(link, nsid, uintptr(d), destsiz) + if e != nil { + return 0, err } return s, nil diff --git a/vendor/golang.org/x/sys/unix/zerrors_darwin_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_darwin_amd64.go index 476a1c7..1430076 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_darwin_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_darwin_amd64.go @@ -1270,6 +1270,16 @@ const ( SEEK_END = 0x2 SEEK_HOLE = 0x3 SEEK_SET = 0x0 + SF_APPEND = 0x40000 + SF_ARCHIVED = 0x10000 + SF_DATALESS = 0x40000000 + SF_FIRMLINK = 0x800000 + SF_IMMUTABLE = 0x20000 + SF_NOUNLINK = 0x100000 + SF_RESTRICTED = 0x80000 + SF_SETTABLE = 0x3fff0000 + SF_SUPPORTED = 0x9f0000 + SF_SYNTHETIC = 0xc0000000 SHUT_RD = 0x0 SHUT_RDWR = 0x2 SHUT_WR = 0x1 @@ -1543,6 +1553,15 @@ const ( TIOCTIMESTAMP = 0x40107459 TIOCUCNTL = 0x80047466 TOSTOP = 0x400000 + UF_APPEND = 0x4 + UF_COMPRESSED = 0x20 + UF_DATAVAULT = 0x80 + UF_HIDDEN = 0x8000 + UF_IMMUTABLE = 0x2 + UF_NODUMP = 0x1 + UF_OPAQUE = 0x8 + UF_SETTABLE = 0xffff + UF_TRACKED = 0x40 VDISCARD = 0xf VDSUSP = 0xb VEOF = 0x0 diff --git a/vendor/golang.org/x/sys/unix/zerrors_darwin_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_darwin_arm64.go index e36f517..ab044a7 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_darwin_arm64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_darwin_arm64.go @@ -1270,6 +1270,16 @@ const ( SEEK_END = 0x2 SEEK_HOLE = 0x3 SEEK_SET = 0x0 + SF_APPEND = 0x40000 + SF_ARCHIVED = 0x10000 + SF_DATALESS = 0x40000000 + SF_FIRMLINK = 0x800000 + SF_IMMUTABLE = 0x20000 + SF_NOUNLINK = 0x100000 + SF_RESTRICTED = 0x80000 + SF_SETTABLE = 0x3fff0000 + SF_SUPPORTED = 0x9f0000 + SF_SYNTHETIC = 0xc0000000 SHUT_RD = 0x0 SHUT_RDWR = 0x2 SHUT_WR = 0x1 @@ -1543,6 +1553,15 @@ const ( TIOCTIMESTAMP = 0x40107459 TIOCUCNTL = 0x80047466 TOSTOP = 0x400000 + UF_APPEND = 0x4 + UF_COMPRESSED = 0x20 + UF_DATAVAULT = 0x80 + UF_HIDDEN = 0x8000 + UF_IMMUTABLE = 0x2 + UF_NODUMP = 0x1 + UF_OPAQUE = 0x8 + UF_SETTABLE = 0xffff + UF_TRACKED = 0x40 VDISCARD = 0xf VDSUSP = 0xb VEOF = 0x0 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux.go b/vendor/golang.org/x/sys/unix/zerrors_linux.go index 785d693..3784f40 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux.go @@ -70,6 +70,7 @@ const ( ALG_SET_DRBG_ENTROPY = 0x6 ALG_SET_IV = 0x2 ALG_SET_KEY = 0x1 + ALG_SET_KEY_BY_KEY_SERIAL = 0x7 ALG_SET_OP = 0x3 ANON_INODE_FS_MAGIC = 0x9041934 ARPHRD_6LOWPAN = 0x339 @@ -457,7 +458,6 @@ const ( B600 = 0x8 B75 = 0x2 B9600 = 0xd - BALLOON_KVM_MAGIC = 0x13661366 BDEVFS_MAGIC = 0x62646576 BINDERFS_SUPER_MAGIC = 0x6c6f6f70 BINFMTFS_MAGIC = 0x42494e4d @@ -493,6 +493,7 @@ const ( BPF_F_TEST_RUN_ON_CPU = 0x1 BPF_F_TEST_STATE_FREQ = 0x8 BPF_F_TEST_XDP_LIVE_FRAMES = 0x2 + BPF_F_XDP_DEV_BOUND_ONLY = 0x40 BPF_F_XDP_HAS_FRAGS = 0x20 BPF_H = 0x8 BPF_IMM = 0x0 @@ -563,6 +564,7 @@ const ( BUS_USB = 0x3 BUS_VIRTUAL = 0x6 CAN_BCM = 0x2 + CAN_BUS_OFF_THRESHOLD = 0x100 CAN_CTRLMODE_3_SAMPLES = 0x4 CAN_CTRLMODE_BERR_REPORTING = 0x10 CAN_CTRLMODE_CC_LEN8_DLC = 0x100 @@ -577,9 +579,12 @@ const ( CAN_EFF_FLAG = 0x80000000 CAN_EFF_ID_BITS = 0x1d CAN_EFF_MASK = 0x1fffffff + CAN_ERROR_PASSIVE_THRESHOLD = 0x80 + CAN_ERROR_WARNING_THRESHOLD = 0x60 CAN_ERR_ACK = 0x20 CAN_ERR_BUSERROR = 0x80 CAN_ERR_BUSOFF = 0x40 + CAN_ERR_CNT = 0x200 CAN_ERR_CRTL = 0x4 CAN_ERR_CRTL_ACTIVE = 0x40 CAN_ERR_CRTL_RX_OVERFLOW = 0x1 @@ -771,6 +776,8 @@ const ( DEVLINK_GENL_MCGRP_CONFIG_NAME = "config" DEVLINK_GENL_NAME = "devlink" DEVLINK_GENL_VERSION = 0x1 + DEVLINK_PORT_FN_CAP_MIGRATABLE = 0x2 + DEVLINK_PORT_FN_CAP_ROCE = 0x1 DEVLINK_SB_THRESHOLD_TO_ALPHA_MAX = 0x14 DEVLINK_SUPPORTED_FLASH_OVERWRITE_SECTIONS = 0x3 DEVMEM_MAGIC = 0x454d444d @@ -820,9 +827,9 @@ const ( DM_UUID_FLAG = 0x4000 DM_UUID_LEN = 0x81 DM_VERSION = 0xc138fd00 - DM_VERSION_EXTRA = "-ioctl (2022-02-22)" + DM_VERSION_EXTRA = "-ioctl (2023-03-01)" DM_VERSION_MAJOR = 0x4 - DM_VERSION_MINOR = 0x2e + DM_VERSION_MINOR = 0x30 DM_VERSION_PATCHLEVEL = 0x0 DT_BLK = 0x6 DT_CHR = 0x2 @@ -1049,6 +1056,7 @@ const ( ETH_P_CAIF = 0xf7 ETH_P_CAN = 0xc ETH_P_CANFD = 0xd + ETH_P_CANXL = 0xe ETH_P_CFM = 0x8902 ETH_P_CONTROL = 0x16 ETH_P_CUST = 0x6006 @@ -1060,6 +1068,7 @@ const ( ETH_P_DNA_RT = 0x6003 ETH_P_DSA = 0x1b ETH_P_DSA_8021Q = 0xdadb + ETH_P_DSA_A5PSW = 0xe001 ETH_P_ECONET = 0x18 ETH_P_EDSA = 0xdada ETH_P_ERSPAN = 0x88be @@ -1189,13 +1198,16 @@ const ( FAN_EVENT_METADATA_LEN = 0x18 FAN_EVENT_ON_CHILD = 0x8000000 FAN_FS_ERROR = 0x8000 + FAN_INFO = 0x20 FAN_MARK_ADD = 0x1 FAN_MARK_DONT_FOLLOW = 0x4 FAN_MARK_EVICTABLE = 0x200 FAN_MARK_FILESYSTEM = 0x100 FAN_MARK_FLUSH = 0x80 + FAN_MARK_IGNORE = 0x400 FAN_MARK_IGNORED_MASK = 0x20 FAN_MARK_IGNORED_SURV_MODIFY = 0x40 + FAN_MARK_IGNORE_SURV = 0x440 FAN_MARK_INODE = 0x0 FAN_MARK_MOUNT = 0x10 FAN_MARK_ONLYDIR = 0x8 @@ -1223,6 +1235,8 @@ const ( FAN_REPORT_PIDFD = 0x80 FAN_REPORT_TARGET_FID = 0x1000 FAN_REPORT_TID = 0x100 + FAN_RESPONSE_INFO_AUDIT_RULE = 0x1 + FAN_RESPONSE_INFO_NONE = 0x0 FAN_UNLIMITED_MARKS = 0x20 FAN_UNLIMITED_QUEUE = 0x10 FD_CLOEXEC = 0x1 @@ -1253,7 +1267,10 @@ const ( FSCRYPT_MODE_AES_128_CBC = 0x5 FSCRYPT_MODE_AES_128_CTS = 0x6 FSCRYPT_MODE_AES_256_CTS = 0x4 + FSCRYPT_MODE_AES_256_HCTR2 = 0xa FSCRYPT_MODE_AES_256_XTS = 0x1 + FSCRYPT_MODE_SM4_CTS = 0x8 + FSCRYPT_MODE_SM4_XTS = 0x7 FSCRYPT_POLICY_FLAGS_PAD_16 = 0x2 FSCRYPT_POLICY_FLAGS_PAD_32 = 0x3 FSCRYPT_POLICY_FLAGS_PAD_4 = 0x0 @@ -1272,8 +1289,6 @@ const ( FS_ENCRYPTION_MODE_AES_256_GCM = 0x2 FS_ENCRYPTION_MODE_AES_256_XTS = 0x1 FS_ENCRYPTION_MODE_INVALID = 0x0 - FS_ENCRYPTION_MODE_SPECK128_256_CTS = 0x8 - FS_ENCRYPTION_MODE_SPECK128_256_XTS = 0x7 FS_IOC_ADD_ENCRYPTION_KEY = 0xc0506617 FS_IOC_GET_ENCRYPTION_KEY_STATUS = 0xc080661a FS_IOC_GET_ENCRYPTION_POLICY_EX = 0xc0096616 @@ -1430,6 +1445,7 @@ const ( IFF_NOARP = 0x80 IFF_NOFILTER = 0x1000 IFF_NOTRAILERS = 0x20 + IFF_NO_CARRIER = 0x40 IFF_NO_PI = 0x1000 IFF_ONE_QUEUE = 0x2000 IFF_PERSIST = 0x800 @@ -1761,6 +1777,7 @@ const ( LANDLOCK_ACCESS_FS_REFER = 0x2000 LANDLOCK_ACCESS_FS_REMOVE_DIR = 0x10 LANDLOCK_ACCESS_FS_REMOVE_FILE = 0x20 + LANDLOCK_ACCESS_FS_TRUNCATE = 0x4000 LANDLOCK_ACCESS_FS_WRITE_FILE = 0x2 LANDLOCK_CREATE_RULESET_VERSION = 0x1 LINUX_REBOOT_CMD_CAD_OFF = 0x0 @@ -1800,11 +1817,13 @@ const ( LWTUNNEL_IP_OPT_GENEVE_MAX = 0x3 LWTUNNEL_IP_OPT_VXLAN_MAX = 0x1 MADV_COLD = 0x14 + MADV_COLLAPSE = 0x19 MADV_DODUMP = 0x11 MADV_DOFORK = 0xb MADV_DONTDUMP = 0x10 MADV_DONTFORK = 0xa MADV_DONTNEED = 0x4 + MADV_DONTNEED_LOCKED = 0x18 MADV_FREE = 0x8 MADV_HUGEPAGE = 0xe MADV_HWPOISON = 0x64 @@ -1845,8 +1864,9 @@ const ( MEMWRITEOOB64 = 0xc0184d15 MFD_ALLOW_SEALING = 0x2 MFD_CLOEXEC = 0x1 + MFD_EXEC = 0x10 MFD_HUGETLB = 0x4 - MFD_HUGE_16GB = -0x78000000 + MFD_HUGE_16GB = 0x88000000 MFD_HUGE_16MB = 0x60000000 MFD_HUGE_1GB = 0x78000000 MFD_HUGE_1MB = 0x50000000 @@ -1860,6 +1880,7 @@ const ( MFD_HUGE_8MB = 0x5c000000 MFD_HUGE_MASK = 0x3f MFD_HUGE_SHIFT = 0x1a + MFD_NOEXEC_SEAL = 0x8 MINIX2_SUPER_MAGIC = 0x2468 MINIX2_SUPER_MAGIC2 = 0x2478 MINIX3_SUPER_MAGIC = 0x4d5a @@ -1883,6 +1904,9 @@ const ( MOUNT_ATTR_SIZE_VER0 = 0x20 MOUNT_ATTR_STRICTATIME = 0x20 MOUNT_ATTR__ATIME = 0x70 + MREMAP_DONTUNMAP = 0x4 + MREMAP_FIXED = 0x2 + MREMAP_MAYMOVE = 0x1 MSDOS_SUPER_MAGIC = 0x4d44 MSG_BATCH = 0x40000 MSG_CMSG_CLOEXEC = 0x40000000 @@ -2153,6 +2177,7 @@ const ( PACKET_FANOUT_DATA = 0x16 PACKET_FANOUT_EBPF = 0x7 PACKET_FANOUT_FLAG_DEFRAG = 0x8000 + PACKET_FANOUT_FLAG_IGNORE_OUTGOING = 0x4000 PACKET_FANOUT_FLAG_ROLLOVER = 0x1000 PACKET_FANOUT_FLAG_UNIQUEID = 0x2000 PACKET_FANOUT_HASH = 0x0 @@ -2188,6 +2213,7 @@ const ( PACKET_USER = 0x6 PACKET_VERSION = 0xa PACKET_VNET_HDR = 0xf + PACKET_VNET_HDR_SZ = 0x18 PARITY_CRC16_PR0 = 0x2 PARITY_CRC16_PR0_CCITT = 0x4 PARITY_CRC16_PR1 = 0x3 @@ -2205,6 +2231,7 @@ const ( PERF_ATTR_SIZE_VER5 = 0x70 PERF_ATTR_SIZE_VER6 = 0x78 PERF_ATTR_SIZE_VER7 = 0x80 + PERF_ATTR_SIZE_VER8 = 0x88 PERF_AUX_FLAG_COLLISION = 0x8 PERF_AUX_FLAG_CORESIGHT_FORMAT_CORESIGHT = 0x0 PERF_AUX_FLAG_CORESIGHT_FORMAT_RAW = 0x100 @@ -2212,6 +2239,11 @@ const ( PERF_AUX_FLAG_PARTIAL = 0x4 PERF_AUX_FLAG_PMU_FORMAT_TYPE_MASK = 0xff00 PERF_AUX_FLAG_TRUNCATED = 0x1 + PERF_BR_ARM64_DEBUG_DATA = 0x7 + PERF_BR_ARM64_DEBUG_EXIT = 0x5 + PERF_BR_ARM64_DEBUG_HALT = 0x4 + PERF_BR_ARM64_DEBUG_INST = 0x6 + PERF_BR_ARM64_FIQ = 0x3 PERF_FLAG_FD_CLOEXEC = 0x8 PERF_FLAG_FD_NO_GROUP = 0x1 PERF_FLAG_FD_OUTPUT = 0x2 @@ -2232,6 +2264,8 @@ const ( PERF_MEM_LOCK_NA = 0x1 PERF_MEM_LOCK_SHIFT = 0x18 PERF_MEM_LVLNUM_ANY_CACHE = 0xb + PERF_MEM_LVLNUM_CXL = 0x9 + PERF_MEM_LVLNUM_IO = 0xa PERF_MEM_LVLNUM_L1 = 0x1 PERF_MEM_LVLNUM_L2 = 0x2 PERF_MEM_LVLNUM_L3 = 0x3 @@ -2265,6 +2299,7 @@ const ( PERF_MEM_REMOTE_REMOTE = 0x1 PERF_MEM_REMOTE_SHIFT = 0x25 PERF_MEM_SNOOPX_FWD = 0x1 + PERF_MEM_SNOOPX_PEER = 0x2 PERF_MEM_SNOOPX_SHIFT = 0x26 PERF_MEM_SNOOP_HIT = 0x4 PERF_MEM_SNOOP_HITM = 0x10 @@ -2301,7 +2336,6 @@ const ( PERF_SAMPLE_BRANCH_PLM_ALL = 0x7 PERF_SAMPLE_WEIGHT_TYPE = 0x1004000 PIPEFS_MAGIC = 0x50495045 - PPC_CMM_MAGIC = 0xc7571590 PPPIOCGNPMODE = 0xc008744c PPPIOCNEWUNIT = 0xc004743e PRIO_PGRP = 0x1 @@ -2338,6 +2372,7 @@ const ( PR_FP_EXC_UND = 0x40000 PR_FP_MODE_FR = 0x1 PR_FP_MODE_FRE = 0x2 + PR_GET_AUXV = 0x41555856 PR_GET_CHILD_SUBREAPER = 0x25 PR_GET_DUMPABLE = 0x3 PR_GET_ENDIAN = 0x13 @@ -2346,6 +2381,8 @@ const ( PR_GET_FP_MODE = 0x2e PR_GET_IO_FLUSHER = 0x3a PR_GET_KEEPCAPS = 0x7 + PR_GET_MDWE = 0x42 + PR_GET_MEMORY_MERGE = 0x44 PR_GET_NAME = 0x10 PR_GET_NO_NEW_PRIVS = 0x27 PR_GET_PDEATHSIG = 0x2 @@ -2366,6 +2403,7 @@ const ( PR_MCE_KILL_GET = 0x22 PR_MCE_KILL_LATE = 0x0 PR_MCE_KILL_SET = 0x1 + PR_MDWE_REFUSE_EXEC_GAIN = 0x1 PR_MPX_DISABLE_MANAGEMENT = 0x2c PR_MPX_ENABLE_MANAGEMENT = 0x2b PR_MTE_TAG_MASK = 0x7fff8 @@ -2400,6 +2438,8 @@ const ( PR_SET_FP_MODE = 0x2d PR_SET_IO_FLUSHER = 0x39 PR_SET_KEEPCAPS = 0x8 + PR_SET_MDWE = 0x41 + PR_SET_MEMORY_MERGE = 0x43 PR_SET_MM = 0x23 PR_SET_MM_ARG_END = 0x9 PR_SET_MM_ARG_START = 0x8 @@ -2483,6 +2523,7 @@ const ( PTRACE_GETSIGMASK = 0x420a PTRACE_GET_RSEQ_CONFIGURATION = 0x420f PTRACE_GET_SYSCALL_INFO = 0x420e + PTRACE_GET_SYSCALL_USER_DISPATCH_CONFIG = 0x4211 PTRACE_INTERRUPT = 0x4207 PTRACE_KILL = 0x8 PTRACE_LISTEN = 0x4208 @@ -2513,6 +2554,7 @@ const ( PTRACE_SETREGSET = 0x4205 PTRACE_SETSIGINFO = 0x4203 PTRACE_SETSIGMASK = 0x420b + PTRACE_SET_SYSCALL_USER_DISPATCH_CONFIG = 0x4210 PTRACE_SINGLESTEP = 0x9 PTRACE_SYSCALL = 0x18 PTRACE_SYSCALL_INFO_ENTRY = 0x1 @@ -2944,6 +2986,7 @@ const ( SOL_TCP = 0x6 SOL_TIPC = 0x10f SOL_TLS = 0x11a + SOL_UDP = 0x11 SOL_X25 = 0x106 SOL_XDP = 0x11b SOMAXCONN = 0x1000 @@ -2999,6 +3042,7 @@ const ( STATX_BLOCKS = 0x400 STATX_BTIME = 0x800 STATX_CTIME = 0x80 + STATX_DIOALIGN = 0x2000 STATX_GID = 0x10 STATX_INO = 0x100 STATX_MNT_ID = 0x1000 @@ -3047,7 +3091,7 @@ const ( TASKSTATS_GENL_NAME = "TASKSTATS" TASKSTATS_GENL_VERSION = 0x1 TASKSTATS_TYPE_MAX = 0x6 - TASKSTATS_VERSION = 0xd + TASKSTATS_VERSION = 0xe TCIFLUSH = 0x0 TCIOFF = 0x2 TCIOFLUSH = 0x2 @@ -3213,6 +3257,7 @@ const ( TP_STATUS_COPY = 0x2 TP_STATUS_CSUMNOTREADY = 0x8 TP_STATUS_CSUM_VALID = 0x80 + TP_STATUS_GSO_TCP = 0x100 TP_STATUS_KERNEL = 0x0 TP_STATUS_LOSING = 0x4 TP_STATUS_SENDING = 0x2 @@ -3227,6 +3272,19 @@ const ( TRACEFS_MAGIC = 0x74726163 TS_COMM_LEN = 0x20 UDF_SUPER_MAGIC = 0x15013346 + UDP_CORK = 0x1 + UDP_ENCAP = 0x64 + UDP_ENCAP_ESPINUDP = 0x2 + UDP_ENCAP_ESPINUDP_NON_IKE = 0x1 + UDP_ENCAP_GTP0 = 0x4 + UDP_ENCAP_GTP1U = 0x5 + UDP_ENCAP_L2TPINUDP = 0x3 + UDP_GRO = 0x68 + UDP_NO_CHECK6_RX = 0x66 + UDP_NO_CHECK6_TX = 0x65 + UDP_SEGMENT = 0x67 + UDP_V4_FLOW = 0x2 + UDP_V6_FLOW = 0x6 UMOUNT_NOFOLLOW = 0x8 USBDEVICE_SUPER_MAGIC = 0x9fa2 UTIME_NOW = 0x3fffffff @@ -3392,9 +3450,7 @@ const ( XDP_ZEROCOPY = 0x4 XENFS_SUPER_MAGIC = 0xabba1974 XFS_SUPER_MAGIC = 0x58465342 - Z3FOLD_MAGIC = 0x33 ZONEFS_MAGIC = 0x5a4f4653 - ZSMALLOC_MAGIC = 0x58295829 _HIDIOCGRAWNAME_LEN = 0x80 _HIDIOCGRAWPHYS_LEN = 0x40 _HIDIOCGRAWUNIQ_LEN = 0x40 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_386.go b/vendor/golang.org/x/sys/unix/zerrors_linux_386.go index 274e2da..a46df0f 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_386.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_386.go @@ -1,11 +1,11 @@ -// mkerrors.sh -Wall -Werror -static -I/tmp/include -m32 +// mkerrors.sh -Wall -Werror -static -I/tmp/386/include -m32 // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && linux // +build 386,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include -m32 _const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/386/include -m32 _const.go package unix @@ -133,6 +133,7 @@ const ( MEMGETREGIONCOUNT = 0x80044d07 MEMISLOCKED = 0x80084d17 MEMLOCK = 0x40084d05 + MEMREAD = 0xc03c4d1a MEMREADOOB = 0xc00c4d04 MEMSETBADBLOCK = 0x40084d0c MEMUNLOCK = 0x40084d06 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go index 95b6eee..6cd4a3e 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go @@ -1,11 +1,11 @@ -// mkerrors.sh -Wall -Werror -static -I/tmp/include -m64 +// mkerrors.sh -Wall -Werror -static -I/tmp/amd64/include -m64 // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && linux // +build amd64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include -m64 _const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/amd64/include -m64 _const.go package unix @@ -133,6 +133,7 @@ const ( MEMGETREGIONCOUNT = 0x80044d07 MEMISLOCKED = 0x80084d17 MEMLOCK = 0x40084d05 + MEMREAD = 0xc0404d1a MEMREADOOB = 0xc0104d04 MEMSETBADBLOCK = 0x40084d0c MEMUNLOCK = 0x40084d06 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go b/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go index 918cd13..c7ebee2 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go @@ -1,11 +1,11 @@ -// mkerrors.sh -Wall -Werror -static -I/tmp/include +// mkerrors.sh -Wall -Werror -static -I/tmp/arm/include // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && linux // +build arm,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/arm/include _const.go package unix @@ -131,6 +131,7 @@ const ( MEMGETREGIONCOUNT = 0x80044d07 MEMISLOCKED = 0x80084d17 MEMLOCK = 0x40084d05 + MEMREAD = 0xc0404d1a MEMREADOOB = 0xc00c4d04 MEMSETBADBLOCK = 0x40084d0c MEMUNLOCK = 0x40084d06 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go index 3907dc5..12a9a13 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go @@ -1,11 +1,11 @@ -// mkerrors.sh -Wall -Werror -static -I/tmp/include -fsigned-char +// mkerrors.sh -Wall -Werror -static -I/tmp/arm64/include -fsigned-char // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && linux // +build arm64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include -fsigned-char _const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/arm64/include -fsigned-char _const.go package unix @@ -134,6 +134,7 @@ const ( MEMGETREGIONCOUNT = 0x80044d07 MEMISLOCKED = 0x80084d17 MEMLOCK = 0x40084d05 + MEMREAD = 0xc0404d1a MEMREADOOB = 0xc0104d04 MEMSETBADBLOCK = 0x40084d0c MEMUNLOCK = 0x40084d06 @@ -442,6 +443,7 @@ const ( TIOCSWINSZ = 0x5414 TIOCVHANGUP = 0x5437 TOSTOP = 0x100 + TPIDR2_MAGIC = 0x54504902 TUNATTACHFILTER = 0x401054d5 TUNDETACHFILTER = 0x401054d6 TUNGETDEVNETNS = 0x54e3 @@ -514,6 +516,7 @@ const ( XCASE = 0x4 XTABS = 0x1800 ZA_MAGIC = 0x54366345 + ZT_MAGIC = 0x5a544e01 _HIDIOCGRAWNAME = 0x80804804 _HIDIOCGRAWPHYS = 0x80404805 _HIDIOCGRAWUNIQ = 0x80404808 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go index 03d5c10..f26a164 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go @@ -1,11 +1,11 @@ -// mkerrors.sh -Wall -Werror -static -I/tmp/include +// mkerrors.sh -Wall -Werror -static -I/tmp/loong64/include // Code generated by the command above; see README.md. DO NOT EDIT. //go:build loong64 && linux // +build loong64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/loong64/include _const.go package unix @@ -132,6 +132,7 @@ const ( MEMGETREGIONCOUNT = 0x80044d07 MEMISLOCKED = 0x80084d17 MEMLOCK = 0x40084d05 + MEMREAD = 0xc0404d1a MEMREADOOB = 0xc0104d04 MEMSETBADBLOCK = 0x40084d0c MEMUNLOCK = 0x40084d06 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go index bd794e0..890bc3c 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go @@ -1,11 +1,11 @@ -// mkerrors.sh -Wall -Werror -static -I/tmp/include +// mkerrors.sh -Wall -Werror -static -I/tmp/mips/include // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips && linux // +build mips,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/mips/include _const.go package unix @@ -131,6 +131,7 @@ const ( MEMGETREGIONCOUNT = 0x40044d07 MEMISLOCKED = 0x40084d17 MEMLOCK = 0x80084d05 + MEMREAD = 0xc0404d1a MEMREADOOB = 0xc00c4d04 MEMSETBADBLOCK = 0x80084d0c MEMUNLOCK = 0x80084d06 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go index 6c741b0..549f26a 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go @@ -1,11 +1,11 @@ -// mkerrors.sh -Wall -Werror -static -I/tmp/include +// mkerrors.sh -Wall -Werror -static -I/tmp/mips64/include // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64 && linux // +build mips64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/mips64/include _const.go package unix @@ -131,6 +131,7 @@ const ( MEMGETREGIONCOUNT = 0x40044d07 MEMISLOCKED = 0x40084d17 MEMLOCK = 0x80084d05 + MEMREAD = 0xc0404d1a MEMREADOOB = 0xc0104d04 MEMSETBADBLOCK = 0x80084d0c MEMUNLOCK = 0x80084d06 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go index 807b8cd..e0365e3 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go @@ -1,11 +1,11 @@ -// mkerrors.sh -Wall -Werror -static -I/tmp/include +// mkerrors.sh -Wall -Werror -static -I/tmp/mips64le/include // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64le && linux // +build mips64le,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/mips64le/include _const.go package unix @@ -131,6 +131,7 @@ const ( MEMGETREGIONCOUNT = 0x40044d07 MEMISLOCKED = 0x40084d17 MEMLOCK = 0x80084d05 + MEMREAD = 0xc0404d1a MEMREADOOB = 0xc0104d04 MEMSETBADBLOCK = 0x80084d0c MEMUNLOCK = 0x80084d06 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go index a39e4f5..fdccce1 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go @@ -1,11 +1,11 @@ -// mkerrors.sh -Wall -Werror -static -I/tmp/include +// mkerrors.sh -Wall -Werror -static -I/tmp/mipsle/include // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mipsle && linux // +build mipsle,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/mipsle/include _const.go package unix @@ -131,6 +131,7 @@ const ( MEMGETREGIONCOUNT = 0x40044d07 MEMISLOCKED = 0x40084d17 MEMLOCK = 0x80084d05 + MEMREAD = 0xc0404d1a MEMREADOOB = 0xc00c4d04 MEMSETBADBLOCK = 0x80084d0c MEMUNLOCK = 0x80084d06 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go index c0fcda8..b2205c8 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go @@ -1,11 +1,11 @@ -// mkerrors.sh -Wall -Werror -static -I/tmp/include +// mkerrors.sh -Wall -Werror -static -I/tmp/ppc/include // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc && linux // +build ppc,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/ppc/include _const.go package unix @@ -131,6 +131,7 @@ const ( MEMGETREGIONCOUNT = 0x40044d07 MEMISLOCKED = 0x40084d17 MEMLOCK = 0x80084d05 + MEMREAD = 0xc0404d1a MEMREADOOB = 0xc00c4d04 MEMSETBADBLOCK = 0x80084d0c MEMUNLOCK = 0x80084d06 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go index f3b7240..81aa5ad 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go @@ -1,11 +1,11 @@ -// mkerrors.sh -Wall -Werror -static -I/tmp/include +// mkerrors.sh -Wall -Werror -static -I/tmp/ppc64/include // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64 && linux // +build ppc64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/ppc64/include _const.go package unix @@ -131,6 +131,7 @@ const ( MEMGETREGIONCOUNT = 0x40044d07 MEMISLOCKED = 0x40084d17 MEMLOCK = 0x80084d05 + MEMREAD = 0xc0404d1a MEMREADOOB = 0xc0104d04 MEMSETBADBLOCK = 0x80084d0c MEMUNLOCK = 0x80084d06 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go index 72f2a45..76807a1 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go @@ -1,11 +1,11 @@ -// mkerrors.sh -Wall -Werror -static -I/tmp/include +// mkerrors.sh -Wall -Werror -static -I/tmp/ppc64le/include // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64le && linux // +build ppc64le,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/ppc64le/include _const.go package unix @@ -131,6 +131,7 @@ const ( MEMGETREGIONCOUNT = 0x40044d07 MEMISLOCKED = 0x40084d17 MEMLOCK = 0x80084d05 + MEMREAD = 0xc0404d1a MEMREADOOB = 0xc0104d04 MEMSETBADBLOCK = 0x80084d0c MEMUNLOCK = 0x80084d06 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go index 45b214b..d4a5ab9 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go @@ -1,11 +1,11 @@ -// mkerrors.sh -Wall -Werror -static -I/tmp/include +// mkerrors.sh -Wall -Werror -static -I/tmp/riscv64/include // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && linux // +build riscv64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/riscv64/include _const.go package unix @@ -131,6 +131,7 @@ const ( MEMGETREGIONCOUNT = 0x80044d07 MEMISLOCKED = 0x80084d17 MEMLOCK = 0x40084d05 + MEMREAD = 0xc0404d1a MEMREADOOB = 0xc0104d04 MEMSETBADBLOCK = 0x40084d0c MEMUNLOCK = 0x40084d06 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go b/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go index 1897f20..66e65db 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go @@ -1,11 +1,11 @@ -// mkerrors.sh -Wall -Werror -static -I/tmp/include -fsigned-char +// mkerrors.sh -Wall -Werror -static -I/tmp/s390x/include -fsigned-char // Code generated by the command above; see README.md. DO NOT EDIT. //go:build s390x && linux // +build s390x,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include -fsigned-char _const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/s390x/include -fsigned-char _const.go package unix @@ -131,6 +131,7 @@ const ( MEMGETREGIONCOUNT = 0x80044d07 MEMISLOCKED = 0x80084d17 MEMLOCK = 0x40084d05 + MEMREAD = 0xc0404d1a MEMREADOOB = 0xc0104d04 MEMSETBADBLOCK = 0x40084d0c MEMUNLOCK = 0x40084d06 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go index 1fb7a39..4898420 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go @@ -1,11 +1,11 @@ -// mkerrors.sh -Wall -Werror -static -I/tmp/include +// mkerrors.sh -Wall -Werror -static -I/tmp/sparc64/include // Code generated by the command above; see README.md. DO NOT EDIT. //go:build sparc64 && linux // +build sparc64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/sparc64/include _const.go package unix @@ -136,6 +136,7 @@ const ( MEMGETREGIONCOUNT = 0x40044d07 MEMISLOCKED = 0x40084d17 MEMLOCK = 0x80084d05 + MEMREAD = 0xc0404d1a MEMREADOOB = 0xc0104d04 MEMSETBADBLOCK = 0x80084d0c MEMUNLOCK = 0x80084d06 @@ -328,6 +329,54 @@ const ( SCM_WIFI_STATUS = 0x25 SFD_CLOEXEC = 0x400000 SFD_NONBLOCK = 0x4000 + SF_FP = 0x38 + SF_I0 = 0x20 + SF_I1 = 0x24 + SF_I2 = 0x28 + SF_I3 = 0x2c + SF_I4 = 0x30 + SF_I5 = 0x34 + SF_L0 = 0x0 + SF_L1 = 0x4 + SF_L2 = 0x8 + SF_L3 = 0xc + SF_L4 = 0x10 + SF_L5 = 0x14 + SF_L6 = 0x18 + SF_L7 = 0x1c + SF_PC = 0x3c + SF_RETP = 0x40 + SF_V9_FP = 0x70 + SF_V9_I0 = 0x40 + SF_V9_I1 = 0x48 + SF_V9_I2 = 0x50 + SF_V9_I3 = 0x58 + SF_V9_I4 = 0x60 + SF_V9_I5 = 0x68 + SF_V9_L0 = 0x0 + SF_V9_L1 = 0x8 + SF_V9_L2 = 0x10 + SF_V9_L3 = 0x18 + SF_V9_L4 = 0x20 + SF_V9_L5 = 0x28 + SF_V9_L6 = 0x30 + SF_V9_L7 = 0x38 + SF_V9_PC = 0x78 + SF_V9_RETP = 0x80 + SF_V9_XARG0 = 0x88 + SF_V9_XARG1 = 0x90 + SF_V9_XARG2 = 0x98 + SF_V9_XARG3 = 0xa0 + SF_V9_XARG4 = 0xa8 + SF_V9_XARG5 = 0xb0 + SF_V9_XXARG = 0xb8 + SF_XARG0 = 0x44 + SF_XARG1 = 0x48 + SF_XARG2 = 0x4c + SF_XARG3 = 0x50 + SF_XARG4 = 0x54 + SF_XARG5 = 0x58 + SF_XXARG = 0x5c SIOCATMARK = 0x8905 SIOCGPGRP = 0x8904 SIOCGSTAMPNS_NEW = 0x40108907 diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_386.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_386.go index 6d56edc..af20e47 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_386.go @@ -46,6 +46,7 @@ const ( AF_SNA = 0xb AF_UNIX = 0x1 AF_UNSPEC = 0x0 + ALTWERASE = 0x200 ARPHRD_ETHER = 0x1 ARPHRD_FRELAY = 0xf ARPHRD_IEEE1394 = 0x18 @@ -108,6 +109,15 @@ const ( BPF_DIRECTION_IN = 0x1 BPF_DIRECTION_OUT = 0x2 BPF_DIV = 0x30 + BPF_FILDROP_CAPTURE = 0x1 + BPF_FILDROP_DROP = 0x2 + BPF_FILDROP_PASS = 0x0 + BPF_F_DIR_IN = 0x10 + BPF_F_DIR_MASK = 0x30 + BPF_F_DIR_OUT = 0x20 + BPF_F_DIR_SHIFT = 0x4 + BPF_F_FLOWID = 0x8 + BPF_F_PRI_MASK = 0x7 BPF_H = 0x8 BPF_IMM = 0x0 BPF_IND = 0x40 @@ -136,6 +146,7 @@ const ( BPF_OR = 0x40 BPF_RELEASE = 0x30bb6 BPF_RET = 0x6 + BPF_RND = 0xc0 BPF_RSH = 0x70 BPF_ST = 0x2 BPF_STX = 0x3 @@ -147,6 +158,12 @@ const ( BRKINT = 0x2 CFLUSH = 0xf CLOCAL = 0x8000 + CLOCK_BOOTTIME = 0x6 + CLOCK_MONOTONIC = 0x3 + CLOCK_PROCESS_CPUTIME_ID = 0x2 + CLOCK_REALTIME = 0x0 + CLOCK_THREAD_CPUTIME_ID = 0x4 + CLOCK_UPTIME = 0x5 CPUSTATES = 0x6 CP_IDLE = 0x5 CP_INTR = 0x4 @@ -170,7 +187,65 @@ const ( CTL_KERN = 0x1 CTL_MAXNAME = 0xc CTL_NET = 0x4 + DIOCADDQUEUE = 0xc100445d + DIOCADDRULE = 0xccc84404 + DIOCADDSTATE = 0xc1084425 + DIOCCHANGERULE = 0xccc8441a + DIOCCLRIFFLAG = 0xc024445a + DIOCCLRSRCNODES = 0x20004455 + DIOCCLRSTATES = 0xc0d04412 + DIOCCLRSTATUS = 0xc0244416 + DIOCGETLIMIT = 0xc0084427 + DIOCGETQSTATS = 0xc1084460 + DIOCGETQUEUE = 0xc100445f + DIOCGETQUEUES = 0xc100445e + DIOCGETRULE = 0xccc84407 + DIOCGETRULES = 0xccc84406 + DIOCGETRULESET = 0xc444443b + DIOCGETRULESETS = 0xc444443a + DIOCGETSRCNODES = 0xc0084454 + DIOCGETSTATE = 0xc1084413 + DIOCGETSTATES = 0xc0084419 + DIOCGETSTATUS = 0xc1e84415 + DIOCGETSYNFLWATS = 0xc0084463 + DIOCGETTIMEOUT = 0xc008441e + DIOCIGETIFACES = 0xc0244457 + DIOCKILLSRCNODES = 0xc068445b + DIOCKILLSTATES = 0xc0d04429 + DIOCNATLOOK = 0xc0504417 + DIOCOSFPADD = 0xc084444f DIOCOSFPFLUSH = 0x2000444e + DIOCOSFPGET = 0xc0844450 + DIOCRADDADDRS = 0xc44c4443 + DIOCRADDTABLES = 0xc44c443d + DIOCRCLRADDRS = 0xc44c4442 + DIOCRCLRASTATS = 0xc44c4448 + DIOCRCLRTABLES = 0xc44c443c + DIOCRCLRTSTATS = 0xc44c4441 + DIOCRDELADDRS = 0xc44c4444 + DIOCRDELTABLES = 0xc44c443e + DIOCRGETADDRS = 0xc44c4446 + DIOCRGETASTATS = 0xc44c4447 + DIOCRGETTABLES = 0xc44c443f + DIOCRGETTSTATS = 0xc44c4440 + DIOCRINADEFINE = 0xc44c444d + DIOCRSETADDRS = 0xc44c4445 + DIOCRSETTFLAGS = 0xc44c444a + DIOCRTSTADDRS = 0xc44c4449 + DIOCSETDEBUG = 0xc0044418 + DIOCSETHOSTID = 0xc0044456 + DIOCSETIFFLAG = 0xc0244459 + DIOCSETLIMIT = 0xc0084428 + DIOCSETREASS = 0xc004445c + DIOCSETSTATUSIF = 0xc0244414 + DIOCSETSYNCOOKIES = 0xc0014462 + DIOCSETSYNFLWATS = 0xc0084461 + DIOCSETTIMEOUT = 0xc008441d + DIOCSTART = 0x20004401 + DIOCSTOP = 0x20004402 + DIOCXBEGIN = 0xc00c4451 + DIOCXCOMMIT = 0xc00c4452 + DIOCXROLLBACK = 0xc00c4453 DLT_ARCNET = 0x7 DLT_ATM_RFC1483 = 0xb DLT_AX25 = 0x3 @@ -186,6 +261,7 @@ const ( DLT_LOOP = 0xc DLT_MPLS = 0xdb DLT_NULL = 0x0 + DLT_OPENFLOW = 0x10b DLT_PFLOG = 0x75 DLT_PFSYNC = 0x12 DLT_PPP = 0x9 @@ -196,6 +272,23 @@ const ( DLT_RAW = 0xe DLT_SLIP = 0x8 DLT_SLIP_BSDOS = 0xf + DLT_USBPCAP = 0xf9 + DLT_USER0 = 0x93 + DLT_USER1 = 0x94 + DLT_USER10 = 0x9d + DLT_USER11 = 0x9e + DLT_USER12 = 0x9f + DLT_USER13 = 0xa0 + DLT_USER14 = 0xa1 + DLT_USER15 = 0xa2 + DLT_USER2 = 0x95 + DLT_USER3 = 0x96 + DLT_USER4 = 0x97 + DLT_USER5 = 0x98 + DLT_USER6 = 0x99 + DLT_USER7 = 0x9a + DLT_USER8 = 0x9b + DLT_USER9 = 0x9c DT_BLK = 0x6 DT_CHR = 0x2 DT_DIR = 0x4 @@ -215,6 +308,8 @@ const ( EMUL_ENABLED = 0x1 EMUL_NATIVE = 0x2 ENDRUNDISC = 0x9 + ETH64_8021_RSVD_MASK = 0xfffffffffff0 + ETH64_8021_RSVD_PREFIX = 0x180c2000000 ETHERMIN = 0x2e ETHERMTU = 0x5dc ETHERTYPE_8023 = 0x4 @@ -267,6 +362,7 @@ const ( ETHERTYPE_DN = 0x6003 ETHERTYPE_DOGFIGHT = 0x1989 ETHERTYPE_DSMD = 0x8039 + ETHERTYPE_EAPOL = 0x888e ETHERTYPE_ECMA = 0x803 ETHERTYPE_ENCRYPT = 0x803d ETHERTYPE_ES = 0x805d @@ -298,6 +394,7 @@ const ( ETHERTYPE_LLDP = 0x88cc ETHERTYPE_LOGICRAFT = 0x8148 ETHERTYPE_LOOPBACK = 0x9000 + ETHERTYPE_MACSEC = 0x88e5 ETHERTYPE_MATRA = 0x807a ETHERTYPE_MAX = 0xffff ETHERTYPE_MERIT = 0x807c @@ -326,15 +423,17 @@ const ( ETHERTYPE_NCD = 0x8149 ETHERTYPE_NESTAR = 0x8006 ETHERTYPE_NETBEUI = 0x8191 + ETHERTYPE_NHRP = 0x2001 ETHERTYPE_NOVELL = 0x8138 ETHERTYPE_NS = 0x600 ETHERTYPE_NSAT = 0x601 ETHERTYPE_NSCOMPAT = 0x807 + ETHERTYPE_NSH = 0x984f ETHERTYPE_NTRAILER = 0x10 ETHERTYPE_OS9 = 0x7007 ETHERTYPE_OS9NET = 0x7009 ETHERTYPE_PACER = 0x80c6 - ETHERTYPE_PAE = 0x888e + ETHERTYPE_PBB = 0x88e7 ETHERTYPE_PCS = 0x4242 ETHERTYPE_PLANNING = 0x8044 ETHERTYPE_PPP = 0x880b @@ -409,28 +508,40 @@ const ( ETHER_CRC_POLY_LE = 0xedb88320 ETHER_HDR_LEN = 0xe ETHER_MAX_DIX_LEN = 0x600 + ETHER_MAX_HARDMTU_LEN = 0xff9b ETHER_MAX_LEN = 0x5ee ETHER_MIN_LEN = 0x40 ETHER_TYPE_LEN = 0x2 ETHER_VLAN_ENCAP_LEN = 0x4 EVFILT_AIO = -0x3 + EVFILT_DEVICE = -0x8 + EVFILT_EXCEPT = -0x9 EVFILT_PROC = -0x5 EVFILT_READ = -0x1 EVFILT_SIGNAL = -0x6 - EVFILT_SYSCOUNT = 0x7 + EVFILT_SYSCOUNT = 0x9 EVFILT_TIMER = -0x7 EVFILT_VNODE = -0x4 EVFILT_WRITE = -0x2 + EVL_ENCAPLEN = 0x4 + EVL_PRIO_BITS = 0xd + EVL_PRIO_MAX = 0x7 + EVL_VLID_MASK = 0xfff + EVL_VLID_MAX = 0xffe + EVL_VLID_MIN = 0x1 + EVL_VLID_NULL = 0x0 EV_ADD = 0x1 EV_CLEAR = 0x20 EV_DELETE = 0x2 EV_DISABLE = 0x8 + EV_DISPATCH = 0x80 EV_ENABLE = 0x4 EV_EOF = 0x8000 EV_ERROR = 0x4000 EV_FLAG1 = 0x2000 EV_ONESHOT = 0x10 - EV_SYSFLAGS = 0xf000 + EV_RECEIPT = 0x40 + EV_SYSFLAGS = 0xf800 EXTA = 0x4b00 EXTB = 0x9600 EXTPROC = 0x800 @@ -443,6 +554,7 @@ const ( F_GETFL = 0x3 F_GETLK = 0x7 F_GETOWN = 0x5 + F_ISATTY = 0xb F_OK = 0x0 F_RDLCK = 0x1 F_SETFD = 0x2 @@ -460,7 +572,6 @@ const ( IEXTEN = 0x400 IFAN_ARRIVAL = 0x0 IFAN_DEPARTURE = 0x1 - IFA_ROUTE = 0x1 IFF_ALLMULTI = 0x200 IFF_BROADCAST = 0x2 IFF_CANTCHANGE = 0x8e52 @@ -471,12 +582,12 @@ const ( IFF_LOOPBACK = 0x8 IFF_MULTICAST = 0x8000 IFF_NOARP = 0x80 - IFF_NOTRAILERS = 0x20 IFF_OACTIVE = 0x400 IFF_POINTOPOINT = 0x10 IFF_PROMISC = 0x100 IFF_RUNNING = 0x40 IFF_SIMPLEX = 0x800 + IFF_STATICARP = 0x20 IFF_UP = 0x1 IFNAMSIZ = 0x10 IFT_1822 = 0x2 @@ -605,6 +716,7 @@ const ( IFT_LINEGROUP = 0xd2 IFT_LOCALTALK = 0x2a IFT_LOOP = 0x18 + IFT_MBIM = 0xfa IFT_MEDIAMAILOVERIP = 0x8b IFT_MFSIGLINK = 0xa7 IFT_MIOX25 = 0x26 @@ -695,6 +807,7 @@ const ( IFT_VOICEOVERCABLE = 0xc6 IFT_VOICEOVERFRAMERELAY = 0x99 IFT_VOICEOVERIP = 0x68 + IFT_WIREGUARD = 0xfb IFT_X213 = 0x5d IFT_X25 = 0x5 IFT_X25DDN = 0x4 @@ -729,8 +842,6 @@ const ( IPPROTO_AH = 0x33 IPPROTO_CARP = 0x70 IPPROTO_DIVERT = 0x102 - IPPROTO_DIVERT_INIT = 0x2 - IPPROTO_DIVERT_RESP = 0x1 IPPROTO_DONE = 0x101 IPPROTO_DSTOPTS = 0x3c IPPROTO_EGP = 0x8 @@ -762,9 +873,11 @@ const ( IPPROTO_RAW = 0xff IPPROTO_ROUTING = 0x2b IPPROTO_RSVP = 0x2e + IPPROTO_SCTP = 0x84 IPPROTO_TCP = 0x6 IPPROTO_TP = 0x1d IPPROTO_UDP = 0x11 + IPPROTO_UDPLITE = 0x88 IPV6_AUTH_LEVEL = 0x35 IPV6_AUTOFLOWLABEL = 0x3b IPV6_CHECKSUM = 0x1a @@ -787,6 +900,7 @@ const ( IPV6_LEAVE_GROUP = 0xd IPV6_MAXHLIM = 0xff IPV6_MAXPACKET = 0xffff + IPV6_MINHOPCOUNT = 0x41 IPV6_MMTU = 0x500 IPV6_MULTICAST_HOPS = 0xa IPV6_MULTICAST_IF = 0x9 @@ -826,12 +940,12 @@ const ( IP_DEFAULT_MULTICAST_LOOP = 0x1 IP_DEFAULT_MULTICAST_TTL = 0x1 IP_DF = 0x4000 - IP_DIVERTFL = 0x1022 IP_DROP_MEMBERSHIP = 0xd IP_ESP_NETWORK_LEVEL = 0x16 IP_ESP_TRANS_LEVEL = 0x15 IP_HDRINCL = 0x2 IP_IPCOMP_LEVEL = 0x1d + IP_IPDEFTTL = 0x25 IP_IPSECFLOWINFO = 0x24 IP_IPSEC_LOCAL_AUTH = 0x1b IP_IPSEC_LOCAL_CRED = 0x19 @@ -865,10 +979,15 @@ const ( IP_RETOPTS = 0x8 IP_RF = 0x8000 IP_RTABLE = 0x1021 + IP_SENDSRCADDR = 0x7 IP_TOS = 0x3 IP_TTL = 0x4 ISIG = 0x80 ISTRIP = 0x20 + ITIMER_PROF = 0x2 + ITIMER_REAL = 0x0 + ITIMER_VIRTUAL = 0x1 + IUCLC = 0x1000 IXANY = 0x800 IXOFF = 0x400 IXON = 0x200 @@ -900,10 +1019,11 @@ const ( MAP_INHERIT_COPY = 0x1 MAP_INHERIT_NONE = 0x2 MAP_INHERIT_SHARE = 0x0 - MAP_NOEXTEND = 0x100 - MAP_NORESERVE = 0x40 + MAP_INHERIT_ZERO = 0x3 + MAP_NOEXTEND = 0x0 + MAP_NORESERVE = 0x0 MAP_PRIVATE = 0x2 - MAP_RENAME = 0x20 + MAP_RENAME = 0x0 MAP_SHARED = 0x1 MAP_STACK = 0x4000 MAP_TRYFIXED = 0x0 @@ -922,6 +1042,7 @@ const ( MNT_NOATIME = 0x8000 MNT_NODEV = 0x10 MNT_NOEXEC = 0x4 + MNT_NOPERM = 0x20 MNT_NOSUID = 0x8 MNT_NOWAIT = 0x2 MNT_QUOTA = 0x2000 @@ -929,13 +1050,29 @@ const ( MNT_RELOAD = 0x40000 MNT_ROOTFS = 0x4000 MNT_SOFTDEP = 0x4000000 + MNT_STALLED = 0x100000 + MNT_SWAPPABLE = 0x200000 MNT_SYNCHRONOUS = 0x2 MNT_UPDATE = 0x10000 MNT_VISFLAGMASK = 0x400ffff MNT_WAIT = 0x1 MNT_WANTRDWR = 0x2000000 MNT_WXALLOWED = 0x800 + MOUNT_AFS = "afs" + MOUNT_CD9660 = "cd9660" + MOUNT_EXT2FS = "ext2fs" + MOUNT_FFS = "ffs" + MOUNT_FUSEFS = "fuse" + MOUNT_MFS = "mfs" + MOUNT_MSDOS = "msdos" + MOUNT_NCPFS = "ncpfs" + MOUNT_NFS = "nfs" + MOUNT_NTFS = "ntfs" + MOUNT_TMPFS = "tmpfs" + MOUNT_UDF = "udf" + MOUNT_UFS = "ffs" MSG_BCAST = 0x100 + MSG_CMSG_CLOEXEC = 0x800 MSG_CTRUNC = 0x20 MSG_DONTROUTE = 0x4 MSG_DONTWAIT = 0x80 @@ -946,6 +1083,7 @@ const ( MSG_PEEK = 0x2 MSG_TRUNC = 0x10 MSG_WAITALL = 0x40 + MSG_WAITFORONE = 0x1000 MS_ASYNC = 0x1 MS_INVALIDATE = 0x4 MS_SYNC = 0x2 @@ -953,12 +1091,16 @@ const ( NET_RT_DUMP = 0x1 NET_RT_FLAGS = 0x2 NET_RT_IFLIST = 0x3 - NET_RT_MAXID = 0x6 + NET_RT_IFNAMES = 0x6 + NET_RT_MAXID = 0x8 + NET_RT_SOURCE = 0x7 NET_RT_STATS = 0x4 NET_RT_TABLE = 0x5 NFDBITS = 0x20 NOFLSH = 0x80000000 + NOKERNINFO = 0x2000000 NOTE_ATTRIB = 0x8 + NOTE_CHANGE = 0x1 NOTE_CHILD = 0x4 NOTE_DELETE = 0x1 NOTE_EOF = 0x2 @@ -968,6 +1110,7 @@ const ( NOTE_FORK = 0x40000000 NOTE_LINK = 0x10 NOTE_LOWAT = 0x1 + NOTE_OOB = 0x4 NOTE_PCTRLMASK = 0xf0000000 NOTE_PDATAMASK = 0xfffff NOTE_RENAME = 0x20 @@ -977,11 +1120,13 @@ const ( NOTE_TRUNCATE = 0x80 NOTE_WRITE = 0x2 OCRNL = 0x10 + OLCUC = 0x20 ONLCR = 0x2 ONLRET = 0x80 ONOCR = 0x40 ONOEOT = 0x8 OPOST = 0x1 + OXTABS = 0x4 O_ACCMODE = 0x3 O_APPEND = 0x8 O_ASYNC = 0x40 @@ -1015,7 +1160,6 @@ const ( PROT_NONE = 0x0 PROT_READ = 0x1 PROT_WRITE = 0x2 - PT_MASK = 0x3ff000 RLIMIT_CORE = 0x4 RLIMIT_CPU = 0x0 RLIMIT_DATA = 0x2 @@ -1027,19 +1171,25 @@ const ( RLIMIT_STACK = 0x3 RLIM_INFINITY = 0x7fffffffffffffff RTAX_AUTHOR = 0x6 + RTAX_BFD = 0xb RTAX_BRD = 0x7 + RTAX_DNS = 0xc RTAX_DST = 0x0 RTAX_GATEWAY = 0x1 RTAX_GENMASK = 0x3 RTAX_IFA = 0x5 RTAX_IFP = 0x4 RTAX_LABEL = 0xa - RTAX_MAX = 0xb + RTAX_MAX = 0xf RTAX_NETMASK = 0x2 + RTAX_SEARCH = 0xe RTAX_SRC = 0x8 RTAX_SRCMASK = 0x9 + RTAX_STATIC = 0xd RTA_AUTHOR = 0x40 + RTA_BFD = 0x800 RTA_BRD = 0x80 + RTA_DNS = 0x1000 RTA_DST = 0x1 RTA_GATEWAY = 0x2 RTA_GENMASK = 0x8 @@ -1047,49 +1197,57 @@ const ( RTA_IFP = 0x10 RTA_LABEL = 0x400 RTA_NETMASK = 0x4 + RTA_SEARCH = 0x4000 RTA_SRC = 0x100 RTA_SRCMASK = 0x200 + RTA_STATIC = 0x2000 RTF_ANNOUNCE = 0x4000 + RTF_BFD = 0x1000000 RTF_BLACKHOLE = 0x1000 + RTF_BROADCAST = 0x400000 + RTF_CACHED = 0x20000 RTF_CLONED = 0x10000 RTF_CLONING = 0x100 + RTF_CONNECTED = 0x800000 RTF_DONE = 0x40 RTF_DYNAMIC = 0x10 - RTF_FMASK = 0x10f808 + RTF_FMASK = 0x110fc08 RTF_GATEWAY = 0x2 RTF_HOST = 0x4 RTF_LLINFO = 0x400 - RTF_MASK = 0x80 + RTF_LOCAL = 0x200000 RTF_MODIFIED = 0x20 RTF_MPATH = 0x40000 RTF_MPLS = 0x100000 + RTF_MULTICAST = 0x200 RTF_PERMANENT_ARP = 0x2000 RTF_PROTO1 = 0x8000 RTF_PROTO2 = 0x4000 RTF_PROTO3 = 0x2000 RTF_REJECT = 0x8 - RTF_SOURCE = 0x20000 RTF_STATIC = 0x800 - RTF_TUNNEL = 0x100000 RTF_UP = 0x1 RTF_USETRAILERS = 0x8000 - RTF_XRESOLVE = 0x200 + RTM_80211INFO = 0x15 RTM_ADD = 0x1 + RTM_BFD = 0x12 RTM_CHANGE = 0x3 + RTM_CHGADDRATTR = 0x14 RTM_DELADDR = 0xd RTM_DELETE = 0x2 RTM_DESYNC = 0x10 RTM_GET = 0x4 RTM_IFANNOUNCE = 0xf RTM_IFINFO = 0xe - RTM_LOCK = 0x8 + RTM_INVALIDATE = 0x11 RTM_LOSING = 0x5 RTM_MAXSIZE = 0x800 RTM_MISS = 0x7 RTM_NEWADDR = 0xc + RTM_PROPOSAL = 0x13 RTM_REDIRECT = 0x6 RTM_RESOLVE = 0xb - RTM_RTTUNIT = 0xf4240 + RTM_SOURCE = 0x16 RTM_VERSION = 0x5 RTV_EXPIRE = 0x4 RTV_HOPCOUNT = 0x2 @@ -1099,67 +1257,74 @@ const ( RTV_RTTVAR = 0x80 RTV_SPIPE = 0x10 RTV_SSTHRESH = 0x20 + RT_TABLEID_BITS = 0x8 + RT_TABLEID_MASK = 0xff RT_TABLEID_MAX = 0xff RUSAGE_CHILDREN = -0x1 RUSAGE_SELF = 0x0 RUSAGE_THREAD = 0x1 SCM_RIGHTS = 0x1 SCM_TIMESTAMP = 0x4 + SEEK_CUR = 0x1 + SEEK_END = 0x2 + SEEK_SET = 0x0 SHUT_RD = 0x0 SHUT_RDWR = 0x2 SHUT_WR = 0x1 SIOCADDMULTI = 0x80206931 SIOCAIFADDR = 0x8040691a SIOCAIFGROUP = 0x80246987 - SIOCALIFADDR = 0x8218691c SIOCATMARK = 0x40047307 - SIOCBRDGADD = 0x8054693c - SIOCBRDGADDS = 0x80546941 - SIOCBRDGARL = 0x806e694d + SIOCBRDGADD = 0x805c693c + SIOCBRDGADDL = 0x805c6949 + SIOCBRDGADDS = 0x805c6941 + SIOCBRDGARL = 0x808c694d SIOCBRDGDADDR = 0x81286947 - SIOCBRDGDEL = 0x8054693d - SIOCBRDGDELS = 0x80546942 - SIOCBRDGFLUSH = 0x80546948 - SIOCBRDGFRL = 0x806e694e + SIOCBRDGDEL = 0x805c693d + SIOCBRDGDELS = 0x805c6942 + SIOCBRDGFLUSH = 0x805c6948 + SIOCBRDGFRL = 0x808c694e SIOCBRDGGCACHE = 0xc0146941 SIOCBRDGGFD = 0xc0146952 SIOCBRDGGHT = 0xc0146951 - SIOCBRDGGIFFLGS = 0xc054693e + SIOCBRDGGIFFLGS = 0xc05c693e SIOCBRDGGMA = 0xc0146953 SIOCBRDGGPARAM = 0xc03c6958 SIOCBRDGGPRI = 0xc0146950 SIOCBRDGGRL = 0xc028694f - SIOCBRDGGSIFS = 0xc054693c SIOCBRDGGTO = 0xc0146946 - SIOCBRDGIFS = 0xc0546942 + SIOCBRDGIFS = 0xc05c6942 SIOCBRDGRTS = 0xc0186943 SIOCBRDGSADDR = 0xc1286944 SIOCBRDGSCACHE = 0x80146940 SIOCBRDGSFD = 0x80146952 SIOCBRDGSHT = 0x80146951 - SIOCBRDGSIFCOST = 0x80546955 - SIOCBRDGSIFFLGS = 0x8054693f - SIOCBRDGSIFPRIO = 0x80546954 + SIOCBRDGSIFCOST = 0x805c6955 + SIOCBRDGSIFFLGS = 0x805c693f + SIOCBRDGSIFPRIO = 0x805c6954 + SIOCBRDGSIFPROT = 0x805c694a SIOCBRDGSMA = 0x80146953 SIOCBRDGSPRI = 0x80146950 SIOCBRDGSPROTO = 0x8014695a SIOCBRDGSTO = 0x80146945 SIOCBRDGSTXHC = 0x80146959 + SIOCDELLABEL = 0x80206997 SIOCDELMULTI = 0x80206932 SIOCDIFADDR = 0x80206919 SIOCDIFGROUP = 0x80246989 + SIOCDIFPARENT = 0x802069b4 SIOCDIFPHYADDR = 0x80206949 - SIOCDLIFADDR = 0x8218691e + SIOCDPWE3NEIGHBOR = 0x802069de + SIOCDVNETID = 0x802069af SIOCGETKALIVE = 0xc01869a4 SIOCGETLABEL = 0x8020699a + SIOCGETMPWCFG = 0xc02069ae SIOCGETPFLOW = 0xc02069fe SIOCGETPFSYNC = 0xc02069f8 SIOCGETSGCNT = 0xc0147534 SIOCGETVIFCNT = 0xc0147533 SIOCGETVLAN = 0xc0206990 - SIOCGHIWAT = 0x40047301 SIOCGIFADDR = 0xc0206921 - SIOCGIFASYNCMAP = 0xc020697c SIOCGIFBRDADDR = 0xc0206923 SIOCGIFCONF = 0xc0086924 SIOCGIFDATA = 0xc020691b @@ -1168,40 +1333,53 @@ const ( SIOCGIFFLAGS = 0xc0206911 SIOCGIFGATTR = 0xc024698b SIOCGIFGENERIC = 0xc020693a + SIOCGIFGLIST = 0xc024698d SIOCGIFGMEMB = 0xc024698a SIOCGIFGROUP = 0xc0246988 SIOCGIFHARDMTU = 0xc02069a5 - SIOCGIFMEDIA = 0xc0286936 + SIOCGIFLLPRIO = 0xc02069b6 + SIOCGIFMEDIA = 0xc0386938 SIOCGIFMETRIC = 0xc0206917 SIOCGIFMTU = 0xc020697e SIOCGIFNETMASK = 0xc0206925 - SIOCGIFPDSTADDR = 0xc0206948 + SIOCGIFPAIR = 0xc02069b1 + SIOCGIFPARENT = 0xc02069b3 SIOCGIFPRIORITY = 0xc020699c - SIOCGIFPSRCADDR = 0xc0206947 SIOCGIFRDOMAIN = 0xc02069a0 SIOCGIFRTLABEL = 0xc0206983 - SIOCGIFTIMESLOT = 0xc0206986 + SIOCGIFRXR = 0x802069aa + SIOCGIFSFFPAGE = 0xc1126939 SIOCGIFXFLAGS = 0xc020699e - SIOCGLIFADDR = 0xc218691d SIOCGLIFPHYADDR = 0xc218694b + SIOCGLIFPHYDF = 0xc02069c2 + SIOCGLIFPHYECN = 0xc02069c8 SIOCGLIFPHYRTABLE = 0xc02069a2 SIOCGLIFPHYTTL = 0xc02069a9 - SIOCGLOWAT = 0x40047303 SIOCGPGRP = 0x40047309 + SIOCGPWE3 = 0xc0206998 + SIOCGPWE3CTRLWORD = 0xc02069dc + SIOCGPWE3FAT = 0xc02069dd + SIOCGPWE3NEIGHBOR = 0xc21869de + SIOCGRXHPRIO = 0xc02069db SIOCGSPPPPARAMS = 0xc0206994 + SIOCGTXHPRIO = 0xc02069c6 + SIOCGUMBINFO = 0xc02069be + SIOCGUMBPARAM = 0xc02069c0 SIOCGVH = 0xc02069f6 + SIOCGVNETFLOWID = 0xc02069c4 SIOCGVNETID = 0xc02069a7 + SIOCIFAFATTACH = 0x801169ab + SIOCIFAFDETACH = 0x801169ac SIOCIFCREATE = 0x8020697a SIOCIFDESTROY = 0x80206979 SIOCIFGCLONERS = 0xc00c6978 SIOCSETKALIVE = 0x801869a3 SIOCSETLABEL = 0x80206999 + SIOCSETMPWCFG = 0x802069ad SIOCSETPFLOW = 0x802069fd SIOCSETPFSYNC = 0x802069f7 SIOCSETVLAN = 0x8020698f - SIOCSHIWAT = 0x80047300 SIOCSIFADDR = 0x8020690c - SIOCSIFASYNCMAP = 0x8020697d SIOCSIFBRDADDR = 0x80206913 SIOCSIFDESCR = 0x80206980 SIOCSIFDSTADDR = 0x8020690e @@ -1209,25 +1387,37 @@ const ( SIOCSIFGATTR = 0x8024698c SIOCSIFGENERIC = 0x80206939 SIOCSIFLLADDR = 0x8020691f - SIOCSIFMEDIA = 0xc0206935 + SIOCSIFLLPRIO = 0x802069b5 + SIOCSIFMEDIA = 0xc0206937 SIOCSIFMETRIC = 0x80206918 SIOCSIFMTU = 0x8020697f SIOCSIFNETMASK = 0x80206916 - SIOCSIFPHYADDR = 0x80406946 + SIOCSIFPAIR = 0x802069b0 + SIOCSIFPARENT = 0x802069b2 SIOCSIFPRIORITY = 0x8020699b SIOCSIFRDOMAIN = 0x8020699f SIOCSIFRTLABEL = 0x80206982 - SIOCSIFTIMESLOT = 0x80206985 SIOCSIFXFLAGS = 0x8020699d SIOCSLIFPHYADDR = 0x8218694a + SIOCSLIFPHYDF = 0x802069c1 + SIOCSLIFPHYECN = 0x802069c7 SIOCSLIFPHYRTABLE = 0x802069a1 SIOCSLIFPHYTTL = 0x802069a8 - SIOCSLOWAT = 0x80047302 SIOCSPGRP = 0x80047308 + SIOCSPWE3CTRLWORD = 0x802069dc + SIOCSPWE3FAT = 0x802069dd + SIOCSPWE3NEIGHBOR = 0x821869de + SIOCSRXHPRIO = 0x802069db SIOCSSPPPPARAMS = 0x80206993 + SIOCSTXHPRIO = 0x802069c5 + SIOCSUMBPARAM = 0x802069bf SIOCSVH = 0xc02069f5 + SIOCSVNETFLOWID = 0x802069c3 SIOCSVNETID = 0x802069a6 + SOCK_CLOEXEC = 0x8000 SOCK_DGRAM = 0x2 + SOCK_DNS = 0x1000 + SOCK_NONBLOCK = 0x4000 SOCK_RAW = 0x3 SOCK_RDM = 0x4 SOCK_SEQPACKET = 0x5 @@ -1238,6 +1428,7 @@ const ( SO_BINDANY = 0x1000 SO_BROADCAST = 0x20 SO_DEBUG = 0x1 + SO_DOMAIN = 0x1024 SO_DONTROUTE = 0x10 SO_ERROR = 0x1007 SO_KEEPALIVE = 0x8 @@ -1245,6 +1436,7 @@ const ( SO_NETPROC = 0x1020 SO_OOBINLINE = 0x100 SO_PEERCRED = 0x1022 + SO_PROTOCOL = 0x1025 SO_RCVBUF = 0x1002 SO_RCVLOWAT = 0x1004 SO_RCVTIMEO = 0x1006 @@ -1258,6 +1450,7 @@ const ( SO_TIMESTAMP = 0x800 SO_TYPE = 0x1008 SO_USELOOPBACK = 0x40 + SO_ZEROIZE = 0x2000 S_BLKSIZE = 0x200 S_IEXEC = 0x40 S_IFBLK = 0x6000 @@ -1287,9 +1480,24 @@ const ( S_IXOTH = 0x1 S_IXUSR = 0x40 TCIFLUSH = 0x1 + TCIOFF = 0x3 TCIOFLUSH = 0x3 + TCION = 0x4 TCOFLUSH = 0x2 - TCP_MAXBURST = 0x4 + TCOOFF = 0x1 + TCOON = 0x2 + TCPOPT_EOL = 0x0 + TCPOPT_MAXSEG = 0x2 + TCPOPT_NOP = 0x1 + TCPOPT_SACK = 0x5 + TCPOPT_SACK_HDR = 0x1010500 + TCPOPT_SACK_PERMITTED = 0x4 + TCPOPT_SACK_PERMIT_HDR = 0x1010402 + TCPOPT_SIGNATURE = 0x13 + TCPOPT_TIMESTAMP = 0x8 + TCPOPT_TSTAMP_HDR = 0x101080a + TCPOPT_WINDOW = 0x3 + TCP_INFO = 0x9 TCP_MAXSEG = 0x2 TCP_MAXWIN = 0xffff TCP_MAX_SACK = 0x3 @@ -1298,11 +1506,15 @@ const ( TCP_MSS = 0x200 TCP_NODELAY = 0x1 TCP_NOPUSH = 0x10 - TCP_NSTATES = 0xb + TCP_SACKHOLE_LIMIT = 0x80 TCP_SACK_ENABLE = 0x8 TCSAFLUSH = 0x2 + TIMER_ABSTIME = 0x1 + TIMER_RELTIME = 0x0 TIOCCBRK = 0x2000747a TIOCCDTR = 0x20007478 + TIOCCHKVERAUTH = 0x2000741e + TIOCCLRVERAUTH = 0x2000741d TIOCCONS = 0x80047462 TIOCDRAIN = 0x2000745e TIOCEXCL = 0x2000740d @@ -1357,17 +1569,21 @@ const ( TIOCSETAF = 0x802c7416 TIOCSETAW = 0x802c7415 TIOCSETD = 0x8004741b + TIOCSETVERAUTH = 0x8004741c TIOCSFLAGS = 0x8004745c TIOCSIG = 0x8004745f TIOCSPGRP = 0x80047476 TIOCSTART = 0x2000746e - TIOCSTAT = 0x80047465 - TIOCSTI = 0x80017472 + TIOCSTAT = 0x20007465 TIOCSTOP = 0x2000746f TIOCSTSTAMP = 0x8008745a TIOCSWINSZ = 0x80087467 TIOCUCNTL = 0x80047466 + TIOCUCNTL_CBRK = 0x7a + TIOCUCNTL_SBRK = 0x7b TOSTOP = 0x400000 + UTIME_NOW = -0x2 + UTIME_OMIT = -0x1 VDISCARD = 0xf VDSUSP = 0xb VEOF = 0x0 @@ -1378,6 +1594,19 @@ const ( VKILL = 0x5 VLNEXT = 0xe VMIN = 0x10 + VM_ANONMIN = 0x7 + VM_LOADAVG = 0x2 + VM_MALLOC_CONF = 0xc + VM_MAXID = 0xd + VM_MAXSLP = 0xa + VM_METER = 0x1 + VM_NKMEMPAGES = 0x6 + VM_PSSTRINGS = 0x3 + VM_SWAPENCRYPT = 0x5 + VM_USPACE = 0xb + VM_UVMEXP = 0x4 + VM_VNODEMIN = 0x9 + VM_VTEXTMIN = 0x8 VQUIT = 0x9 VREPRINT = 0x6 VSTART = 0xc @@ -1390,8 +1619,8 @@ const ( WCONTINUED = 0x8 WCOREFLAG = 0x80 WNOHANG = 0x1 - WSTOPPED = 0x7f WUNTRACED = 0x2 + XCASE = 0x1000000 ) // Errors @@ -1405,6 +1634,7 @@ const ( EALREADY = syscall.Errno(0x25) EAUTH = syscall.Errno(0x50) EBADF = syscall.Errno(0x9) + EBADMSG = syscall.Errno(0x5c) EBADRPC = syscall.Errno(0x48) EBUSY = syscall.Errno(0x10) ECANCELED = syscall.Errno(0x58) @@ -1431,7 +1661,7 @@ const ( EIPSEC = syscall.Errno(0x52) EISCONN = syscall.Errno(0x38) EISDIR = syscall.Errno(0x15) - ELAST = syscall.Errno(0x5b) + ELAST = syscall.Errno(0x5f) ELOOP = syscall.Errno(0x3e) EMEDIUMTYPE = syscall.Errno(0x56) EMFILE = syscall.Errno(0x18) @@ -1459,12 +1689,14 @@ const ( ENOTCONN = syscall.Errno(0x39) ENOTDIR = syscall.Errno(0x14) ENOTEMPTY = syscall.Errno(0x42) + ENOTRECOVERABLE = syscall.Errno(0x5d) ENOTSOCK = syscall.Errno(0x26) ENOTSUP = syscall.Errno(0x5b) ENOTTY = syscall.Errno(0x19) ENXIO = syscall.Errno(0x6) EOPNOTSUPP = syscall.Errno(0x2d) EOVERFLOW = syscall.Errno(0x57) + EOWNERDEAD = syscall.Errno(0x5e) EPERM = syscall.Errno(0x1) EPFNOSUPPORT = syscall.Errno(0x2e) EPIPE = syscall.Errno(0x20) @@ -1472,6 +1704,7 @@ const ( EPROCUNAVAIL = syscall.Errno(0x4c) EPROGMISMATCH = syscall.Errno(0x4b) EPROGUNAVAIL = syscall.Errno(0x4a) + EPROTO = syscall.Errno(0x5f) EPROTONOSUPPORT = syscall.Errno(0x2b) EPROTOTYPE = syscall.Errno(0x29) ERANGE = syscall.Errno(0x22) @@ -1568,7 +1801,7 @@ var errorList = [...]struct { {32, "EPIPE", "broken pipe"}, {33, "EDOM", "numerical argument out of domain"}, {34, "ERANGE", "result too large"}, - {35, "EWOULDBLOCK", "resource temporarily unavailable"}, + {35, "EAGAIN", "resource temporarily unavailable"}, {36, "EINPROGRESS", "operation now in progress"}, {37, "EALREADY", "operation already in progress"}, {38, "ENOTSOCK", "socket operation on non-socket"}, @@ -1624,7 +1857,11 @@ var errorList = [...]struct { {88, "ECANCELED", "operation canceled"}, {89, "EIDRM", "identifier removed"}, {90, "ENOMSG", "no message of desired type"}, - {91, "ELAST", "not supported"}, + {91, "ENOTSUP", "not supported"}, + {92, "EBADMSG", "bad message"}, + {93, "ENOTRECOVERABLE", "state not recoverable"}, + {94, "EOWNERDEAD", "previous owner died"}, + {95, "ELAST", "protocol error"}, } // Signal table @@ -1638,7 +1875,7 @@ var signalList = [...]struct { {3, "SIGQUIT", "quit"}, {4, "SIGILL", "illegal instruction"}, {5, "SIGTRAP", "trace/BPT trap"}, - {6, "SIGABRT", "abort trap"}, + {6, "SIGIOT", "abort trap"}, {7, "SIGEMT", "EMT trap"}, {8, "SIGFPE", "floating point exception"}, {9, "SIGKILL", "killed"}, @@ -1665,4 +1902,5 @@ var signalList = [...]struct { {30, "SIGUSR1", "user defined signal 1"}, {31, "SIGUSR2", "user defined signal 2"}, {32, "SIGTHR", "thread AST"}, + {28672, "SIGSTKSZ", "unknown signal"}, } diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_amd64.go index 25cb609..6015fcb 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_amd64.go @@ -109,6 +109,15 @@ const ( BPF_DIRECTION_IN = 0x1 BPF_DIRECTION_OUT = 0x2 BPF_DIV = 0x30 + BPF_FILDROP_CAPTURE = 0x1 + BPF_FILDROP_DROP = 0x2 + BPF_FILDROP_PASS = 0x0 + BPF_F_DIR_IN = 0x10 + BPF_F_DIR_MASK = 0x30 + BPF_F_DIR_OUT = 0x20 + BPF_F_DIR_SHIFT = 0x4 + BPF_F_FLOWID = 0x8 + BPF_F_PRI_MASK = 0x7 BPF_H = 0x8 BPF_IMM = 0x0 BPF_IND = 0x40 @@ -137,6 +146,7 @@ const ( BPF_OR = 0x40 BPF_RELEASE = 0x30bb6 BPF_RET = 0x6 + BPF_RND = 0xc0 BPF_RSH = 0x70 BPF_ST = 0x2 BPF_STX = 0x3 @@ -177,7 +187,65 @@ const ( CTL_KERN = 0x1 CTL_MAXNAME = 0xc CTL_NET = 0x4 + DIOCADDQUEUE = 0xc110445d + DIOCADDRULE = 0xcd604404 + DIOCADDSTATE = 0xc1084425 + DIOCCHANGERULE = 0xcd60441a + DIOCCLRIFFLAG = 0xc028445a + DIOCCLRSRCNODES = 0x20004455 + DIOCCLRSTATES = 0xc0e04412 + DIOCCLRSTATUS = 0xc0284416 + DIOCGETLIMIT = 0xc0084427 + DIOCGETQSTATS = 0xc1204460 + DIOCGETQUEUE = 0xc110445f + DIOCGETQUEUES = 0xc110445e + DIOCGETRULE = 0xcd604407 + DIOCGETRULES = 0xcd604406 + DIOCGETRULESET = 0xc444443b + DIOCGETRULESETS = 0xc444443a + DIOCGETSRCNODES = 0xc0104454 + DIOCGETSTATE = 0xc1084413 + DIOCGETSTATES = 0xc0104419 + DIOCGETSTATUS = 0xc1e84415 + DIOCGETSYNFLWATS = 0xc0084463 + DIOCGETTIMEOUT = 0xc008441e + DIOCIGETIFACES = 0xc0284457 + DIOCKILLSRCNODES = 0xc080445b + DIOCKILLSTATES = 0xc0e04429 + DIOCNATLOOK = 0xc0504417 + DIOCOSFPADD = 0xc088444f DIOCOSFPFLUSH = 0x2000444e + DIOCOSFPGET = 0xc0884450 + DIOCRADDADDRS = 0xc4504443 + DIOCRADDTABLES = 0xc450443d + DIOCRCLRADDRS = 0xc4504442 + DIOCRCLRASTATS = 0xc4504448 + DIOCRCLRTABLES = 0xc450443c + DIOCRCLRTSTATS = 0xc4504441 + DIOCRDELADDRS = 0xc4504444 + DIOCRDELTABLES = 0xc450443e + DIOCRGETADDRS = 0xc4504446 + DIOCRGETASTATS = 0xc4504447 + DIOCRGETTABLES = 0xc450443f + DIOCRGETTSTATS = 0xc4504440 + DIOCRINADEFINE = 0xc450444d + DIOCRSETADDRS = 0xc4504445 + DIOCRSETTFLAGS = 0xc450444a + DIOCRTSTADDRS = 0xc4504449 + DIOCSETDEBUG = 0xc0044418 + DIOCSETHOSTID = 0xc0044456 + DIOCSETIFFLAG = 0xc0284459 + DIOCSETLIMIT = 0xc0084428 + DIOCSETREASS = 0xc004445c + DIOCSETSTATUSIF = 0xc0284414 + DIOCSETSYNCOOKIES = 0xc0014462 + DIOCSETSYNFLWATS = 0xc0084461 + DIOCSETTIMEOUT = 0xc008441d + DIOCSTART = 0x20004401 + DIOCSTOP = 0x20004402 + DIOCXBEGIN = 0xc0104451 + DIOCXCOMMIT = 0xc0104452 + DIOCXROLLBACK = 0xc0104453 DLT_ARCNET = 0x7 DLT_ATM_RFC1483 = 0xb DLT_AX25 = 0x3 @@ -240,6 +308,8 @@ const ( EMUL_ENABLED = 0x1 EMUL_NATIVE = 0x2 ENDRUNDISC = 0x9 + ETH64_8021_RSVD_MASK = 0xfffffffffff0 + ETH64_8021_RSVD_PREFIX = 0x180c2000000 ETHERMIN = 0x2e ETHERMTU = 0x5dc ETHERTYPE_8023 = 0x4 @@ -292,6 +362,7 @@ const ( ETHERTYPE_DN = 0x6003 ETHERTYPE_DOGFIGHT = 0x1989 ETHERTYPE_DSMD = 0x8039 + ETHERTYPE_EAPOL = 0x888e ETHERTYPE_ECMA = 0x803 ETHERTYPE_ENCRYPT = 0x803d ETHERTYPE_ES = 0x805d @@ -323,6 +394,7 @@ const ( ETHERTYPE_LLDP = 0x88cc ETHERTYPE_LOGICRAFT = 0x8148 ETHERTYPE_LOOPBACK = 0x9000 + ETHERTYPE_MACSEC = 0x88e5 ETHERTYPE_MATRA = 0x807a ETHERTYPE_MAX = 0xffff ETHERTYPE_MERIT = 0x807c @@ -351,15 +423,17 @@ const ( ETHERTYPE_NCD = 0x8149 ETHERTYPE_NESTAR = 0x8006 ETHERTYPE_NETBEUI = 0x8191 + ETHERTYPE_NHRP = 0x2001 ETHERTYPE_NOVELL = 0x8138 ETHERTYPE_NS = 0x600 ETHERTYPE_NSAT = 0x601 ETHERTYPE_NSCOMPAT = 0x807 + ETHERTYPE_NSH = 0x984f ETHERTYPE_NTRAILER = 0x10 ETHERTYPE_OS9 = 0x7007 ETHERTYPE_OS9NET = 0x7009 ETHERTYPE_PACER = 0x80c6 - ETHERTYPE_PAE = 0x888e + ETHERTYPE_PBB = 0x88e7 ETHERTYPE_PCS = 0x4242 ETHERTYPE_PLANNING = 0x8044 ETHERTYPE_PPP = 0x880b @@ -441,10 +515,11 @@ const ( ETHER_VLAN_ENCAP_LEN = 0x4 EVFILT_AIO = -0x3 EVFILT_DEVICE = -0x8 + EVFILT_EXCEPT = -0x9 EVFILT_PROC = -0x5 EVFILT_READ = -0x1 EVFILT_SIGNAL = -0x6 - EVFILT_SYSCOUNT = 0x8 + EVFILT_SYSCOUNT = 0x9 EVFILT_TIMER = -0x7 EVFILT_VNODE = -0x4 EVFILT_WRITE = -0x2 @@ -466,7 +541,7 @@ const ( EV_FLAG1 = 0x2000 EV_ONESHOT = 0x10 EV_RECEIPT = 0x40 - EV_SYSFLAGS = 0xf000 + EV_SYSFLAGS = 0xf800 EXTA = 0x4b00 EXTB = 0x9600 EXTPROC = 0x800 @@ -732,6 +807,7 @@ const ( IFT_VOICEOVERCABLE = 0xc6 IFT_VOICEOVERFRAMERELAY = 0x99 IFT_VOICEOVERIP = 0x68 + IFT_WIREGUARD = 0xfb IFT_X213 = 0x5d IFT_X25 = 0x5 IFT_X25DDN = 0x4 @@ -797,9 +873,11 @@ const ( IPPROTO_RAW = 0xff IPPROTO_ROUTING = 0x2b IPPROTO_RSVP = 0x2e + IPPROTO_SCTP = 0x84 IPPROTO_TCP = 0x6 IPPROTO_TP = 0x1d IPPROTO_UDP = 0x11 + IPPROTO_UDPLITE = 0x88 IPV6_AUTH_LEVEL = 0x35 IPV6_AUTOFLOWLABEL = 0x3b IPV6_CHECKSUM = 0x1a @@ -906,6 +984,9 @@ const ( IP_TTL = 0x4 ISIG = 0x80 ISTRIP = 0x20 + ITIMER_PROF = 0x2 + ITIMER_REAL = 0x0 + ITIMER_VIRTUAL = 0x1 IUCLC = 0x1000 IXANY = 0x800 IXOFF = 0x400 @@ -970,12 +1051,26 @@ const ( MNT_ROOTFS = 0x4000 MNT_SOFTDEP = 0x4000000 MNT_STALLED = 0x100000 + MNT_SWAPPABLE = 0x200000 MNT_SYNCHRONOUS = 0x2 MNT_UPDATE = 0x10000 MNT_VISFLAGMASK = 0x400ffff MNT_WAIT = 0x1 MNT_WANTRDWR = 0x2000000 MNT_WXALLOWED = 0x800 + MOUNT_AFS = "afs" + MOUNT_CD9660 = "cd9660" + MOUNT_EXT2FS = "ext2fs" + MOUNT_FFS = "ffs" + MOUNT_FUSEFS = "fuse" + MOUNT_MFS = "mfs" + MOUNT_MSDOS = "msdos" + MOUNT_NCPFS = "ncpfs" + MOUNT_NFS = "nfs" + MOUNT_NTFS = "ntfs" + MOUNT_TMPFS = "tmpfs" + MOUNT_UDF = "udf" + MOUNT_UFS = "ffs" MSG_BCAST = 0x100 MSG_CMSG_CLOEXEC = 0x800 MSG_CTRUNC = 0x20 @@ -988,6 +1083,7 @@ const ( MSG_PEEK = 0x2 MSG_TRUNC = 0x10 MSG_WAITALL = 0x40 + MSG_WAITFORONE = 0x1000 MS_ASYNC = 0x1 MS_INVALIDATE = 0x4 MS_SYNC = 0x2 @@ -996,7 +1092,8 @@ const ( NET_RT_FLAGS = 0x2 NET_RT_IFLIST = 0x3 NET_RT_IFNAMES = 0x6 - NET_RT_MAXID = 0x7 + NET_RT_MAXID = 0x8 + NET_RT_SOURCE = 0x7 NET_RT_STATS = 0x4 NET_RT_TABLE = 0x5 NFDBITS = 0x20 @@ -1013,6 +1110,7 @@ const ( NOTE_FORK = 0x40000000 NOTE_LINK = 0x10 NOTE_LOWAT = 0x1 + NOTE_OOB = 0x4 NOTE_PCTRLMASK = 0xf0000000 NOTE_PDATAMASK = 0xfffff NOTE_RENAME = 0x20 @@ -1130,9 +1228,11 @@ const ( RTF_STATIC = 0x800 RTF_UP = 0x1 RTF_USETRAILERS = 0x8000 + RTM_80211INFO = 0x15 RTM_ADD = 0x1 RTM_BFD = 0x12 RTM_CHANGE = 0x3 + RTM_CHGADDRATTR = 0x14 RTM_DELADDR = 0xd RTM_DELETE = 0x2 RTM_DESYNC = 0x10 @@ -1140,7 +1240,6 @@ const ( RTM_IFANNOUNCE = 0xf RTM_IFINFO = 0xe RTM_INVALIDATE = 0x11 - RTM_LOCK = 0x8 RTM_LOSING = 0x5 RTM_MAXSIZE = 0x800 RTM_MISS = 0x7 @@ -1148,7 +1247,7 @@ const ( RTM_PROPOSAL = 0x13 RTM_REDIRECT = 0x6 RTM_RESOLVE = 0xb - RTM_RTTUNIT = 0xf4240 + RTM_SOURCE = 0x16 RTM_VERSION = 0x5 RTV_EXPIRE = 0x4 RTV_HOPCOUNT = 0x2 @@ -1166,6 +1265,9 @@ const ( RUSAGE_THREAD = 0x1 SCM_RIGHTS = 0x1 SCM_TIMESTAMP = 0x4 + SEEK_CUR = 0x1 + SEEK_END = 0x2 + SEEK_SET = 0x0 SHUT_RD = 0x0 SHUT_RDWR = 0x2 SHUT_WR = 0x1 @@ -1182,35 +1284,37 @@ const ( SIOCBRDGDELS = 0x80606942 SIOCBRDGFLUSH = 0x80606948 SIOCBRDGFRL = 0x808c694e - SIOCBRDGGCACHE = 0xc0186941 - SIOCBRDGGFD = 0xc0186952 - SIOCBRDGGHT = 0xc0186951 + SIOCBRDGGCACHE = 0xc0146941 + SIOCBRDGGFD = 0xc0146952 + SIOCBRDGGHT = 0xc0146951 SIOCBRDGGIFFLGS = 0xc060693e - SIOCBRDGGMA = 0xc0186953 + SIOCBRDGGMA = 0xc0146953 SIOCBRDGGPARAM = 0xc0406958 - SIOCBRDGGPRI = 0xc0186950 + SIOCBRDGGPRI = 0xc0146950 SIOCBRDGGRL = 0xc030694f - SIOCBRDGGTO = 0xc0186946 + SIOCBRDGGTO = 0xc0146946 SIOCBRDGIFS = 0xc0606942 SIOCBRDGRTS = 0xc0206943 SIOCBRDGSADDR = 0xc1286944 - SIOCBRDGSCACHE = 0x80186940 - SIOCBRDGSFD = 0x80186952 - SIOCBRDGSHT = 0x80186951 + SIOCBRDGSCACHE = 0x80146940 + SIOCBRDGSFD = 0x80146952 + SIOCBRDGSHT = 0x80146951 SIOCBRDGSIFCOST = 0x80606955 SIOCBRDGSIFFLGS = 0x8060693f SIOCBRDGSIFPRIO = 0x80606954 SIOCBRDGSIFPROT = 0x8060694a - SIOCBRDGSMA = 0x80186953 - SIOCBRDGSPRI = 0x80186950 - SIOCBRDGSPROTO = 0x8018695a - SIOCBRDGSTO = 0x80186945 - SIOCBRDGSTXHC = 0x80186959 + SIOCBRDGSMA = 0x80146953 + SIOCBRDGSPRI = 0x80146950 + SIOCBRDGSPROTO = 0x8014695a + SIOCBRDGSTO = 0x80146945 + SIOCBRDGSTXHC = 0x80146959 + SIOCDELLABEL = 0x80206997 SIOCDELMULTI = 0x80206932 SIOCDIFADDR = 0x80206919 SIOCDIFGROUP = 0x80286989 SIOCDIFPARENT = 0x802069b4 SIOCDIFPHYADDR = 0x80206949 + SIOCDPWE3NEIGHBOR = 0x802069de SIOCDVNETID = 0x802069af SIOCGETKALIVE = 0xc01869a4 SIOCGETLABEL = 0x8020699a @@ -1229,6 +1333,7 @@ const ( SIOCGIFFLAGS = 0xc0206911 SIOCGIFGATTR = 0xc028698b SIOCGIFGENERIC = 0xc020693a + SIOCGIFGLIST = 0xc028698d SIOCGIFGMEMB = 0xc028698a SIOCGIFGROUP = 0xc0286988 SIOCGIFHARDMTU = 0xc02069a5 @@ -1243,13 +1348,21 @@ const ( SIOCGIFRDOMAIN = 0xc02069a0 SIOCGIFRTLABEL = 0xc0206983 SIOCGIFRXR = 0x802069aa + SIOCGIFSFFPAGE = 0xc1126939 SIOCGIFXFLAGS = 0xc020699e SIOCGLIFPHYADDR = 0xc218694b SIOCGLIFPHYDF = 0xc02069c2 + SIOCGLIFPHYECN = 0xc02069c8 SIOCGLIFPHYRTABLE = 0xc02069a2 SIOCGLIFPHYTTL = 0xc02069a9 SIOCGPGRP = 0x40047309 + SIOCGPWE3 = 0xc0206998 + SIOCGPWE3CTRLWORD = 0xc02069dc + SIOCGPWE3FAT = 0xc02069dd + SIOCGPWE3NEIGHBOR = 0xc21869de + SIOCGRXHPRIO = 0xc02069db SIOCGSPPPPARAMS = 0xc0206994 + SIOCGTXHPRIO = 0xc02069c6 SIOCGUMBINFO = 0xc02069be SIOCGUMBPARAM = 0xc02069c0 SIOCGVH = 0xc02069f6 @@ -1287,19 +1400,20 @@ const ( SIOCSIFXFLAGS = 0x8020699d SIOCSLIFPHYADDR = 0x8218694a SIOCSLIFPHYDF = 0x802069c1 + SIOCSLIFPHYECN = 0x802069c7 SIOCSLIFPHYRTABLE = 0x802069a1 SIOCSLIFPHYTTL = 0x802069a8 SIOCSPGRP = 0x80047308 + SIOCSPWE3CTRLWORD = 0x802069dc + SIOCSPWE3FAT = 0x802069dd + SIOCSPWE3NEIGHBOR = 0x821869de + SIOCSRXHPRIO = 0x802069db SIOCSSPPPPARAMS = 0x80206993 + SIOCSTXHPRIO = 0x802069c5 SIOCSUMBPARAM = 0x802069bf SIOCSVH = 0xc02069f5 SIOCSVNETFLOWID = 0x802069c3 SIOCSVNETID = 0x802069a6 - SIOCSWGDPID = 0xc018695b - SIOCSWGMAXFLOW = 0xc0186960 - SIOCSWGMAXGROUP = 0xc018695d - SIOCSWSDPID = 0x8018695c - SIOCSWSPORTNO = 0xc060695f SOCK_CLOEXEC = 0x8000 SOCK_DGRAM = 0x2 SOCK_DNS = 0x1000 @@ -1314,6 +1428,7 @@ const ( SO_BINDANY = 0x1000 SO_BROADCAST = 0x20 SO_DEBUG = 0x1 + SO_DOMAIN = 0x1024 SO_DONTROUTE = 0x10 SO_ERROR = 0x1007 SO_KEEPALIVE = 0x8 @@ -1321,6 +1436,7 @@ const ( SO_NETPROC = 0x1020 SO_OOBINLINE = 0x100 SO_PEERCRED = 0x1022 + SO_PROTOCOL = 0x1025 SO_RCVBUF = 0x1002 SO_RCVLOWAT = 0x1004 SO_RCVTIMEO = 0x1006 @@ -1370,7 +1486,18 @@ const ( TCOFLUSH = 0x2 TCOOFF = 0x1 TCOON = 0x2 - TCP_MAXBURST = 0x4 + TCPOPT_EOL = 0x0 + TCPOPT_MAXSEG = 0x2 + TCPOPT_NOP = 0x1 + TCPOPT_SACK = 0x5 + TCPOPT_SACK_HDR = 0x1010500 + TCPOPT_SACK_PERMITTED = 0x4 + TCPOPT_SACK_PERMIT_HDR = 0x1010402 + TCPOPT_SIGNATURE = 0x13 + TCPOPT_TIMESTAMP = 0x8 + TCPOPT_TSTAMP_HDR = 0x101080a + TCPOPT_WINDOW = 0x3 + TCP_INFO = 0x9 TCP_MAXSEG = 0x2 TCP_MAXWIN = 0xffff TCP_MAX_SACK = 0x3 @@ -1379,8 +1506,11 @@ const ( TCP_MSS = 0x200 TCP_NODELAY = 0x1 TCP_NOPUSH = 0x10 + TCP_SACKHOLE_LIMIT = 0x80 TCP_SACK_ENABLE = 0x8 TCSAFLUSH = 0x2 + TIMER_ABSTIME = 0x1 + TIMER_RELTIME = 0x0 TIOCCBRK = 0x2000747a TIOCCDTR = 0x20007478 TIOCCHKVERAUTH = 0x2000741e @@ -1445,7 +1575,6 @@ const ( TIOCSPGRP = 0x80047476 TIOCSTART = 0x2000746e TIOCSTAT = 0x20007465 - TIOCSTI = 0x80017472 TIOCSTOP = 0x2000746f TIOCSTSTAMP = 0x8008745a TIOCSWINSZ = 0x80087467 @@ -1467,7 +1596,8 @@ const ( VMIN = 0x10 VM_ANONMIN = 0x7 VM_LOADAVG = 0x2 - VM_MAXID = 0xc + VM_MALLOC_CONF = 0xc + VM_MAXID = 0xd VM_MAXSLP = 0xa VM_METER = 0x1 VM_NKMEMPAGES = 0x6 @@ -1745,7 +1875,7 @@ var signalList = [...]struct { {3, "SIGQUIT", "quit"}, {4, "SIGILL", "illegal instruction"}, {5, "SIGTRAP", "trace/BPT trap"}, - {6, "SIGABRT", "abort trap"}, + {6, "SIGIOT", "abort trap"}, {7, "SIGEMT", "EMT trap"}, {8, "SIGFPE", "floating point exception"}, {9, "SIGKILL", "killed"}, @@ -1772,4 +1902,5 @@ var signalList = [...]struct { {30, "SIGUSR1", "user defined signal 1"}, {31, "SIGUSR2", "user defined signal 2"}, {32, "SIGTHR", "thread AST"}, + {28672, "SIGSTKSZ", "unknown signal"}, } diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm.go index aef6c08..8d44955 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm.go @@ -46,6 +46,7 @@ const ( AF_SNA = 0xb AF_UNIX = 0x1 AF_UNSPEC = 0x0 + ALTWERASE = 0x200 ARPHRD_ETHER = 0x1 ARPHRD_FRELAY = 0xf ARPHRD_IEEE1394 = 0x18 @@ -82,7 +83,7 @@ const ( BIOCGFILDROP = 0x40044278 BIOCGHDRCMPLT = 0x40044274 BIOCGRSIG = 0x40044273 - BIOCGRTIMEOUT = 0x400c426e + BIOCGRTIMEOUT = 0x4010426e BIOCGSTATS = 0x4008426f BIOCIMMEDIATE = 0x80044270 BIOCLOCK = 0x20004276 @@ -96,7 +97,7 @@ const ( BIOCSFILDROP = 0x80044279 BIOCSHDRCMPLT = 0x80044275 BIOCSRSIG = 0x80044272 - BIOCSRTIMEOUT = 0x800c426d + BIOCSRTIMEOUT = 0x8010426d BIOCVERSION = 0x40044271 BPF_A = 0x10 BPF_ABS = 0x20 @@ -108,6 +109,15 @@ const ( BPF_DIRECTION_IN = 0x1 BPF_DIRECTION_OUT = 0x2 BPF_DIV = 0x30 + BPF_FILDROP_CAPTURE = 0x1 + BPF_FILDROP_DROP = 0x2 + BPF_FILDROP_PASS = 0x0 + BPF_F_DIR_IN = 0x10 + BPF_F_DIR_MASK = 0x30 + BPF_F_DIR_OUT = 0x20 + BPF_F_DIR_SHIFT = 0x4 + BPF_F_FLOWID = 0x8 + BPF_F_PRI_MASK = 0x7 BPF_H = 0x8 BPF_IMM = 0x0 BPF_IND = 0x40 @@ -136,6 +146,7 @@ const ( BPF_OR = 0x40 BPF_RELEASE = 0x30bb6 BPF_RET = 0x6 + BPF_RND = 0xc0 BPF_RSH = 0x70 BPF_ST = 0x2 BPF_STX = 0x3 @@ -147,6 +158,12 @@ const ( BRKINT = 0x2 CFLUSH = 0xf CLOCAL = 0x8000 + CLOCK_BOOTTIME = 0x6 + CLOCK_MONOTONIC = 0x3 + CLOCK_PROCESS_CPUTIME_ID = 0x2 + CLOCK_REALTIME = 0x0 + CLOCK_THREAD_CPUTIME_ID = 0x4 + CLOCK_UPTIME = 0x5 CPUSTATES = 0x6 CP_IDLE = 0x5 CP_INTR = 0x4 @@ -170,7 +187,65 @@ const ( CTL_KERN = 0x1 CTL_MAXNAME = 0xc CTL_NET = 0x4 + DIOCADDQUEUE = 0xc100445d + DIOCADDRULE = 0xcce04404 + DIOCADDSTATE = 0xc1084425 + DIOCCHANGERULE = 0xcce0441a + DIOCCLRIFFLAG = 0xc024445a + DIOCCLRSRCNODES = 0x20004455 + DIOCCLRSTATES = 0xc0d04412 + DIOCCLRSTATUS = 0xc0244416 + DIOCGETLIMIT = 0xc0084427 + DIOCGETQSTATS = 0xc1084460 + DIOCGETQUEUE = 0xc100445f + DIOCGETQUEUES = 0xc100445e + DIOCGETRULE = 0xcce04407 + DIOCGETRULES = 0xcce04406 + DIOCGETRULESET = 0xc444443b + DIOCGETRULESETS = 0xc444443a + DIOCGETSRCNODES = 0xc0084454 + DIOCGETSTATE = 0xc1084413 + DIOCGETSTATES = 0xc0084419 + DIOCGETSTATUS = 0xc1e84415 + DIOCGETSYNFLWATS = 0xc0084463 + DIOCGETTIMEOUT = 0xc008441e + DIOCIGETIFACES = 0xc0244457 + DIOCKILLSRCNODES = 0xc068445b + DIOCKILLSTATES = 0xc0d04429 + DIOCNATLOOK = 0xc0504417 + DIOCOSFPADD = 0xc088444f DIOCOSFPFLUSH = 0x2000444e + DIOCOSFPGET = 0xc0884450 + DIOCRADDADDRS = 0xc44c4443 + DIOCRADDTABLES = 0xc44c443d + DIOCRCLRADDRS = 0xc44c4442 + DIOCRCLRASTATS = 0xc44c4448 + DIOCRCLRTABLES = 0xc44c443c + DIOCRCLRTSTATS = 0xc44c4441 + DIOCRDELADDRS = 0xc44c4444 + DIOCRDELTABLES = 0xc44c443e + DIOCRGETADDRS = 0xc44c4446 + DIOCRGETASTATS = 0xc44c4447 + DIOCRGETTABLES = 0xc44c443f + DIOCRGETTSTATS = 0xc44c4440 + DIOCRINADEFINE = 0xc44c444d + DIOCRSETADDRS = 0xc44c4445 + DIOCRSETTFLAGS = 0xc44c444a + DIOCRTSTADDRS = 0xc44c4449 + DIOCSETDEBUG = 0xc0044418 + DIOCSETHOSTID = 0xc0044456 + DIOCSETIFFLAG = 0xc0244459 + DIOCSETLIMIT = 0xc0084428 + DIOCSETREASS = 0xc004445c + DIOCSETSTATUSIF = 0xc0244414 + DIOCSETSYNCOOKIES = 0xc0014462 + DIOCSETSYNFLWATS = 0xc0084461 + DIOCSETTIMEOUT = 0xc008441d + DIOCSTART = 0x20004401 + DIOCSTOP = 0x20004402 + DIOCXBEGIN = 0xc00c4451 + DIOCXCOMMIT = 0xc00c4452 + DIOCXROLLBACK = 0xc00c4453 DLT_ARCNET = 0x7 DLT_ATM_RFC1483 = 0xb DLT_AX25 = 0x3 @@ -186,6 +261,7 @@ const ( DLT_LOOP = 0xc DLT_MPLS = 0xdb DLT_NULL = 0x0 + DLT_OPENFLOW = 0x10b DLT_PFLOG = 0x75 DLT_PFSYNC = 0x12 DLT_PPP = 0x9 @@ -196,6 +272,23 @@ const ( DLT_RAW = 0xe DLT_SLIP = 0x8 DLT_SLIP_BSDOS = 0xf + DLT_USBPCAP = 0xf9 + DLT_USER0 = 0x93 + DLT_USER1 = 0x94 + DLT_USER10 = 0x9d + DLT_USER11 = 0x9e + DLT_USER12 = 0x9f + DLT_USER13 = 0xa0 + DLT_USER14 = 0xa1 + DLT_USER15 = 0xa2 + DLT_USER2 = 0x95 + DLT_USER3 = 0x96 + DLT_USER4 = 0x97 + DLT_USER5 = 0x98 + DLT_USER6 = 0x99 + DLT_USER7 = 0x9a + DLT_USER8 = 0x9b + DLT_USER9 = 0x9c DT_BLK = 0x6 DT_CHR = 0x2 DT_DIR = 0x4 @@ -215,6 +308,8 @@ const ( EMUL_ENABLED = 0x1 EMUL_NATIVE = 0x2 ENDRUNDISC = 0x9 + ETH64_8021_RSVD_MASK = 0xfffffffffff0 + ETH64_8021_RSVD_PREFIX = 0x180c2000000 ETHERMIN = 0x2e ETHERMTU = 0x5dc ETHERTYPE_8023 = 0x4 @@ -267,6 +362,7 @@ const ( ETHERTYPE_DN = 0x6003 ETHERTYPE_DOGFIGHT = 0x1989 ETHERTYPE_DSMD = 0x8039 + ETHERTYPE_EAPOL = 0x888e ETHERTYPE_ECMA = 0x803 ETHERTYPE_ENCRYPT = 0x803d ETHERTYPE_ES = 0x805d @@ -298,6 +394,7 @@ const ( ETHERTYPE_LLDP = 0x88cc ETHERTYPE_LOGICRAFT = 0x8148 ETHERTYPE_LOOPBACK = 0x9000 + ETHERTYPE_MACSEC = 0x88e5 ETHERTYPE_MATRA = 0x807a ETHERTYPE_MAX = 0xffff ETHERTYPE_MERIT = 0x807c @@ -326,15 +423,17 @@ const ( ETHERTYPE_NCD = 0x8149 ETHERTYPE_NESTAR = 0x8006 ETHERTYPE_NETBEUI = 0x8191 + ETHERTYPE_NHRP = 0x2001 ETHERTYPE_NOVELL = 0x8138 ETHERTYPE_NS = 0x600 ETHERTYPE_NSAT = 0x601 ETHERTYPE_NSCOMPAT = 0x807 + ETHERTYPE_NSH = 0x984f ETHERTYPE_NTRAILER = 0x10 ETHERTYPE_OS9 = 0x7007 ETHERTYPE_OS9NET = 0x7009 ETHERTYPE_PACER = 0x80c6 - ETHERTYPE_PAE = 0x888e + ETHERTYPE_PBB = 0x88e7 ETHERTYPE_PCS = 0x4242 ETHERTYPE_PLANNING = 0x8044 ETHERTYPE_PPP = 0x880b @@ -409,28 +508,40 @@ const ( ETHER_CRC_POLY_LE = 0xedb88320 ETHER_HDR_LEN = 0xe ETHER_MAX_DIX_LEN = 0x600 + ETHER_MAX_HARDMTU_LEN = 0xff9b ETHER_MAX_LEN = 0x5ee ETHER_MIN_LEN = 0x40 ETHER_TYPE_LEN = 0x2 ETHER_VLAN_ENCAP_LEN = 0x4 EVFILT_AIO = -0x3 + EVFILT_DEVICE = -0x8 + EVFILT_EXCEPT = -0x9 EVFILT_PROC = -0x5 EVFILT_READ = -0x1 EVFILT_SIGNAL = -0x6 - EVFILT_SYSCOUNT = 0x7 + EVFILT_SYSCOUNT = 0x9 EVFILT_TIMER = -0x7 EVFILT_VNODE = -0x4 EVFILT_WRITE = -0x2 + EVL_ENCAPLEN = 0x4 + EVL_PRIO_BITS = 0xd + EVL_PRIO_MAX = 0x7 + EVL_VLID_MASK = 0xfff + EVL_VLID_MAX = 0xffe + EVL_VLID_MIN = 0x1 + EVL_VLID_NULL = 0x0 EV_ADD = 0x1 EV_CLEAR = 0x20 EV_DELETE = 0x2 EV_DISABLE = 0x8 + EV_DISPATCH = 0x80 EV_ENABLE = 0x4 EV_EOF = 0x8000 EV_ERROR = 0x4000 EV_FLAG1 = 0x2000 EV_ONESHOT = 0x10 - EV_SYSFLAGS = 0xf000 + EV_RECEIPT = 0x40 + EV_SYSFLAGS = 0xf800 EXTA = 0x4b00 EXTB = 0x9600 EXTPROC = 0x800 @@ -443,6 +554,8 @@ const ( F_GETFL = 0x3 F_GETLK = 0x7 F_GETOWN = 0x5 + F_ISATTY = 0xb + F_OK = 0x0 F_RDLCK = 0x1 F_SETFD = 0x2 F_SETFL = 0x4 @@ -459,7 +572,6 @@ const ( IEXTEN = 0x400 IFAN_ARRIVAL = 0x0 IFAN_DEPARTURE = 0x1 - IFA_ROUTE = 0x1 IFF_ALLMULTI = 0x200 IFF_BROADCAST = 0x2 IFF_CANTCHANGE = 0x8e52 @@ -470,12 +582,12 @@ const ( IFF_LOOPBACK = 0x8 IFF_MULTICAST = 0x8000 IFF_NOARP = 0x80 - IFF_NOTRAILERS = 0x20 IFF_OACTIVE = 0x400 IFF_POINTOPOINT = 0x10 IFF_PROMISC = 0x100 IFF_RUNNING = 0x40 IFF_SIMPLEX = 0x800 + IFF_STATICARP = 0x20 IFF_UP = 0x1 IFNAMSIZ = 0x10 IFT_1822 = 0x2 @@ -604,6 +716,7 @@ const ( IFT_LINEGROUP = 0xd2 IFT_LOCALTALK = 0x2a IFT_LOOP = 0x18 + IFT_MBIM = 0xfa IFT_MEDIAMAILOVERIP = 0x8b IFT_MFSIGLINK = 0xa7 IFT_MIOX25 = 0x26 @@ -694,6 +807,7 @@ const ( IFT_VOICEOVERCABLE = 0xc6 IFT_VOICEOVERFRAMERELAY = 0x99 IFT_VOICEOVERIP = 0x68 + IFT_WIREGUARD = 0xfb IFT_X213 = 0x5d IFT_X25 = 0x5 IFT_X25DDN = 0x4 @@ -728,8 +842,6 @@ const ( IPPROTO_AH = 0x33 IPPROTO_CARP = 0x70 IPPROTO_DIVERT = 0x102 - IPPROTO_DIVERT_INIT = 0x2 - IPPROTO_DIVERT_RESP = 0x1 IPPROTO_DONE = 0x101 IPPROTO_DSTOPTS = 0x3c IPPROTO_EGP = 0x8 @@ -761,9 +873,11 @@ const ( IPPROTO_RAW = 0xff IPPROTO_ROUTING = 0x2b IPPROTO_RSVP = 0x2e + IPPROTO_SCTP = 0x84 IPPROTO_TCP = 0x6 IPPROTO_TP = 0x1d IPPROTO_UDP = 0x11 + IPPROTO_UDPLITE = 0x88 IPV6_AUTH_LEVEL = 0x35 IPV6_AUTOFLOWLABEL = 0x3b IPV6_CHECKSUM = 0x1a @@ -786,6 +900,7 @@ const ( IPV6_LEAVE_GROUP = 0xd IPV6_MAXHLIM = 0xff IPV6_MAXPACKET = 0xffff + IPV6_MINHOPCOUNT = 0x41 IPV6_MMTU = 0x500 IPV6_MULTICAST_HOPS = 0xa IPV6_MULTICAST_IF = 0x9 @@ -825,12 +940,12 @@ const ( IP_DEFAULT_MULTICAST_LOOP = 0x1 IP_DEFAULT_MULTICAST_TTL = 0x1 IP_DF = 0x4000 - IP_DIVERTFL = 0x1022 IP_DROP_MEMBERSHIP = 0xd IP_ESP_NETWORK_LEVEL = 0x16 IP_ESP_TRANS_LEVEL = 0x15 IP_HDRINCL = 0x2 IP_IPCOMP_LEVEL = 0x1d + IP_IPDEFTTL = 0x25 IP_IPSECFLOWINFO = 0x24 IP_IPSEC_LOCAL_AUTH = 0x1b IP_IPSEC_LOCAL_CRED = 0x19 @@ -864,10 +979,15 @@ const ( IP_RETOPTS = 0x8 IP_RF = 0x8000 IP_RTABLE = 0x1021 + IP_SENDSRCADDR = 0x7 IP_TOS = 0x3 IP_TTL = 0x4 ISIG = 0x80 ISTRIP = 0x20 + ITIMER_PROF = 0x2 + ITIMER_REAL = 0x0 + ITIMER_VIRTUAL = 0x1 + IUCLC = 0x1000 IXANY = 0x800 IXOFF = 0x400 IXON = 0x200 @@ -922,6 +1042,7 @@ const ( MNT_NOATIME = 0x8000 MNT_NODEV = 0x10 MNT_NOEXEC = 0x4 + MNT_NOPERM = 0x20 MNT_NOSUID = 0x8 MNT_NOWAIT = 0x2 MNT_QUOTA = 0x2000 @@ -929,12 +1050,27 @@ const ( MNT_RELOAD = 0x40000 MNT_ROOTFS = 0x4000 MNT_SOFTDEP = 0x4000000 + MNT_STALLED = 0x100000 + MNT_SWAPPABLE = 0x200000 MNT_SYNCHRONOUS = 0x2 MNT_UPDATE = 0x10000 MNT_VISFLAGMASK = 0x400ffff MNT_WAIT = 0x1 MNT_WANTRDWR = 0x2000000 MNT_WXALLOWED = 0x800 + MOUNT_AFS = "afs" + MOUNT_CD9660 = "cd9660" + MOUNT_EXT2FS = "ext2fs" + MOUNT_FFS = "ffs" + MOUNT_FUSEFS = "fuse" + MOUNT_MFS = "mfs" + MOUNT_MSDOS = "msdos" + MOUNT_NCPFS = "ncpfs" + MOUNT_NFS = "nfs" + MOUNT_NTFS = "ntfs" + MOUNT_TMPFS = "tmpfs" + MOUNT_UDF = "udf" + MOUNT_UFS = "ffs" MSG_BCAST = 0x100 MSG_CMSG_CLOEXEC = 0x800 MSG_CTRUNC = 0x20 @@ -947,6 +1083,7 @@ const ( MSG_PEEK = 0x2 MSG_TRUNC = 0x10 MSG_WAITALL = 0x40 + MSG_WAITFORONE = 0x1000 MS_ASYNC = 0x1 MS_INVALIDATE = 0x4 MS_SYNC = 0x2 @@ -954,12 +1091,16 @@ const ( NET_RT_DUMP = 0x1 NET_RT_FLAGS = 0x2 NET_RT_IFLIST = 0x3 - NET_RT_MAXID = 0x6 + NET_RT_IFNAMES = 0x6 + NET_RT_MAXID = 0x8 + NET_RT_SOURCE = 0x7 NET_RT_STATS = 0x4 NET_RT_TABLE = 0x5 NFDBITS = 0x20 NOFLSH = 0x80000000 + NOKERNINFO = 0x2000000 NOTE_ATTRIB = 0x8 + NOTE_CHANGE = 0x1 NOTE_CHILD = 0x4 NOTE_DELETE = 0x1 NOTE_EOF = 0x2 @@ -969,6 +1110,7 @@ const ( NOTE_FORK = 0x40000000 NOTE_LINK = 0x10 NOTE_LOWAT = 0x1 + NOTE_OOB = 0x4 NOTE_PCTRLMASK = 0xf0000000 NOTE_PDATAMASK = 0xfffff NOTE_RENAME = 0x20 @@ -978,11 +1120,13 @@ const ( NOTE_TRUNCATE = 0x80 NOTE_WRITE = 0x2 OCRNL = 0x10 + OLCUC = 0x20 ONLCR = 0x2 ONLRET = 0x80 ONOCR = 0x40 ONOEOT = 0x8 OPOST = 0x1 + OXTABS = 0x4 O_ACCMODE = 0x3 O_APPEND = 0x8 O_ASYNC = 0x40 @@ -1027,19 +1171,25 @@ const ( RLIMIT_STACK = 0x3 RLIM_INFINITY = 0x7fffffffffffffff RTAX_AUTHOR = 0x6 + RTAX_BFD = 0xb RTAX_BRD = 0x7 + RTAX_DNS = 0xc RTAX_DST = 0x0 RTAX_GATEWAY = 0x1 RTAX_GENMASK = 0x3 RTAX_IFA = 0x5 RTAX_IFP = 0x4 RTAX_LABEL = 0xa - RTAX_MAX = 0xb + RTAX_MAX = 0xf RTAX_NETMASK = 0x2 + RTAX_SEARCH = 0xe RTAX_SRC = 0x8 RTAX_SRCMASK = 0x9 + RTAX_STATIC = 0xd RTA_AUTHOR = 0x40 + RTA_BFD = 0x800 RTA_BRD = 0x80 + RTA_DNS = 0x1000 RTA_DST = 0x1 RTA_GATEWAY = 0x2 RTA_GENMASK = 0x8 @@ -1047,24 +1197,29 @@ const ( RTA_IFP = 0x10 RTA_LABEL = 0x400 RTA_NETMASK = 0x4 + RTA_SEARCH = 0x4000 RTA_SRC = 0x100 RTA_SRCMASK = 0x200 + RTA_STATIC = 0x2000 RTF_ANNOUNCE = 0x4000 + RTF_BFD = 0x1000000 RTF_BLACKHOLE = 0x1000 RTF_BROADCAST = 0x400000 + RTF_CACHED = 0x20000 RTF_CLONED = 0x10000 RTF_CLONING = 0x100 + RTF_CONNECTED = 0x800000 RTF_DONE = 0x40 RTF_DYNAMIC = 0x10 - RTF_FMASK = 0x70f808 + RTF_FMASK = 0x110fc08 RTF_GATEWAY = 0x2 RTF_HOST = 0x4 RTF_LLINFO = 0x400 RTF_LOCAL = 0x200000 - RTF_MASK = 0x80 RTF_MODIFIED = 0x20 RTF_MPATH = 0x40000 RTF_MPLS = 0x100000 + RTF_MULTICAST = 0x200 RTF_PERMANENT_ARP = 0x2000 RTF_PROTO1 = 0x8000 RTF_PROTO2 = 0x4000 @@ -1073,23 +1228,26 @@ const ( RTF_STATIC = 0x800 RTF_UP = 0x1 RTF_USETRAILERS = 0x8000 - RTF_XRESOLVE = 0x200 + RTM_80211INFO = 0x15 RTM_ADD = 0x1 + RTM_BFD = 0x12 RTM_CHANGE = 0x3 + RTM_CHGADDRATTR = 0x14 RTM_DELADDR = 0xd RTM_DELETE = 0x2 RTM_DESYNC = 0x10 RTM_GET = 0x4 RTM_IFANNOUNCE = 0xf RTM_IFINFO = 0xe - RTM_LOCK = 0x8 + RTM_INVALIDATE = 0x11 RTM_LOSING = 0x5 RTM_MAXSIZE = 0x800 RTM_MISS = 0x7 RTM_NEWADDR = 0xc + RTM_PROPOSAL = 0x13 RTM_REDIRECT = 0x6 RTM_RESOLVE = 0xb - RTM_RTTUNIT = 0xf4240 + RTM_SOURCE = 0x16 RTM_VERSION = 0x5 RTV_EXPIRE = 0x4 RTV_HOPCOUNT = 0x2 @@ -1099,67 +1257,74 @@ const ( RTV_RTTVAR = 0x80 RTV_SPIPE = 0x10 RTV_SSTHRESH = 0x20 + RT_TABLEID_BITS = 0x8 + RT_TABLEID_MASK = 0xff RT_TABLEID_MAX = 0xff RUSAGE_CHILDREN = -0x1 RUSAGE_SELF = 0x0 RUSAGE_THREAD = 0x1 SCM_RIGHTS = 0x1 SCM_TIMESTAMP = 0x4 + SEEK_CUR = 0x1 + SEEK_END = 0x2 + SEEK_SET = 0x0 SHUT_RD = 0x0 SHUT_RDWR = 0x2 SHUT_WR = 0x1 SIOCADDMULTI = 0x80206931 SIOCAIFADDR = 0x8040691a SIOCAIFGROUP = 0x80246987 - SIOCALIFADDR = 0x8218691c SIOCATMARK = 0x40047307 - SIOCBRDGADD = 0x8054693c - SIOCBRDGADDS = 0x80546941 - SIOCBRDGARL = 0x806e694d + SIOCBRDGADD = 0x8060693c + SIOCBRDGADDL = 0x80606949 + SIOCBRDGADDS = 0x80606941 + SIOCBRDGARL = 0x808c694d SIOCBRDGDADDR = 0x81286947 - SIOCBRDGDEL = 0x8054693d - SIOCBRDGDELS = 0x80546942 - SIOCBRDGFLUSH = 0x80546948 - SIOCBRDGFRL = 0x806e694e + SIOCBRDGDEL = 0x8060693d + SIOCBRDGDELS = 0x80606942 + SIOCBRDGFLUSH = 0x80606948 + SIOCBRDGFRL = 0x808c694e SIOCBRDGGCACHE = 0xc0146941 SIOCBRDGGFD = 0xc0146952 SIOCBRDGGHT = 0xc0146951 - SIOCBRDGGIFFLGS = 0xc054693e + SIOCBRDGGIFFLGS = 0xc060693e SIOCBRDGGMA = 0xc0146953 - SIOCBRDGGPARAM = 0xc03c6958 + SIOCBRDGGPARAM = 0xc0406958 SIOCBRDGGPRI = 0xc0146950 SIOCBRDGGRL = 0xc028694f - SIOCBRDGGSIFS = 0xc054693c SIOCBRDGGTO = 0xc0146946 - SIOCBRDGIFS = 0xc0546942 + SIOCBRDGIFS = 0xc0606942 SIOCBRDGRTS = 0xc0186943 SIOCBRDGSADDR = 0xc1286944 SIOCBRDGSCACHE = 0x80146940 SIOCBRDGSFD = 0x80146952 SIOCBRDGSHT = 0x80146951 - SIOCBRDGSIFCOST = 0x80546955 - SIOCBRDGSIFFLGS = 0x8054693f - SIOCBRDGSIFPRIO = 0x80546954 + SIOCBRDGSIFCOST = 0x80606955 + SIOCBRDGSIFFLGS = 0x8060693f + SIOCBRDGSIFPRIO = 0x80606954 + SIOCBRDGSIFPROT = 0x8060694a SIOCBRDGSMA = 0x80146953 SIOCBRDGSPRI = 0x80146950 SIOCBRDGSPROTO = 0x8014695a SIOCBRDGSTO = 0x80146945 SIOCBRDGSTXHC = 0x80146959 + SIOCDELLABEL = 0x80206997 SIOCDELMULTI = 0x80206932 SIOCDIFADDR = 0x80206919 SIOCDIFGROUP = 0x80246989 + SIOCDIFPARENT = 0x802069b4 SIOCDIFPHYADDR = 0x80206949 - SIOCDLIFADDR = 0x8218691e + SIOCDPWE3NEIGHBOR = 0x802069de + SIOCDVNETID = 0x802069af SIOCGETKALIVE = 0xc01869a4 SIOCGETLABEL = 0x8020699a + SIOCGETMPWCFG = 0xc02069ae SIOCGETPFLOW = 0xc02069fe SIOCGETPFSYNC = 0xc02069f8 SIOCGETSGCNT = 0xc0147534 SIOCGETVIFCNT = 0xc0147533 SIOCGETVLAN = 0xc0206990 - SIOCGHIWAT = 0x40047301 SIOCGIFADDR = 0xc0206921 - SIOCGIFASYNCMAP = 0xc020697c SIOCGIFBRDADDR = 0xc0206923 SIOCGIFCONF = 0xc0086924 SIOCGIFDATA = 0xc020691b @@ -1168,41 +1333,53 @@ const ( SIOCGIFFLAGS = 0xc0206911 SIOCGIFGATTR = 0xc024698b SIOCGIFGENERIC = 0xc020693a + SIOCGIFGLIST = 0xc024698d SIOCGIFGMEMB = 0xc024698a SIOCGIFGROUP = 0xc0246988 SIOCGIFHARDMTU = 0xc02069a5 - SIOCGIFMEDIA = 0xc0286936 + SIOCGIFLLPRIO = 0xc02069b6 + SIOCGIFMEDIA = 0xc0386938 SIOCGIFMETRIC = 0xc0206917 SIOCGIFMTU = 0xc020697e SIOCGIFNETMASK = 0xc0206925 - SIOCGIFPDSTADDR = 0xc0206948 + SIOCGIFPAIR = 0xc02069b1 + SIOCGIFPARENT = 0xc02069b3 SIOCGIFPRIORITY = 0xc020699c - SIOCGIFPSRCADDR = 0xc0206947 SIOCGIFRDOMAIN = 0xc02069a0 SIOCGIFRTLABEL = 0xc0206983 SIOCGIFRXR = 0x802069aa - SIOCGIFTIMESLOT = 0xc0206986 + SIOCGIFSFFPAGE = 0xc1126939 SIOCGIFXFLAGS = 0xc020699e - SIOCGLIFADDR = 0xc218691d SIOCGLIFPHYADDR = 0xc218694b + SIOCGLIFPHYDF = 0xc02069c2 + SIOCGLIFPHYECN = 0xc02069c8 SIOCGLIFPHYRTABLE = 0xc02069a2 SIOCGLIFPHYTTL = 0xc02069a9 - SIOCGLOWAT = 0x40047303 SIOCGPGRP = 0x40047309 + SIOCGPWE3 = 0xc0206998 + SIOCGPWE3CTRLWORD = 0xc02069dc + SIOCGPWE3FAT = 0xc02069dd + SIOCGPWE3NEIGHBOR = 0xc21869de + SIOCGRXHPRIO = 0xc02069db SIOCGSPPPPARAMS = 0xc0206994 + SIOCGTXHPRIO = 0xc02069c6 + SIOCGUMBINFO = 0xc02069be + SIOCGUMBPARAM = 0xc02069c0 SIOCGVH = 0xc02069f6 + SIOCGVNETFLOWID = 0xc02069c4 SIOCGVNETID = 0xc02069a7 + SIOCIFAFATTACH = 0x801169ab + SIOCIFAFDETACH = 0x801169ac SIOCIFCREATE = 0x8020697a SIOCIFDESTROY = 0x80206979 SIOCIFGCLONERS = 0xc00c6978 SIOCSETKALIVE = 0x801869a3 SIOCSETLABEL = 0x80206999 + SIOCSETMPWCFG = 0x802069ad SIOCSETPFLOW = 0x802069fd SIOCSETPFSYNC = 0x802069f7 SIOCSETVLAN = 0x8020698f - SIOCSHIWAT = 0x80047300 SIOCSIFADDR = 0x8020690c - SIOCSIFASYNCMAP = 0x8020697d SIOCSIFBRDADDR = 0x80206913 SIOCSIFDESCR = 0x80206980 SIOCSIFDSTADDR = 0x8020690e @@ -1210,26 +1387,36 @@ const ( SIOCSIFGATTR = 0x8024698c SIOCSIFGENERIC = 0x80206939 SIOCSIFLLADDR = 0x8020691f - SIOCSIFMEDIA = 0xc0206935 + SIOCSIFLLPRIO = 0x802069b5 + SIOCSIFMEDIA = 0xc0206937 SIOCSIFMETRIC = 0x80206918 SIOCSIFMTU = 0x8020697f SIOCSIFNETMASK = 0x80206916 - SIOCSIFPHYADDR = 0x80406946 + SIOCSIFPAIR = 0x802069b0 + SIOCSIFPARENT = 0x802069b2 SIOCSIFPRIORITY = 0x8020699b SIOCSIFRDOMAIN = 0x8020699f SIOCSIFRTLABEL = 0x80206982 - SIOCSIFTIMESLOT = 0x80206985 SIOCSIFXFLAGS = 0x8020699d SIOCSLIFPHYADDR = 0x8218694a + SIOCSLIFPHYDF = 0x802069c1 + SIOCSLIFPHYECN = 0x802069c7 SIOCSLIFPHYRTABLE = 0x802069a1 SIOCSLIFPHYTTL = 0x802069a8 - SIOCSLOWAT = 0x80047302 SIOCSPGRP = 0x80047308 + SIOCSPWE3CTRLWORD = 0x802069dc + SIOCSPWE3FAT = 0x802069dd + SIOCSPWE3NEIGHBOR = 0x821869de + SIOCSRXHPRIO = 0x802069db SIOCSSPPPPARAMS = 0x80206993 + SIOCSTXHPRIO = 0x802069c5 + SIOCSUMBPARAM = 0x802069bf SIOCSVH = 0xc02069f5 + SIOCSVNETFLOWID = 0x802069c3 SIOCSVNETID = 0x802069a6 SOCK_CLOEXEC = 0x8000 SOCK_DGRAM = 0x2 + SOCK_DNS = 0x1000 SOCK_NONBLOCK = 0x4000 SOCK_RAW = 0x3 SOCK_RDM = 0x4 @@ -1241,6 +1428,7 @@ const ( SO_BINDANY = 0x1000 SO_BROADCAST = 0x20 SO_DEBUG = 0x1 + SO_DOMAIN = 0x1024 SO_DONTROUTE = 0x10 SO_ERROR = 0x1007 SO_KEEPALIVE = 0x8 @@ -1248,6 +1436,7 @@ const ( SO_NETPROC = 0x1020 SO_OOBINLINE = 0x100 SO_PEERCRED = 0x1022 + SO_PROTOCOL = 0x1025 SO_RCVBUF = 0x1002 SO_RCVLOWAT = 0x1004 SO_RCVTIMEO = 0x1006 @@ -1261,6 +1450,7 @@ const ( SO_TIMESTAMP = 0x800 SO_TYPE = 0x1008 SO_USELOOPBACK = 0x40 + SO_ZEROIZE = 0x2000 S_BLKSIZE = 0x200 S_IEXEC = 0x40 S_IFBLK = 0x6000 @@ -1290,9 +1480,24 @@ const ( S_IXOTH = 0x1 S_IXUSR = 0x40 TCIFLUSH = 0x1 + TCIOFF = 0x3 TCIOFLUSH = 0x3 + TCION = 0x4 TCOFLUSH = 0x2 - TCP_MAXBURST = 0x4 + TCOOFF = 0x1 + TCOON = 0x2 + TCPOPT_EOL = 0x0 + TCPOPT_MAXSEG = 0x2 + TCPOPT_NOP = 0x1 + TCPOPT_SACK = 0x5 + TCPOPT_SACK_HDR = 0x1010500 + TCPOPT_SACK_PERMITTED = 0x4 + TCPOPT_SACK_PERMIT_HDR = 0x1010402 + TCPOPT_SIGNATURE = 0x13 + TCPOPT_TIMESTAMP = 0x8 + TCPOPT_TSTAMP_HDR = 0x101080a + TCPOPT_WINDOW = 0x3 + TCP_INFO = 0x9 TCP_MAXSEG = 0x2 TCP_MAXWIN = 0xffff TCP_MAX_SACK = 0x3 @@ -1301,11 +1506,15 @@ const ( TCP_MSS = 0x200 TCP_NODELAY = 0x1 TCP_NOPUSH = 0x10 - TCP_NSTATES = 0xb + TCP_SACKHOLE_LIMIT = 0x80 TCP_SACK_ENABLE = 0x8 TCSAFLUSH = 0x2 + TIMER_ABSTIME = 0x1 + TIMER_RELTIME = 0x0 TIOCCBRK = 0x2000747a TIOCCDTR = 0x20007478 + TIOCCHKVERAUTH = 0x2000741e + TIOCCLRVERAUTH = 0x2000741d TIOCCONS = 0x80047462 TIOCDRAIN = 0x2000745e TIOCEXCL = 0x2000740d @@ -1321,7 +1530,7 @@ const ( TIOCGFLAGS = 0x4004745d TIOCGPGRP = 0x40047477 TIOCGSID = 0x40047463 - TIOCGTSTAMP = 0x400c745b + TIOCGTSTAMP = 0x4010745b TIOCGWINSZ = 0x40087468 TIOCMBIC = 0x8004746b TIOCMBIS = 0x8004746c @@ -1360,17 +1569,21 @@ const ( TIOCSETAF = 0x802c7416 TIOCSETAW = 0x802c7415 TIOCSETD = 0x8004741b + TIOCSETVERAUTH = 0x8004741c TIOCSFLAGS = 0x8004745c TIOCSIG = 0x8004745f TIOCSPGRP = 0x80047476 TIOCSTART = 0x2000746e - TIOCSTAT = 0x80047465 - TIOCSTI = 0x80017472 + TIOCSTAT = 0x20007465 TIOCSTOP = 0x2000746f TIOCSTSTAMP = 0x8008745a TIOCSWINSZ = 0x80087467 TIOCUCNTL = 0x80047466 + TIOCUCNTL_CBRK = 0x7a + TIOCUCNTL_SBRK = 0x7b TOSTOP = 0x400000 + UTIME_NOW = -0x2 + UTIME_OMIT = -0x1 VDISCARD = 0xf VDSUSP = 0xb VEOF = 0x0 @@ -1381,6 +1594,19 @@ const ( VKILL = 0x5 VLNEXT = 0xe VMIN = 0x10 + VM_ANONMIN = 0x7 + VM_LOADAVG = 0x2 + VM_MALLOC_CONF = 0xc + VM_MAXID = 0xd + VM_MAXSLP = 0xa + VM_METER = 0x1 + VM_NKMEMPAGES = 0x6 + VM_PSSTRINGS = 0x3 + VM_SWAPENCRYPT = 0x5 + VM_USPACE = 0xb + VM_UVMEXP = 0x4 + VM_VNODEMIN = 0x9 + VM_VTEXTMIN = 0x8 VQUIT = 0x9 VREPRINT = 0x6 VSTART = 0xc @@ -1394,6 +1620,7 @@ const ( WCOREFLAG = 0x80 WNOHANG = 0x1 WUNTRACED = 0x2 + XCASE = 0x1000000 ) // Errors @@ -1407,6 +1634,7 @@ const ( EALREADY = syscall.Errno(0x25) EAUTH = syscall.Errno(0x50) EBADF = syscall.Errno(0x9) + EBADMSG = syscall.Errno(0x5c) EBADRPC = syscall.Errno(0x48) EBUSY = syscall.Errno(0x10) ECANCELED = syscall.Errno(0x58) @@ -1433,7 +1661,7 @@ const ( EIPSEC = syscall.Errno(0x52) EISCONN = syscall.Errno(0x38) EISDIR = syscall.Errno(0x15) - ELAST = syscall.Errno(0x5b) + ELAST = syscall.Errno(0x5f) ELOOP = syscall.Errno(0x3e) EMEDIUMTYPE = syscall.Errno(0x56) EMFILE = syscall.Errno(0x18) @@ -1461,12 +1689,14 @@ const ( ENOTCONN = syscall.Errno(0x39) ENOTDIR = syscall.Errno(0x14) ENOTEMPTY = syscall.Errno(0x42) + ENOTRECOVERABLE = syscall.Errno(0x5d) ENOTSOCK = syscall.Errno(0x26) ENOTSUP = syscall.Errno(0x5b) ENOTTY = syscall.Errno(0x19) ENXIO = syscall.Errno(0x6) EOPNOTSUPP = syscall.Errno(0x2d) EOVERFLOW = syscall.Errno(0x57) + EOWNERDEAD = syscall.Errno(0x5e) EPERM = syscall.Errno(0x1) EPFNOSUPPORT = syscall.Errno(0x2e) EPIPE = syscall.Errno(0x20) @@ -1474,6 +1704,7 @@ const ( EPROCUNAVAIL = syscall.Errno(0x4c) EPROGMISMATCH = syscall.Errno(0x4b) EPROGUNAVAIL = syscall.Errno(0x4a) + EPROTO = syscall.Errno(0x5f) EPROTONOSUPPORT = syscall.Errno(0x2b) EPROTOTYPE = syscall.Errno(0x29) ERANGE = syscall.Errno(0x22) @@ -1570,7 +1801,7 @@ var errorList = [...]struct { {32, "EPIPE", "broken pipe"}, {33, "EDOM", "numerical argument out of domain"}, {34, "ERANGE", "result too large"}, - {35, "EWOULDBLOCK", "resource temporarily unavailable"}, + {35, "EAGAIN", "resource temporarily unavailable"}, {36, "EINPROGRESS", "operation now in progress"}, {37, "EALREADY", "operation already in progress"}, {38, "ENOTSOCK", "socket operation on non-socket"}, @@ -1626,7 +1857,11 @@ var errorList = [...]struct { {88, "ECANCELED", "operation canceled"}, {89, "EIDRM", "identifier removed"}, {90, "ENOMSG", "no message of desired type"}, - {91, "ELAST", "not supported"}, + {91, "ENOTSUP", "not supported"}, + {92, "EBADMSG", "bad message"}, + {93, "ENOTRECOVERABLE", "state not recoverable"}, + {94, "EOWNERDEAD", "previous owner died"}, + {95, "ELAST", "protocol error"}, } // Signal table @@ -1640,7 +1875,7 @@ var signalList = [...]struct { {3, "SIGQUIT", "quit"}, {4, "SIGILL", "illegal instruction"}, {5, "SIGTRAP", "trace/BPT trap"}, - {6, "SIGABRT", "abort trap"}, + {6, "SIGIOT", "abort trap"}, {7, "SIGEMT", "EMT trap"}, {8, "SIGFPE", "floating point exception"}, {9, "SIGKILL", "killed"}, @@ -1667,4 +1902,5 @@ var signalList = [...]struct { {30, "SIGUSR1", "user defined signal 1"}, {31, "SIGUSR2", "user defined signal 2"}, {32, "SIGTHR", "thread AST"}, + {28672, "SIGSTKSZ", "unknown signal"}, } diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm64.go index 90de7df..ae16fe7 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm64.go @@ -112,6 +112,12 @@ const ( BPF_FILDROP_CAPTURE = 0x1 BPF_FILDROP_DROP = 0x2 BPF_FILDROP_PASS = 0x0 + BPF_F_DIR_IN = 0x10 + BPF_F_DIR_MASK = 0x30 + BPF_F_DIR_OUT = 0x20 + BPF_F_DIR_SHIFT = 0x4 + BPF_F_FLOWID = 0x8 + BPF_F_PRI_MASK = 0x7 BPF_H = 0x8 BPF_IMM = 0x0 BPF_IND = 0x40 @@ -140,6 +146,7 @@ const ( BPF_OR = 0x40 BPF_RELEASE = 0x30bb6 BPF_RET = 0x6 + BPF_RND = 0xc0 BPF_RSH = 0x70 BPF_ST = 0x2 BPF_STX = 0x3 @@ -180,7 +187,65 @@ const ( CTL_KERN = 0x1 CTL_MAXNAME = 0xc CTL_NET = 0x4 + DIOCADDQUEUE = 0xc110445d + DIOCADDRULE = 0xcd604404 + DIOCADDSTATE = 0xc1084425 + DIOCCHANGERULE = 0xcd60441a + DIOCCLRIFFLAG = 0xc028445a + DIOCCLRSRCNODES = 0x20004455 + DIOCCLRSTATES = 0xc0e04412 + DIOCCLRSTATUS = 0xc0284416 + DIOCGETLIMIT = 0xc0084427 + DIOCGETQSTATS = 0xc1204460 + DIOCGETQUEUE = 0xc110445f + DIOCGETQUEUES = 0xc110445e + DIOCGETRULE = 0xcd604407 + DIOCGETRULES = 0xcd604406 + DIOCGETRULESET = 0xc444443b + DIOCGETRULESETS = 0xc444443a + DIOCGETSRCNODES = 0xc0104454 + DIOCGETSTATE = 0xc1084413 + DIOCGETSTATES = 0xc0104419 + DIOCGETSTATUS = 0xc1e84415 + DIOCGETSYNFLWATS = 0xc0084463 + DIOCGETTIMEOUT = 0xc008441e + DIOCIGETIFACES = 0xc0284457 + DIOCKILLSRCNODES = 0xc080445b + DIOCKILLSTATES = 0xc0e04429 + DIOCNATLOOK = 0xc0504417 + DIOCOSFPADD = 0xc088444f DIOCOSFPFLUSH = 0x2000444e + DIOCOSFPGET = 0xc0884450 + DIOCRADDADDRS = 0xc4504443 + DIOCRADDTABLES = 0xc450443d + DIOCRCLRADDRS = 0xc4504442 + DIOCRCLRASTATS = 0xc4504448 + DIOCRCLRTABLES = 0xc450443c + DIOCRCLRTSTATS = 0xc4504441 + DIOCRDELADDRS = 0xc4504444 + DIOCRDELTABLES = 0xc450443e + DIOCRGETADDRS = 0xc4504446 + DIOCRGETASTATS = 0xc4504447 + DIOCRGETTABLES = 0xc450443f + DIOCRGETTSTATS = 0xc4504440 + DIOCRINADEFINE = 0xc450444d + DIOCRSETADDRS = 0xc4504445 + DIOCRSETTFLAGS = 0xc450444a + DIOCRTSTADDRS = 0xc4504449 + DIOCSETDEBUG = 0xc0044418 + DIOCSETHOSTID = 0xc0044456 + DIOCSETIFFLAG = 0xc0284459 + DIOCSETLIMIT = 0xc0084428 + DIOCSETREASS = 0xc004445c + DIOCSETSTATUSIF = 0xc0284414 + DIOCSETSYNCOOKIES = 0xc0014462 + DIOCSETSYNFLWATS = 0xc0084461 + DIOCSETTIMEOUT = 0xc008441d + DIOCSTART = 0x20004401 + DIOCSTOP = 0x20004402 + DIOCXBEGIN = 0xc0104451 + DIOCXCOMMIT = 0xc0104452 + DIOCXROLLBACK = 0xc0104453 DLT_ARCNET = 0x7 DLT_ATM_RFC1483 = 0xb DLT_AX25 = 0x3 @@ -243,6 +308,8 @@ const ( EMUL_ENABLED = 0x1 EMUL_NATIVE = 0x2 ENDRUNDISC = 0x9 + ETH64_8021_RSVD_MASK = 0xfffffffffff0 + ETH64_8021_RSVD_PREFIX = 0x180c2000000 ETHERMIN = 0x2e ETHERMTU = 0x5dc ETHERTYPE_8023 = 0x4 @@ -295,6 +362,7 @@ const ( ETHERTYPE_DN = 0x6003 ETHERTYPE_DOGFIGHT = 0x1989 ETHERTYPE_DSMD = 0x8039 + ETHERTYPE_EAPOL = 0x888e ETHERTYPE_ECMA = 0x803 ETHERTYPE_ENCRYPT = 0x803d ETHERTYPE_ES = 0x805d @@ -326,6 +394,7 @@ const ( ETHERTYPE_LLDP = 0x88cc ETHERTYPE_LOGICRAFT = 0x8148 ETHERTYPE_LOOPBACK = 0x9000 + ETHERTYPE_MACSEC = 0x88e5 ETHERTYPE_MATRA = 0x807a ETHERTYPE_MAX = 0xffff ETHERTYPE_MERIT = 0x807c @@ -354,15 +423,16 @@ const ( ETHERTYPE_NCD = 0x8149 ETHERTYPE_NESTAR = 0x8006 ETHERTYPE_NETBEUI = 0x8191 + ETHERTYPE_NHRP = 0x2001 ETHERTYPE_NOVELL = 0x8138 ETHERTYPE_NS = 0x600 ETHERTYPE_NSAT = 0x601 ETHERTYPE_NSCOMPAT = 0x807 + ETHERTYPE_NSH = 0x984f ETHERTYPE_NTRAILER = 0x10 ETHERTYPE_OS9 = 0x7007 ETHERTYPE_OS9NET = 0x7009 ETHERTYPE_PACER = 0x80c6 - ETHERTYPE_PAE = 0x888e ETHERTYPE_PBB = 0x88e7 ETHERTYPE_PCS = 0x4242 ETHERTYPE_PLANNING = 0x8044 @@ -445,10 +515,11 @@ const ( ETHER_VLAN_ENCAP_LEN = 0x4 EVFILT_AIO = -0x3 EVFILT_DEVICE = -0x8 + EVFILT_EXCEPT = -0x9 EVFILT_PROC = -0x5 EVFILT_READ = -0x1 EVFILT_SIGNAL = -0x6 - EVFILT_SYSCOUNT = 0x8 + EVFILT_SYSCOUNT = 0x9 EVFILT_TIMER = -0x7 EVFILT_VNODE = -0x4 EVFILT_WRITE = -0x2 @@ -470,7 +541,7 @@ const ( EV_FLAG1 = 0x2000 EV_ONESHOT = 0x10 EV_RECEIPT = 0x40 - EV_SYSFLAGS = 0xf000 + EV_SYSFLAGS = 0xf800 EXTA = 0x4b00 EXTB = 0x9600 EXTPROC = 0x800 @@ -736,6 +807,7 @@ const ( IFT_VOICEOVERCABLE = 0xc6 IFT_VOICEOVERFRAMERELAY = 0x99 IFT_VOICEOVERIP = 0x68 + IFT_WIREGUARD = 0xfb IFT_X213 = 0x5d IFT_X25 = 0x5 IFT_X25DDN = 0x4 @@ -801,9 +873,11 @@ const ( IPPROTO_RAW = 0xff IPPROTO_ROUTING = 0x2b IPPROTO_RSVP = 0x2e + IPPROTO_SCTP = 0x84 IPPROTO_TCP = 0x6 IPPROTO_TP = 0x1d IPPROTO_UDP = 0x11 + IPPROTO_UDPLITE = 0x88 IPV6_AUTH_LEVEL = 0x35 IPV6_AUTOFLOWLABEL = 0x3b IPV6_CHECKSUM = 0x1a @@ -910,6 +984,9 @@ const ( IP_TTL = 0x4 ISIG = 0x80 ISTRIP = 0x20 + ITIMER_PROF = 0x2 + ITIMER_REAL = 0x0 + ITIMER_VIRTUAL = 0x1 IUCLC = 0x1000 IXANY = 0x800 IXOFF = 0x400 @@ -981,6 +1058,19 @@ const ( MNT_WAIT = 0x1 MNT_WANTRDWR = 0x2000000 MNT_WXALLOWED = 0x800 + MOUNT_AFS = "afs" + MOUNT_CD9660 = "cd9660" + MOUNT_EXT2FS = "ext2fs" + MOUNT_FFS = "ffs" + MOUNT_FUSEFS = "fuse" + MOUNT_MFS = "mfs" + MOUNT_MSDOS = "msdos" + MOUNT_NCPFS = "ncpfs" + MOUNT_NFS = "nfs" + MOUNT_NTFS = "ntfs" + MOUNT_TMPFS = "tmpfs" + MOUNT_UDF = "udf" + MOUNT_UFS = "ffs" MSG_BCAST = 0x100 MSG_CMSG_CLOEXEC = 0x800 MSG_CTRUNC = 0x20 @@ -993,6 +1083,7 @@ const ( MSG_PEEK = 0x2 MSG_TRUNC = 0x10 MSG_WAITALL = 0x40 + MSG_WAITFORONE = 0x1000 MS_ASYNC = 0x1 MS_INVALIDATE = 0x4 MS_SYNC = 0x2 @@ -1001,7 +1092,8 @@ const ( NET_RT_FLAGS = 0x2 NET_RT_IFLIST = 0x3 NET_RT_IFNAMES = 0x6 - NET_RT_MAXID = 0x7 + NET_RT_MAXID = 0x8 + NET_RT_SOURCE = 0x7 NET_RT_STATS = 0x4 NET_RT_TABLE = 0x5 NFDBITS = 0x20 @@ -1018,6 +1110,7 @@ const ( NOTE_FORK = 0x40000000 NOTE_LINK = 0x10 NOTE_LOWAT = 0x1 + NOTE_OOB = 0x4 NOTE_PCTRLMASK = 0xf0000000 NOTE_PDATAMASK = 0xfffff NOTE_RENAME = 0x20 @@ -1154,7 +1247,7 @@ const ( RTM_PROPOSAL = 0x13 RTM_REDIRECT = 0x6 RTM_RESOLVE = 0xb - RTM_RTTUNIT = 0xf4240 + RTM_SOURCE = 0x16 RTM_VERSION = 0x5 RTV_EXPIRE = 0x4 RTV_HOPCOUNT = 0x2 @@ -1172,6 +1265,9 @@ const ( RUSAGE_THREAD = 0x1 SCM_RIGHTS = 0x1 SCM_TIMESTAMP = 0x4 + SEEK_CUR = 0x1 + SEEK_END = 0x2 + SEEK_SET = 0x0 SHUT_RD = 0x0 SHUT_RDWR = 0x2 SHUT_WR = 0x1 @@ -1188,30 +1284,30 @@ const ( SIOCBRDGDELS = 0x80606942 SIOCBRDGFLUSH = 0x80606948 SIOCBRDGFRL = 0x808c694e - SIOCBRDGGCACHE = 0xc0186941 - SIOCBRDGGFD = 0xc0186952 - SIOCBRDGGHT = 0xc0186951 + SIOCBRDGGCACHE = 0xc0146941 + SIOCBRDGGFD = 0xc0146952 + SIOCBRDGGHT = 0xc0146951 SIOCBRDGGIFFLGS = 0xc060693e - SIOCBRDGGMA = 0xc0186953 + SIOCBRDGGMA = 0xc0146953 SIOCBRDGGPARAM = 0xc0406958 - SIOCBRDGGPRI = 0xc0186950 + SIOCBRDGGPRI = 0xc0146950 SIOCBRDGGRL = 0xc030694f - SIOCBRDGGTO = 0xc0186946 + SIOCBRDGGTO = 0xc0146946 SIOCBRDGIFS = 0xc0606942 SIOCBRDGRTS = 0xc0206943 SIOCBRDGSADDR = 0xc1286944 - SIOCBRDGSCACHE = 0x80186940 - SIOCBRDGSFD = 0x80186952 - SIOCBRDGSHT = 0x80186951 + SIOCBRDGSCACHE = 0x80146940 + SIOCBRDGSFD = 0x80146952 + SIOCBRDGSHT = 0x80146951 SIOCBRDGSIFCOST = 0x80606955 SIOCBRDGSIFFLGS = 0x8060693f SIOCBRDGSIFPRIO = 0x80606954 SIOCBRDGSIFPROT = 0x8060694a - SIOCBRDGSMA = 0x80186953 - SIOCBRDGSPRI = 0x80186950 - SIOCBRDGSPROTO = 0x8018695a - SIOCBRDGSTO = 0x80186945 - SIOCBRDGSTXHC = 0x80186959 + SIOCBRDGSMA = 0x80146953 + SIOCBRDGSPRI = 0x80146950 + SIOCBRDGSPROTO = 0x8014695a + SIOCBRDGSTO = 0x80146945 + SIOCBRDGSTXHC = 0x80146959 SIOCDELLABEL = 0x80206997 SIOCDELMULTI = 0x80206932 SIOCDIFADDR = 0x80206919 @@ -1264,6 +1360,7 @@ const ( SIOCGPWE3CTRLWORD = 0xc02069dc SIOCGPWE3FAT = 0xc02069dd SIOCGPWE3NEIGHBOR = 0xc21869de + SIOCGRXHPRIO = 0xc02069db SIOCGSPPPPARAMS = 0xc0206994 SIOCGTXHPRIO = 0xc02069c6 SIOCGUMBINFO = 0xc02069be @@ -1310,17 +1407,13 @@ const ( SIOCSPWE3CTRLWORD = 0x802069dc SIOCSPWE3FAT = 0x802069dd SIOCSPWE3NEIGHBOR = 0x821869de + SIOCSRXHPRIO = 0x802069db SIOCSSPPPPARAMS = 0x80206993 SIOCSTXHPRIO = 0x802069c5 SIOCSUMBPARAM = 0x802069bf SIOCSVH = 0xc02069f5 SIOCSVNETFLOWID = 0x802069c3 SIOCSVNETID = 0x802069a6 - SIOCSWGDPID = 0xc018695b - SIOCSWGMAXFLOW = 0xc0186960 - SIOCSWGMAXGROUP = 0xc018695d - SIOCSWSDPID = 0x8018695c - SIOCSWSPORTNO = 0xc060695f SOCK_CLOEXEC = 0x8000 SOCK_DGRAM = 0x2 SOCK_DNS = 0x1000 @@ -1335,6 +1428,7 @@ const ( SO_BINDANY = 0x1000 SO_BROADCAST = 0x20 SO_DEBUG = 0x1 + SO_DOMAIN = 0x1024 SO_DONTROUTE = 0x10 SO_ERROR = 0x1007 SO_KEEPALIVE = 0x8 @@ -1342,6 +1436,7 @@ const ( SO_NETPROC = 0x1020 SO_OOBINLINE = 0x100 SO_PEERCRED = 0x1022 + SO_PROTOCOL = 0x1025 SO_RCVBUF = 0x1002 SO_RCVLOWAT = 0x1004 SO_RCVTIMEO = 0x1006 @@ -1391,7 +1486,18 @@ const ( TCOFLUSH = 0x2 TCOOFF = 0x1 TCOON = 0x2 - TCP_MAXBURST = 0x4 + TCPOPT_EOL = 0x0 + TCPOPT_MAXSEG = 0x2 + TCPOPT_NOP = 0x1 + TCPOPT_SACK = 0x5 + TCPOPT_SACK_HDR = 0x1010500 + TCPOPT_SACK_PERMITTED = 0x4 + TCPOPT_SACK_PERMIT_HDR = 0x1010402 + TCPOPT_SIGNATURE = 0x13 + TCPOPT_TIMESTAMP = 0x8 + TCPOPT_TSTAMP_HDR = 0x101080a + TCPOPT_WINDOW = 0x3 + TCP_INFO = 0x9 TCP_MAXSEG = 0x2 TCP_MAXWIN = 0xffff TCP_MAX_SACK = 0x3 @@ -1400,6 +1506,7 @@ const ( TCP_MSS = 0x200 TCP_NODELAY = 0x1 TCP_NOPUSH = 0x10 + TCP_SACKHOLE_LIMIT = 0x80 TCP_SACK_ENABLE = 0x8 TCSAFLUSH = 0x2 TIMER_ABSTIME = 0x1 @@ -1768,7 +1875,7 @@ var signalList = [...]struct { {3, "SIGQUIT", "quit"}, {4, "SIGILL", "illegal instruction"}, {5, "SIGTRAP", "trace/BPT trap"}, - {6, "SIGABRT", "abort trap"}, + {6, "SIGIOT", "abort trap"}, {7, "SIGEMT", "EMT trap"}, {8, "SIGFPE", "floating point exception"}, {9, "SIGKILL", "killed"}, @@ -1795,4 +1902,5 @@ var signalList = [...]struct { {30, "SIGUSR1", "user defined signal 1"}, {31, "SIGUSR2", "user defined signal 2"}, {32, "SIGTHR", "thread AST"}, + {28672, "SIGSTKSZ", "unknown signal"}, } diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_mips64.go index f1154ff..03d90fe 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_mips64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_mips64.go @@ -112,6 +112,12 @@ const ( BPF_FILDROP_CAPTURE = 0x1 BPF_FILDROP_DROP = 0x2 BPF_FILDROP_PASS = 0x0 + BPF_F_DIR_IN = 0x10 + BPF_F_DIR_MASK = 0x30 + BPF_F_DIR_OUT = 0x20 + BPF_F_DIR_SHIFT = 0x4 + BPF_F_FLOWID = 0x8 + BPF_F_PRI_MASK = 0x7 BPF_H = 0x8 BPF_IMM = 0x0 BPF_IND = 0x40 @@ -140,6 +146,7 @@ const ( BPF_OR = 0x40 BPF_RELEASE = 0x30bb6 BPF_RET = 0x6 + BPF_RND = 0xc0 BPF_RSH = 0x70 BPF_ST = 0x2 BPF_STX = 0x3 @@ -301,6 +308,8 @@ const ( EMUL_ENABLED = 0x1 EMUL_NATIVE = 0x2 ENDRUNDISC = 0x9 + ETH64_8021_RSVD_MASK = 0xfffffffffff0 + ETH64_8021_RSVD_PREFIX = 0x180c2000000 ETHERMIN = 0x2e ETHERMTU = 0x5dc ETHERTYPE_8023 = 0x4 @@ -353,6 +362,7 @@ const ( ETHERTYPE_DN = 0x6003 ETHERTYPE_DOGFIGHT = 0x1989 ETHERTYPE_DSMD = 0x8039 + ETHERTYPE_EAPOL = 0x888e ETHERTYPE_ECMA = 0x803 ETHERTYPE_ENCRYPT = 0x803d ETHERTYPE_ES = 0x805d @@ -413,15 +423,16 @@ const ( ETHERTYPE_NCD = 0x8149 ETHERTYPE_NESTAR = 0x8006 ETHERTYPE_NETBEUI = 0x8191 + ETHERTYPE_NHRP = 0x2001 ETHERTYPE_NOVELL = 0x8138 ETHERTYPE_NS = 0x600 ETHERTYPE_NSAT = 0x601 ETHERTYPE_NSCOMPAT = 0x807 + ETHERTYPE_NSH = 0x984f ETHERTYPE_NTRAILER = 0x10 ETHERTYPE_OS9 = 0x7007 ETHERTYPE_OS9NET = 0x7009 ETHERTYPE_PACER = 0x80c6 - ETHERTYPE_PAE = 0x888e ETHERTYPE_PBB = 0x88e7 ETHERTYPE_PCS = 0x4242 ETHERTYPE_PLANNING = 0x8044 @@ -504,10 +515,11 @@ const ( ETHER_VLAN_ENCAP_LEN = 0x4 EVFILT_AIO = -0x3 EVFILT_DEVICE = -0x8 + EVFILT_EXCEPT = -0x9 EVFILT_PROC = -0x5 EVFILT_READ = -0x1 EVFILT_SIGNAL = -0x6 - EVFILT_SYSCOUNT = 0x8 + EVFILT_SYSCOUNT = 0x9 EVFILT_TIMER = -0x7 EVFILT_VNODE = -0x4 EVFILT_WRITE = -0x2 @@ -529,7 +541,7 @@ const ( EV_FLAG1 = 0x2000 EV_ONESHOT = 0x10 EV_RECEIPT = 0x40 - EV_SYSFLAGS = 0xf000 + EV_SYSFLAGS = 0xf800 EXTA = 0x4b00 EXTB = 0x9600 EXTPROC = 0x800 @@ -795,6 +807,7 @@ const ( IFT_VOICEOVERCABLE = 0xc6 IFT_VOICEOVERFRAMERELAY = 0x99 IFT_VOICEOVERIP = 0x68 + IFT_WIREGUARD = 0xfb IFT_X213 = 0x5d IFT_X25 = 0x5 IFT_X25DDN = 0x4 @@ -860,6 +873,7 @@ const ( IPPROTO_RAW = 0xff IPPROTO_ROUTING = 0x2b IPPROTO_RSVP = 0x2e + IPPROTO_SCTP = 0x84 IPPROTO_TCP = 0x6 IPPROTO_TP = 0x1d IPPROTO_UDP = 0x11 @@ -970,6 +984,9 @@ const ( IP_TTL = 0x4 ISIG = 0x80 ISTRIP = 0x20 + ITIMER_PROF = 0x2 + ITIMER_REAL = 0x0 + ITIMER_VIRTUAL = 0x1 IUCLC = 0x1000 IXANY = 0x800 IXOFF = 0x400 @@ -1041,6 +1058,19 @@ const ( MNT_WAIT = 0x1 MNT_WANTRDWR = 0x2000000 MNT_WXALLOWED = 0x800 + MOUNT_AFS = "afs" + MOUNT_CD9660 = "cd9660" + MOUNT_EXT2FS = "ext2fs" + MOUNT_FFS = "ffs" + MOUNT_FUSEFS = "fuse" + MOUNT_MFS = "mfs" + MOUNT_MSDOS = "msdos" + MOUNT_NCPFS = "ncpfs" + MOUNT_NFS = "nfs" + MOUNT_NTFS = "ntfs" + MOUNT_TMPFS = "tmpfs" + MOUNT_UDF = "udf" + MOUNT_UFS = "ffs" MSG_BCAST = 0x100 MSG_CMSG_CLOEXEC = 0x800 MSG_CTRUNC = 0x20 @@ -1053,6 +1083,7 @@ const ( MSG_PEEK = 0x2 MSG_TRUNC = 0x10 MSG_WAITALL = 0x40 + MSG_WAITFORONE = 0x1000 MS_ASYNC = 0x1 MS_INVALIDATE = 0x4 MS_SYNC = 0x2 @@ -1061,7 +1092,8 @@ const ( NET_RT_FLAGS = 0x2 NET_RT_IFLIST = 0x3 NET_RT_IFNAMES = 0x6 - NET_RT_MAXID = 0x7 + NET_RT_MAXID = 0x8 + NET_RT_SOURCE = 0x7 NET_RT_STATS = 0x4 NET_RT_TABLE = 0x5 NFDBITS = 0x20 @@ -1078,6 +1110,7 @@ const ( NOTE_FORK = 0x40000000 NOTE_LINK = 0x10 NOTE_LOWAT = 0x1 + NOTE_OOB = 0x4 NOTE_PCTRLMASK = 0xf0000000 NOTE_PDATAMASK = 0xfffff NOTE_RENAME = 0x20 @@ -1214,7 +1247,7 @@ const ( RTM_PROPOSAL = 0x13 RTM_REDIRECT = 0x6 RTM_RESOLVE = 0xb - RTM_RTTUNIT = 0xf4240 + RTM_SOURCE = 0x16 RTM_VERSION = 0x5 RTV_EXPIRE = 0x4 RTV_HOPCOUNT = 0x2 @@ -1232,6 +1265,9 @@ const ( RUSAGE_THREAD = 0x1 SCM_RIGHTS = 0x1 SCM_TIMESTAMP = 0x4 + SEEK_CUR = 0x1 + SEEK_END = 0x2 + SEEK_SET = 0x0 SHUT_RD = 0x0 SHUT_RDWR = 0x2 SHUT_WR = 0x1 @@ -1248,30 +1284,30 @@ const ( SIOCBRDGDELS = 0x80606942 SIOCBRDGFLUSH = 0x80606948 SIOCBRDGFRL = 0x808c694e - SIOCBRDGGCACHE = 0xc0186941 - SIOCBRDGGFD = 0xc0186952 - SIOCBRDGGHT = 0xc0186951 + SIOCBRDGGCACHE = 0xc0146941 + SIOCBRDGGFD = 0xc0146952 + SIOCBRDGGHT = 0xc0146951 SIOCBRDGGIFFLGS = 0xc060693e - SIOCBRDGGMA = 0xc0186953 + SIOCBRDGGMA = 0xc0146953 SIOCBRDGGPARAM = 0xc0406958 - SIOCBRDGGPRI = 0xc0186950 + SIOCBRDGGPRI = 0xc0146950 SIOCBRDGGRL = 0xc030694f - SIOCBRDGGTO = 0xc0186946 + SIOCBRDGGTO = 0xc0146946 SIOCBRDGIFS = 0xc0606942 SIOCBRDGRTS = 0xc0206943 SIOCBRDGSADDR = 0xc1286944 - SIOCBRDGSCACHE = 0x80186940 - SIOCBRDGSFD = 0x80186952 - SIOCBRDGSHT = 0x80186951 + SIOCBRDGSCACHE = 0x80146940 + SIOCBRDGSFD = 0x80146952 + SIOCBRDGSHT = 0x80146951 SIOCBRDGSIFCOST = 0x80606955 SIOCBRDGSIFFLGS = 0x8060693f SIOCBRDGSIFPRIO = 0x80606954 SIOCBRDGSIFPROT = 0x8060694a - SIOCBRDGSMA = 0x80186953 - SIOCBRDGSPRI = 0x80186950 - SIOCBRDGSPROTO = 0x8018695a - SIOCBRDGSTO = 0x80186945 - SIOCBRDGSTXHC = 0x80186959 + SIOCBRDGSMA = 0x80146953 + SIOCBRDGSPRI = 0x80146950 + SIOCBRDGSPROTO = 0x8014695a + SIOCBRDGSTO = 0x80146945 + SIOCBRDGSTXHC = 0x80146959 SIOCDELLABEL = 0x80206997 SIOCDELMULTI = 0x80206932 SIOCDIFADDR = 0x80206919 @@ -1378,11 +1414,6 @@ const ( SIOCSVH = 0xc02069f5 SIOCSVNETFLOWID = 0x802069c3 SIOCSVNETID = 0x802069a6 - SIOCSWGDPID = 0xc018695b - SIOCSWGMAXFLOW = 0xc0186960 - SIOCSWGMAXGROUP = 0xc018695d - SIOCSWSDPID = 0x8018695c - SIOCSWSPORTNO = 0xc060695f SOCK_CLOEXEC = 0x8000 SOCK_DGRAM = 0x2 SOCK_DNS = 0x1000 @@ -1455,7 +1486,18 @@ const ( TCOFLUSH = 0x2 TCOOFF = 0x1 TCOON = 0x2 - TCP_MAXBURST = 0x4 + TCPOPT_EOL = 0x0 + TCPOPT_MAXSEG = 0x2 + TCPOPT_NOP = 0x1 + TCPOPT_SACK = 0x5 + TCPOPT_SACK_HDR = 0x1010500 + TCPOPT_SACK_PERMITTED = 0x4 + TCPOPT_SACK_PERMIT_HDR = 0x1010402 + TCPOPT_SIGNATURE = 0x13 + TCPOPT_TIMESTAMP = 0x8 + TCPOPT_TSTAMP_HDR = 0x101080a + TCPOPT_WINDOW = 0x3 + TCP_INFO = 0x9 TCP_MAXSEG = 0x2 TCP_MAXWIN = 0xffff TCP_MAX_SACK = 0x3 @@ -1833,7 +1875,7 @@ var signalList = [...]struct { {3, "SIGQUIT", "quit"}, {4, "SIGILL", "illegal instruction"}, {5, "SIGTRAP", "trace/BPT trap"}, - {6, "SIGABRT", "abort trap"}, + {6, "SIGIOT", "abort trap"}, {7, "SIGEMT", "EMT trap"}, {8, "SIGFPE", "floating point exception"}, {9, "SIGKILL", "killed"}, @@ -1860,4 +1902,5 @@ var signalList = [...]struct { {30, "SIGUSR1", "user defined signal 1"}, {31, "SIGUSR2", "user defined signal 2"}, {32, "SIGTHR", "thread AST"}, + {81920, "SIGSTKSZ", "unknown signal"}, } diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_ppc64.go new file mode 100644 index 0000000..8e2c51b --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_ppc64.go @@ -0,0 +1,1905 @@ +// mkerrors.sh -m64 +// Code generated by the command above; see README.md. DO NOT EDIT. + +//go:build ppc64 && openbsd +// +build ppc64,openbsd + +// Code generated by cmd/cgo -godefs; DO NOT EDIT. +// cgo -godefs -- -m64 _const.go + +package unix + +import "syscall" + +const ( + AF_APPLETALK = 0x10 + AF_BLUETOOTH = 0x20 + AF_CCITT = 0xa + AF_CHAOS = 0x5 + AF_CNT = 0x15 + AF_COIP = 0x14 + AF_DATAKIT = 0x9 + AF_DECnet = 0xc + AF_DLI = 0xd + AF_E164 = 0x1a + AF_ECMA = 0x8 + AF_ENCAP = 0x1c + AF_HYLINK = 0xf + AF_IMPLINK = 0x3 + AF_INET = 0x2 + AF_INET6 = 0x18 + AF_IPX = 0x17 + AF_ISDN = 0x1a + AF_ISO = 0x7 + AF_KEY = 0x1e + AF_LAT = 0xe + AF_LINK = 0x12 + AF_LOCAL = 0x1 + AF_MAX = 0x24 + AF_MPLS = 0x21 + AF_NATM = 0x1b + AF_NS = 0x6 + AF_OSI = 0x7 + AF_PUP = 0x4 + AF_ROUTE = 0x11 + AF_SIP = 0x1d + AF_SNA = 0xb + AF_UNIX = 0x1 + AF_UNSPEC = 0x0 + ALTWERASE = 0x200 + ARPHRD_ETHER = 0x1 + ARPHRD_FRELAY = 0xf + ARPHRD_IEEE1394 = 0x18 + ARPHRD_IEEE802 = 0x6 + B0 = 0x0 + B110 = 0x6e + B115200 = 0x1c200 + B1200 = 0x4b0 + B134 = 0x86 + B14400 = 0x3840 + B150 = 0x96 + B1800 = 0x708 + B19200 = 0x4b00 + B200 = 0xc8 + B230400 = 0x38400 + B2400 = 0x960 + B28800 = 0x7080 + B300 = 0x12c + B38400 = 0x9600 + B4800 = 0x12c0 + B50 = 0x32 + B57600 = 0xe100 + B600 = 0x258 + B7200 = 0x1c20 + B75 = 0x4b + B76800 = 0x12c00 + B9600 = 0x2580 + BIOCFLUSH = 0x20004268 + BIOCGBLEN = 0x40044266 + BIOCGDIRFILT = 0x4004427c + BIOCGDLT = 0x4004426a + BIOCGDLTLIST = 0xc010427b + BIOCGETIF = 0x4020426b + BIOCGFILDROP = 0x40044278 + BIOCGHDRCMPLT = 0x40044274 + BIOCGRSIG = 0x40044273 + BIOCGRTIMEOUT = 0x4010426e + BIOCGSTATS = 0x4008426f + BIOCIMMEDIATE = 0x80044270 + BIOCLOCK = 0x20004276 + BIOCPROMISC = 0x20004269 + BIOCSBLEN = 0xc0044266 + BIOCSDIRFILT = 0x8004427d + BIOCSDLT = 0x8004427a + BIOCSETF = 0x80104267 + BIOCSETIF = 0x8020426c + BIOCSETWF = 0x80104277 + BIOCSFILDROP = 0x80044279 + BIOCSHDRCMPLT = 0x80044275 + BIOCSRSIG = 0x80044272 + BIOCSRTIMEOUT = 0x8010426d + BIOCVERSION = 0x40044271 + BPF_A = 0x10 + BPF_ABS = 0x20 + BPF_ADD = 0x0 + BPF_ALIGNMENT = 0x4 + BPF_ALU = 0x4 + BPF_AND = 0x50 + BPF_B = 0x10 + BPF_DIRECTION_IN = 0x1 + BPF_DIRECTION_OUT = 0x2 + BPF_DIV = 0x30 + BPF_FILDROP_CAPTURE = 0x1 + BPF_FILDROP_DROP = 0x2 + BPF_FILDROP_PASS = 0x0 + BPF_F_DIR_IN = 0x10 + BPF_F_DIR_MASK = 0x30 + BPF_F_DIR_OUT = 0x20 + BPF_F_DIR_SHIFT = 0x4 + BPF_F_FLOWID = 0x8 + BPF_F_PRI_MASK = 0x7 + BPF_H = 0x8 + BPF_IMM = 0x0 + BPF_IND = 0x40 + BPF_JA = 0x0 + BPF_JEQ = 0x10 + BPF_JGE = 0x30 + BPF_JGT = 0x20 + BPF_JMP = 0x5 + BPF_JSET = 0x40 + BPF_K = 0x0 + BPF_LD = 0x0 + BPF_LDX = 0x1 + BPF_LEN = 0x80 + BPF_LSH = 0x60 + BPF_MAJOR_VERSION = 0x1 + BPF_MAXBUFSIZE = 0x200000 + BPF_MAXINSNS = 0x200 + BPF_MEM = 0x60 + BPF_MEMWORDS = 0x10 + BPF_MINBUFSIZE = 0x20 + BPF_MINOR_VERSION = 0x1 + BPF_MISC = 0x7 + BPF_MSH = 0xa0 + BPF_MUL = 0x20 + BPF_NEG = 0x80 + BPF_OR = 0x40 + BPF_RELEASE = 0x30bb6 + BPF_RET = 0x6 + BPF_RND = 0xc0 + BPF_RSH = 0x70 + BPF_ST = 0x2 + BPF_STX = 0x3 + BPF_SUB = 0x10 + BPF_TAX = 0x0 + BPF_TXA = 0x80 + BPF_W = 0x0 + BPF_X = 0x8 + BRKINT = 0x2 + CFLUSH = 0xf + CLOCAL = 0x8000 + CLOCK_BOOTTIME = 0x6 + CLOCK_MONOTONIC = 0x3 + CLOCK_PROCESS_CPUTIME_ID = 0x2 + CLOCK_REALTIME = 0x0 + CLOCK_THREAD_CPUTIME_ID = 0x4 + CLOCK_UPTIME = 0x5 + CPUSTATES = 0x6 + CP_IDLE = 0x5 + CP_INTR = 0x4 + CP_NICE = 0x1 + CP_SPIN = 0x3 + CP_SYS = 0x2 + CP_USER = 0x0 + CREAD = 0x800 + CRTSCTS = 0x10000 + CS5 = 0x0 + CS6 = 0x100 + CS7 = 0x200 + CS8 = 0x300 + CSIZE = 0x300 + CSTART = 0x11 + CSTATUS = 0xff + CSTOP = 0x13 + CSTOPB = 0x400 + CSUSP = 0x1a + CTL_HW = 0x6 + CTL_KERN = 0x1 + CTL_MAXNAME = 0xc + CTL_NET = 0x4 + DIOCADDQUEUE = 0xc110445d + DIOCADDRULE = 0xcd604404 + DIOCADDSTATE = 0xc1084425 + DIOCCHANGERULE = 0xcd60441a + DIOCCLRIFFLAG = 0xc028445a + DIOCCLRSRCNODES = 0x20004455 + DIOCCLRSTATES = 0xc0e04412 + DIOCCLRSTATUS = 0xc0284416 + DIOCGETLIMIT = 0xc0084427 + DIOCGETQSTATS = 0xc1204460 + DIOCGETQUEUE = 0xc110445f + DIOCGETQUEUES = 0xc110445e + DIOCGETRULE = 0xcd604407 + DIOCGETRULES = 0xcd604406 + DIOCGETRULESET = 0xc444443b + DIOCGETRULESETS = 0xc444443a + DIOCGETSRCNODES = 0xc0104454 + DIOCGETSTATE = 0xc1084413 + DIOCGETSTATES = 0xc0104419 + DIOCGETSTATUS = 0xc1e84415 + DIOCGETSYNFLWATS = 0xc0084463 + DIOCGETTIMEOUT = 0xc008441e + DIOCIGETIFACES = 0xc0284457 + DIOCKILLSRCNODES = 0xc080445b + DIOCKILLSTATES = 0xc0e04429 + DIOCNATLOOK = 0xc0504417 + DIOCOSFPADD = 0xc088444f + DIOCOSFPFLUSH = 0x2000444e + DIOCOSFPGET = 0xc0884450 + DIOCRADDADDRS = 0xc4504443 + DIOCRADDTABLES = 0xc450443d + DIOCRCLRADDRS = 0xc4504442 + DIOCRCLRASTATS = 0xc4504448 + DIOCRCLRTABLES = 0xc450443c + DIOCRCLRTSTATS = 0xc4504441 + DIOCRDELADDRS = 0xc4504444 + DIOCRDELTABLES = 0xc450443e + DIOCRGETADDRS = 0xc4504446 + DIOCRGETASTATS = 0xc4504447 + DIOCRGETTABLES = 0xc450443f + DIOCRGETTSTATS = 0xc4504440 + DIOCRINADEFINE = 0xc450444d + DIOCRSETADDRS = 0xc4504445 + DIOCRSETTFLAGS = 0xc450444a + DIOCRTSTADDRS = 0xc4504449 + DIOCSETDEBUG = 0xc0044418 + DIOCSETHOSTID = 0xc0044456 + DIOCSETIFFLAG = 0xc0284459 + DIOCSETLIMIT = 0xc0084428 + DIOCSETREASS = 0xc004445c + DIOCSETSTATUSIF = 0xc0284414 + DIOCSETSYNCOOKIES = 0xc0014462 + DIOCSETSYNFLWATS = 0xc0084461 + DIOCSETTIMEOUT = 0xc008441d + DIOCSTART = 0x20004401 + DIOCSTOP = 0x20004402 + DIOCXBEGIN = 0xc0104451 + DIOCXCOMMIT = 0xc0104452 + DIOCXROLLBACK = 0xc0104453 + DLT_ARCNET = 0x7 + DLT_ATM_RFC1483 = 0xb + DLT_AX25 = 0x3 + DLT_CHAOS = 0x5 + DLT_C_HDLC = 0x68 + DLT_EN10MB = 0x1 + DLT_EN3MB = 0x2 + DLT_ENC = 0xd + DLT_FDDI = 0xa + DLT_IEEE802 = 0x6 + DLT_IEEE802_11 = 0x69 + DLT_IEEE802_11_RADIO = 0x7f + DLT_LOOP = 0xc + DLT_MPLS = 0xdb + DLT_NULL = 0x0 + DLT_OPENFLOW = 0x10b + DLT_PFLOG = 0x75 + DLT_PFSYNC = 0x12 + DLT_PPP = 0x9 + DLT_PPP_BSDOS = 0x10 + DLT_PPP_ETHER = 0x33 + DLT_PPP_SERIAL = 0x32 + DLT_PRONET = 0x4 + DLT_RAW = 0xe + DLT_SLIP = 0x8 + DLT_SLIP_BSDOS = 0xf + DLT_USBPCAP = 0xf9 + DLT_USER0 = 0x93 + DLT_USER1 = 0x94 + DLT_USER10 = 0x9d + DLT_USER11 = 0x9e + DLT_USER12 = 0x9f + DLT_USER13 = 0xa0 + DLT_USER14 = 0xa1 + DLT_USER15 = 0xa2 + DLT_USER2 = 0x95 + DLT_USER3 = 0x96 + DLT_USER4 = 0x97 + DLT_USER5 = 0x98 + DLT_USER6 = 0x99 + DLT_USER7 = 0x9a + DLT_USER8 = 0x9b + DLT_USER9 = 0x9c + DT_BLK = 0x6 + DT_CHR = 0x2 + DT_DIR = 0x4 + DT_FIFO = 0x1 + DT_LNK = 0xa + DT_REG = 0x8 + DT_SOCK = 0xc + DT_UNKNOWN = 0x0 + ECHO = 0x8 + ECHOCTL = 0x40 + ECHOE = 0x2 + ECHOK = 0x4 + ECHOKE = 0x1 + ECHONL = 0x10 + ECHOPRT = 0x20 + EMT_TAGOVF = 0x1 + EMUL_ENABLED = 0x1 + EMUL_NATIVE = 0x2 + ENDRUNDISC = 0x9 + ETH64_8021_RSVD_MASK = 0xfffffffffff0 + ETH64_8021_RSVD_PREFIX = 0x180c2000000 + ETHERMIN = 0x2e + ETHERMTU = 0x5dc + ETHERTYPE_8023 = 0x4 + ETHERTYPE_AARP = 0x80f3 + ETHERTYPE_ACCTON = 0x8390 + ETHERTYPE_AEONIC = 0x8036 + ETHERTYPE_ALPHA = 0x814a + ETHERTYPE_AMBER = 0x6008 + ETHERTYPE_AMOEBA = 0x8145 + ETHERTYPE_AOE = 0x88a2 + ETHERTYPE_APOLLO = 0x80f7 + ETHERTYPE_APOLLODOMAIN = 0x8019 + ETHERTYPE_APPLETALK = 0x809b + ETHERTYPE_APPLITEK = 0x80c7 + ETHERTYPE_ARGONAUT = 0x803a + ETHERTYPE_ARP = 0x806 + ETHERTYPE_AT = 0x809b + ETHERTYPE_ATALK = 0x809b + ETHERTYPE_ATOMIC = 0x86df + ETHERTYPE_ATT = 0x8069 + ETHERTYPE_ATTSTANFORD = 0x8008 + ETHERTYPE_AUTOPHON = 0x806a + ETHERTYPE_AXIS = 0x8856 + ETHERTYPE_BCLOOP = 0x9003 + ETHERTYPE_BOFL = 0x8102 + ETHERTYPE_CABLETRON = 0x7034 + ETHERTYPE_CHAOS = 0x804 + ETHERTYPE_COMDESIGN = 0x806c + ETHERTYPE_COMPUGRAPHIC = 0x806d + ETHERTYPE_COUNTERPOINT = 0x8062 + ETHERTYPE_CRONUS = 0x8004 + ETHERTYPE_CRONUSVLN = 0x8003 + ETHERTYPE_DCA = 0x1234 + ETHERTYPE_DDE = 0x807b + ETHERTYPE_DEBNI = 0xaaaa + ETHERTYPE_DECAM = 0x8048 + ETHERTYPE_DECCUST = 0x6006 + ETHERTYPE_DECDIAG = 0x6005 + ETHERTYPE_DECDNS = 0x803c + ETHERTYPE_DECDTS = 0x803e + ETHERTYPE_DECEXPER = 0x6000 + ETHERTYPE_DECLAST = 0x8041 + ETHERTYPE_DECLTM = 0x803f + ETHERTYPE_DECMUMPS = 0x6009 + ETHERTYPE_DECNETBIOS = 0x8040 + ETHERTYPE_DELTACON = 0x86de + ETHERTYPE_DIDDLE = 0x4321 + ETHERTYPE_DLOG1 = 0x660 + ETHERTYPE_DLOG2 = 0x661 + ETHERTYPE_DN = 0x6003 + ETHERTYPE_DOGFIGHT = 0x1989 + ETHERTYPE_DSMD = 0x8039 + ETHERTYPE_EAPOL = 0x888e + ETHERTYPE_ECMA = 0x803 + ETHERTYPE_ENCRYPT = 0x803d + ETHERTYPE_ES = 0x805d + ETHERTYPE_EXCELAN = 0x8010 + ETHERTYPE_EXPERDATA = 0x8049 + ETHERTYPE_FLIP = 0x8146 + ETHERTYPE_FLOWCONTROL = 0x8808 + ETHERTYPE_FRARP = 0x808 + ETHERTYPE_GENDYN = 0x8068 + ETHERTYPE_HAYES = 0x8130 + ETHERTYPE_HIPPI_FP = 0x8180 + ETHERTYPE_HITACHI = 0x8820 + ETHERTYPE_HP = 0x8005 + ETHERTYPE_IEEEPUP = 0xa00 + ETHERTYPE_IEEEPUPAT = 0xa01 + ETHERTYPE_IMLBL = 0x4c42 + ETHERTYPE_IMLBLDIAG = 0x424c + ETHERTYPE_IP = 0x800 + ETHERTYPE_IPAS = 0x876c + ETHERTYPE_IPV6 = 0x86dd + ETHERTYPE_IPX = 0x8137 + ETHERTYPE_IPXNEW = 0x8037 + ETHERTYPE_KALPANA = 0x8582 + ETHERTYPE_LANBRIDGE = 0x8038 + ETHERTYPE_LANPROBE = 0x8888 + ETHERTYPE_LAT = 0x6004 + ETHERTYPE_LBACK = 0x9000 + ETHERTYPE_LITTLE = 0x8060 + ETHERTYPE_LLDP = 0x88cc + ETHERTYPE_LOGICRAFT = 0x8148 + ETHERTYPE_LOOPBACK = 0x9000 + ETHERTYPE_MACSEC = 0x88e5 + ETHERTYPE_MATRA = 0x807a + ETHERTYPE_MAX = 0xffff + ETHERTYPE_MERIT = 0x807c + ETHERTYPE_MICP = 0x873a + ETHERTYPE_MOPDL = 0x6001 + ETHERTYPE_MOPRC = 0x6002 + ETHERTYPE_MOTOROLA = 0x818d + ETHERTYPE_MPLS = 0x8847 + ETHERTYPE_MPLS_MCAST = 0x8848 + ETHERTYPE_MUMPS = 0x813f + ETHERTYPE_NBPCC = 0x3c04 + ETHERTYPE_NBPCLAIM = 0x3c09 + ETHERTYPE_NBPCLREQ = 0x3c05 + ETHERTYPE_NBPCLRSP = 0x3c06 + ETHERTYPE_NBPCREQ = 0x3c02 + ETHERTYPE_NBPCRSP = 0x3c03 + ETHERTYPE_NBPDG = 0x3c07 + ETHERTYPE_NBPDGB = 0x3c08 + ETHERTYPE_NBPDLTE = 0x3c0a + ETHERTYPE_NBPRAR = 0x3c0c + ETHERTYPE_NBPRAS = 0x3c0b + ETHERTYPE_NBPRST = 0x3c0d + ETHERTYPE_NBPSCD = 0x3c01 + ETHERTYPE_NBPVCD = 0x3c00 + ETHERTYPE_NBS = 0x802 + ETHERTYPE_NCD = 0x8149 + ETHERTYPE_NESTAR = 0x8006 + ETHERTYPE_NETBEUI = 0x8191 + ETHERTYPE_NHRP = 0x2001 + ETHERTYPE_NOVELL = 0x8138 + ETHERTYPE_NS = 0x600 + ETHERTYPE_NSAT = 0x601 + ETHERTYPE_NSCOMPAT = 0x807 + ETHERTYPE_NSH = 0x984f + ETHERTYPE_NTRAILER = 0x10 + ETHERTYPE_OS9 = 0x7007 + ETHERTYPE_OS9NET = 0x7009 + ETHERTYPE_PACER = 0x80c6 + ETHERTYPE_PBB = 0x88e7 + ETHERTYPE_PCS = 0x4242 + ETHERTYPE_PLANNING = 0x8044 + ETHERTYPE_PPP = 0x880b + ETHERTYPE_PPPOE = 0x8864 + ETHERTYPE_PPPOEDISC = 0x8863 + ETHERTYPE_PRIMENTS = 0x7031 + ETHERTYPE_PUP = 0x200 + ETHERTYPE_PUPAT = 0x200 + ETHERTYPE_QINQ = 0x88a8 + ETHERTYPE_RACAL = 0x7030 + ETHERTYPE_RATIONAL = 0x8150 + ETHERTYPE_RAWFR = 0x6559 + ETHERTYPE_RCL = 0x1995 + ETHERTYPE_RDP = 0x8739 + ETHERTYPE_RETIX = 0x80f2 + ETHERTYPE_REVARP = 0x8035 + ETHERTYPE_SCA = 0x6007 + ETHERTYPE_SECTRA = 0x86db + ETHERTYPE_SECUREDATA = 0x876d + ETHERTYPE_SGITW = 0x817e + ETHERTYPE_SG_BOUNCE = 0x8016 + ETHERTYPE_SG_DIAG = 0x8013 + ETHERTYPE_SG_NETGAMES = 0x8014 + ETHERTYPE_SG_RESV = 0x8015 + ETHERTYPE_SIMNET = 0x5208 + ETHERTYPE_SLOW = 0x8809 + ETHERTYPE_SNA = 0x80d5 + ETHERTYPE_SNMP = 0x814c + ETHERTYPE_SONIX = 0xfaf5 + ETHERTYPE_SPIDER = 0x809f + ETHERTYPE_SPRITE = 0x500 + ETHERTYPE_STP = 0x8181 + ETHERTYPE_TALARIS = 0x812b + ETHERTYPE_TALARISMC = 0x852b + ETHERTYPE_TCPCOMP = 0x876b + ETHERTYPE_TCPSM = 0x9002 + ETHERTYPE_TEC = 0x814f + ETHERTYPE_TIGAN = 0x802f + ETHERTYPE_TRAIL = 0x1000 + ETHERTYPE_TRANSETHER = 0x6558 + ETHERTYPE_TYMSHARE = 0x802e + ETHERTYPE_UBBST = 0x7005 + ETHERTYPE_UBDEBUG = 0x900 + ETHERTYPE_UBDIAGLOOP = 0x7002 + ETHERTYPE_UBDL = 0x7000 + ETHERTYPE_UBNIU = 0x7001 + ETHERTYPE_UBNMC = 0x7003 + ETHERTYPE_VALID = 0x1600 + ETHERTYPE_VARIAN = 0x80dd + ETHERTYPE_VAXELN = 0x803b + ETHERTYPE_VEECO = 0x8067 + ETHERTYPE_VEXP = 0x805b + ETHERTYPE_VGLAB = 0x8131 + ETHERTYPE_VINES = 0xbad + ETHERTYPE_VINESECHO = 0xbaf + ETHERTYPE_VINESLOOP = 0xbae + ETHERTYPE_VITAL = 0xff00 + ETHERTYPE_VLAN = 0x8100 + ETHERTYPE_VLTLMAN = 0x8080 + ETHERTYPE_VPROD = 0x805c + ETHERTYPE_VURESERVED = 0x8147 + ETHERTYPE_WATERLOO = 0x8130 + ETHERTYPE_WELLFLEET = 0x8103 + ETHERTYPE_X25 = 0x805 + ETHERTYPE_X75 = 0x801 + ETHERTYPE_XNSSM = 0x9001 + ETHERTYPE_XTP = 0x817d + ETHER_ADDR_LEN = 0x6 + ETHER_ALIGN = 0x2 + ETHER_CRC_LEN = 0x4 + ETHER_CRC_POLY_BE = 0x4c11db6 + ETHER_CRC_POLY_LE = 0xedb88320 + ETHER_HDR_LEN = 0xe + ETHER_MAX_DIX_LEN = 0x600 + ETHER_MAX_HARDMTU_LEN = 0xff9b + ETHER_MAX_LEN = 0x5ee + ETHER_MIN_LEN = 0x40 + ETHER_TYPE_LEN = 0x2 + ETHER_VLAN_ENCAP_LEN = 0x4 + EVFILT_AIO = -0x3 + EVFILT_DEVICE = -0x8 + EVFILT_EXCEPT = -0x9 + EVFILT_PROC = -0x5 + EVFILT_READ = -0x1 + EVFILT_SIGNAL = -0x6 + EVFILT_SYSCOUNT = 0x9 + EVFILT_TIMER = -0x7 + EVFILT_VNODE = -0x4 + EVFILT_WRITE = -0x2 + EVL_ENCAPLEN = 0x4 + EVL_PRIO_BITS = 0xd + EVL_PRIO_MAX = 0x7 + EVL_VLID_MASK = 0xfff + EVL_VLID_MAX = 0xffe + EVL_VLID_MIN = 0x1 + EVL_VLID_NULL = 0x0 + EV_ADD = 0x1 + EV_CLEAR = 0x20 + EV_DELETE = 0x2 + EV_DISABLE = 0x8 + EV_DISPATCH = 0x80 + EV_ENABLE = 0x4 + EV_EOF = 0x8000 + EV_ERROR = 0x4000 + EV_FLAG1 = 0x2000 + EV_ONESHOT = 0x10 + EV_RECEIPT = 0x40 + EV_SYSFLAGS = 0xf800 + EXTA = 0x4b00 + EXTB = 0x9600 + EXTPROC = 0x800 + FD_CLOEXEC = 0x1 + FD_SETSIZE = 0x400 + FLUSHO = 0x800000 + F_DUPFD = 0x0 + F_DUPFD_CLOEXEC = 0xa + F_GETFD = 0x1 + F_GETFL = 0x3 + F_GETLK = 0x7 + F_GETOWN = 0x5 + F_ISATTY = 0xb + F_OK = 0x0 + F_RDLCK = 0x1 + F_SETFD = 0x2 + F_SETFL = 0x4 + F_SETLK = 0x8 + F_SETLKW = 0x9 + F_SETOWN = 0x6 + F_UNLCK = 0x2 + F_WRLCK = 0x3 + HUPCL = 0x4000 + HW_MACHINE = 0x1 + ICANON = 0x100 + ICMP6_FILTER = 0x12 + ICRNL = 0x100 + IEXTEN = 0x400 + IFAN_ARRIVAL = 0x0 + IFAN_DEPARTURE = 0x1 + IFF_ALLMULTI = 0x200 + IFF_BROADCAST = 0x2 + IFF_CANTCHANGE = 0x8e52 + IFF_DEBUG = 0x4 + IFF_LINK0 = 0x1000 + IFF_LINK1 = 0x2000 + IFF_LINK2 = 0x4000 + IFF_LOOPBACK = 0x8 + IFF_MULTICAST = 0x8000 + IFF_NOARP = 0x80 + IFF_OACTIVE = 0x400 + IFF_POINTOPOINT = 0x10 + IFF_PROMISC = 0x100 + IFF_RUNNING = 0x40 + IFF_SIMPLEX = 0x800 + IFF_STATICARP = 0x20 + IFF_UP = 0x1 + IFNAMSIZ = 0x10 + IFT_1822 = 0x2 + IFT_A12MPPSWITCH = 0x82 + IFT_AAL2 = 0xbb + IFT_AAL5 = 0x31 + IFT_ADSL = 0x5e + IFT_AFLANE8023 = 0x3b + IFT_AFLANE8025 = 0x3c + IFT_ARAP = 0x58 + IFT_ARCNET = 0x23 + IFT_ARCNETPLUS = 0x24 + IFT_ASYNC = 0x54 + IFT_ATM = 0x25 + IFT_ATMDXI = 0x69 + IFT_ATMFUNI = 0x6a + IFT_ATMIMA = 0x6b + IFT_ATMLOGICAL = 0x50 + IFT_ATMRADIO = 0xbd + IFT_ATMSUBINTERFACE = 0x86 + IFT_ATMVCIENDPT = 0xc2 + IFT_ATMVIRTUAL = 0x95 + IFT_BGPPOLICYACCOUNTING = 0xa2 + IFT_BLUETOOTH = 0xf8 + IFT_BRIDGE = 0xd1 + IFT_BSC = 0x53 + IFT_CARP = 0xf7 + IFT_CCTEMUL = 0x3d + IFT_CEPT = 0x13 + IFT_CES = 0x85 + IFT_CHANNEL = 0x46 + IFT_CNR = 0x55 + IFT_COFFEE = 0x84 + IFT_COMPOSITELINK = 0x9b + IFT_DCN = 0x8d + IFT_DIGITALPOWERLINE = 0x8a + IFT_DIGITALWRAPPEROVERHEADCHANNEL = 0xba + IFT_DLSW = 0x4a + IFT_DOCSCABLEDOWNSTREAM = 0x80 + IFT_DOCSCABLEMACLAYER = 0x7f + IFT_DOCSCABLEUPSTREAM = 0x81 + IFT_DOCSCABLEUPSTREAMCHANNEL = 0xcd + IFT_DS0 = 0x51 + IFT_DS0BUNDLE = 0x52 + IFT_DS1FDL = 0xaa + IFT_DS3 = 0x1e + IFT_DTM = 0x8c + IFT_DUMMY = 0xf1 + IFT_DVBASILN = 0xac + IFT_DVBASIOUT = 0xad + IFT_DVBRCCDOWNSTREAM = 0x93 + IFT_DVBRCCMACLAYER = 0x92 + IFT_DVBRCCUPSTREAM = 0x94 + IFT_ECONET = 0xce + IFT_ENC = 0xf4 + IFT_EON = 0x19 + IFT_EPLRS = 0x57 + IFT_ESCON = 0x49 + IFT_ETHER = 0x6 + IFT_FAITH = 0xf3 + IFT_FAST = 0x7d + IFT_FASTETHER = 0x3e + IFT_FASTETHERFX = 0x45 + IFT_FDDI = 0xf + IFT_FIBRECHANNEL = 0x38 + IFT_FRAMERELAYINTERCONNECT = 0x3a + IFT_FRAMERELAYMPI = 0x5c + IFT_FRDLCIENDPT = 0xc1 + IFT_FRELAY = 0x20 + IFT_FRELAYDCE = 0x2c + IFT_FRF16MFRBUNDLE = 0xa3 + IFT_FRFORWARD = 0x9e + IFT_G703AT2MB = 0x43 + IFT_G703AT64K = 0x42 + IFT_GIF = 0xf0 + IFT_GIGABITETHERNET = 0x75 + IFT_GR303IDT = 0xb2 + IFT_GR303RDT = 0xb1 + IFT_H323GATEKEEPER = 0xa4 + IFT_H323PROXY = 0xa5 + IFT_HDH1822 = 0x3 + IFT_HDLC = 0x76 + IFT_HDSL2 = 0xa8 + IFT_HIPERLAN2 = 0xb7 + IFT_HIPPI = 0x2f + IFT_HIPPIINTERFACE = 0x39 + IFT_HOSTPAD = 0x5a + IFT_HSSI = 0x2e + IFT_HY = 0xe + IFT_IBM370PARCHAN = 0x48 + IFT_IDSL = 0x9a + IFT_IEEE1394 = 0x90 + IFT_IEEE80211 = 0x47 + IFT_IEEE80212 = 0x37 + IFT_IEEE8023ADLAG = 0xa1 + IFT_IFGSN = 0x91 + IFT_IMT = 0xbe + IFT_INFINIBAND = 0xc7 + IFT_INTERLEAVE = 0x7c + IFT_IP = 0x7e + IFT_IPFORWARD = 0x8e + IFT_IPOVERATM = 0x72 + IFT_IPOVERCDLC = 0x6d + IFT_IPOVERCLAW = 0x6e + IFT_IPSWITCH = 0x4e + IFT_ISDN = 0x3f + IFT_ISDNBASIC = 0x14 + IFT_ISDNPRIMARY = 0x15 + IFT_ISDNS = 0x4b + IFT_ISDNU = 0x4c + IFT_ISO88022LLC = 0x29 + IFT_ISO88023 = 0x7 + IFT_ISO88024 = 0x8 + IFT_ISO88025 = 0x9 + IFT_ISO88025CRFPINT = 0x62 + IFT_ISO88025DTR = 0x56 + IFT_ISO88025FIBER = 0x73 + IFT_ISO88026 = 0xa + IFT_ISUP = 0xb3 + IFT_L2VLAN = 0x87 + IFT_L3IPVLAN = 0x88 + IFT_L3IPXVLAN = 0x89 + IFT_LAPB = 0x10 + IFT_LAPD = 0x4d + IFT_LAPF = 0x77 + IFT_LINEGROUP = 0xd2 + IFT_LOCALTALK = 0x2a + IFT_LOOP = 0x18 + IFT_MBIM = 0xfa + IFT_MEDIAMAILOVERIP = 0x8b + IFT_MFSIGLINK = 0xa7 + IFT_MIOX25 = 0x26 + IFT_MODEM = 0x30 + IFT_MPC = 0x71 + IFT_MPLS = 0xa6 + IFT_MPLSTUNNEL = 0x96 + IFT_MSDSL = 0x8f + IFT_MVL = 0xbf + IFT_MYRINET = 0x63 + IFT_NFAS = 0xaf + IFT_NSIP = 0x1b + IFT_OPTICALCHANNEL = 0xc3 + IFT_OPTICALTRANSPORT = 0xc4 + IFT_OTHER = 0x1 + IFT_P10 = 0xc + IFT_P80 = 0xd + IFT_PARA = 0x22 + IFT_PFLOG = 0xf5 + IFT_PFLOW = 0xf9 + IFT_PFSYNC = 0xf6 + IFT_PLC = 0xae + IFT_PON155 = 0xcf + IFT_PON622 = 0xd0 + IFT_POS = 0xab + IFT_PPP = 0x17 + IFT_PPPMULTILINKBUNDLE = 0x6c + IFT_PROPATM = 0xc5 + IFT_PROPBWAP2MP = 0xb8 + IFT_PROPCNLS = 0x59 + IFT_PROPDOCSWIRELESSDOWNSTREAM = 0xb5 + IFT_PROPDOCSWIRELESSMACLAYER = 0xb4 + IFT_PROPDOCSWIRELESSUPSTREAM = 0xb6 + IFT_PROPMUX = 0x36 + IFT_PROPVIRTUAL = 0x35 + IFT_PROPWIRELESSP2P = 0x9d + IFT_PTPSERIAL = 0x16 + IFT_PVC = 0xf2 + IFT_Q2931 = 0xc9 + IFT_QLLC = 0x44 + IFT_RADIOMAC = 0xbc + IFT_RADSL = 0x5f + IFT_REACHDSL = 0xc0 + IFT_RFC1483 = 0x9f + IFT_RS232 = 0x21 + IFT_RSRB = 0x4f + IFT_SDLC = 0x11 + IFT_SDSL = 0x60 + IFT_SHDSL = 0xa9 + IFT_SIP = 0x1f + IFT_SIPSIG = 0xcc + IFT_SIPTG = 0xcb + IFT_SLIP = 0x1c + IFT_SMDSDXI = 0x2b + IFT_SMDSICIP = 0x34 + IFT_SONET = 0x27 + IFT_SONETOVERHEADCHANNEL = 0xb9 + IFT_SONETPATH = 0x32 + IFT_SONETVT = 0x33 + IFT_SRP = 0x97 + IFT_SS7SIGLINK = 0x9c + IFT_STACKTOSTACK = 0x6f + IFT_STARLAN = 0xb + IFT_T1 = 0x12 + IFT_TDLC = 0x74 + IFT_TELINK = 0xc8 + IFT_TERMPAD = 0x5b + IFT_TR008 = 0xb0 + IFT_TRANSPHDLC = 0x7b + IFT_TUNNEL = 0x83 + IFT_ULTRA = 0x1d + IFT_USB = 0xa0 + IFT_V11 = 0x40 + IFT_V35 = 0x2d + IFT_V36 = 0x41 + IFT_V37 = 0x78 + IFT_VDSL = 0x61 + IFT_VIRTUALIPADDRESS = 0x70 + IFT_VIRTUALTG = 0xca + IFT_VOICEDID = 0xd5 + IFT_VOICEEM = 0x64 + IFT_VOICEEMFGD = 0xd3 + IFT_VOICEENCAP = 0x67 + IFT_VOICEFGDEANA = 0xd4 + IFT_VOICEFXO = 0x65 + IFT_VOICEFXS = 0x66 + IFT_VOICEOVERATM = 0x98 + IFT_VOICEOVERCABLE = 0xc6 + IFT_VOICEOVERFRAMERELAY = 0x99 + IFT_VOICEOVERIP = 0x68 + IFT_WIREGUARD = 0xfb + IFT_X213 = 0x5d + IFT_X25 = 0x5 + IFT_X25DDN = 0x4 + IFT_X25HUNTGROUP = 0x7a + IFT_X25MLP = 0x79 + IFT_X25PLE = 0x28 + IFT_XETHER = 0x1a + IGNBRK = 0x1 + IGNCR = 0x80 + IGNPAR = 0x4 + IMAXBEL = 0x2000 + INLCR = 0x40 + INPCK = 0x10 + IN_CLASSA_HOST = 0xffffff + IN_CLASSA_MAX = 0x80 + IN_CLASSA_NET = 0xff000000 + IN_CLASSA_NSHIFT = 0x18 + IN_CLASSB_HOST = 0xffff + IN_CLASSB_MAX = 0x10000 + IN_CLASSB_NET = 0xffff0000 + IN_CLASSB_NSHIFT = 0x10 + IN_CLASSC_HOST = 0xff + IN_CLASSC_NET = 0xffffff00 + IN_CLASSC_NSHIFT = 0x8 + IN_CLASSD_HOST = 0xfffffff + IN_CLASSD_NET = 0xf0000000 + IN_CLASSD_NSHIFT = 0x1c + IN_LOOPBACKNET = 0x7f + IN_RFC3021_HOST = 0x1 + IN_RFC3021_NET = 0xfffffffe + IN_RFC3021_NSHIFT = 0x1f + IPPROTO_AH = 0x33 + IPPROTO_CARP = 0x70 + IPPROTO_DIVERT = 0x102 + IPPROTO_DONE = 0x101 + IPPROTO_DSTOPTS = 0x3c + IPPROTO_EGP = 0x8 + IPPROTO_ENCAP = 0x62 + IPPROTO_EON = 0x50 + IPPROTO_ESP = 0x32 + IPPROTO_ETHERIP = 0x61 + IPPROTO_FRAGMENT = 0x2c + IPPROTO_GGP = 0x3 + IPPROTO_GRE = 0x2f + IPPROTO_HOPOPTS = 0x0 + IPPROTO_ICMP = 0x1 + IPPROTO_ICMPV6 = 0x3a + IPPROTO_IDP = 0x16 + IPPROTO_IGMP = 0x2 + IPPROTO_IP = 0x0 + IPPROTO_IPCOMP = 0x6c + IPPROTO_IPIP = 0x4 + IPPROTO_IPV4 = 0x4 + IPPROTO_IPV6 = 0x29 + IPPROTO_MAX = 0x100 + IPPROTO_MAXID = 0x103 + IPPROTO_MOBILE = 0x37 + IPPROTO_MPLS = 0x89 + IPPROTO_NONE = 0x3b + IPPROTO_PFSYNC = 0xf0 + IPPROTO_PIM = 0x67 + IPPROTO_PUP = 0xc + IPPROTO_RAW = 0xff + IPPROTO_ROUTING = 0x2b + IPPROTO_RSVP = 0x2e + IPPROTO_SCTP = 0x84 + IPPROTO_TCP = 0x6 + IPPROTO_TP = 0x1d + IPPROTO_UDP = 0x11 + IPPROTO_UDPLITE = 0x88 + IPV6_AUTH_LEVEL = 0x35 + IPV6_AUTOFLOWLABEL = 0x3b + IPV6_CHECKSUM = 0x1a + IPV6_DEFAULT_MULTICAST_HOPS = 0x1 + IPV6_DEFAULT_MULTICAST_LOOP = 0x1 + IPV6_DEFHLIM = 0x40 + IPV6_DONTFRAG = 0x3e + IPV6_DSTOPTS = 0x32 + IPV6_ESP_NETWORK_LEVEL = 0x37 + IPV6_ESP_TRANS_LEVEL = 0x36 + IPV6_FAITH = 0x1d + IPV6_FLOWINFO_MASK = 0xfffffff + IPV6_FLOWLABEL_MASK = 0xfffff + IPV6_FRAGTTL = 0x78 + IPV6_HLIMDEC = 0x1 + IPV6_HOPLIMIT = 0x2f + IPV6_HOPOPTS = 0x31 + IPV6_IPCOMP_LEVEL = 0x3c + IPV6_JOIN_GROUP = 0xc + IPV6_LEAVE_GROUP = 0xd + IPV6_MAXHLIM = 0xff + IPV6_MAXPACKET = 0xffff + IPV6_MINHOPCOUNT = 0x41 + IPV6_MMTU = 0x500 + IPV6_MULTICAST_HOPS = 0xa + IPV6_MULTICAST_IF = 0x9 + IPV6_MULTICAST_LOOP = 0xb + IPV6_NEXTHOP = 0x30 + IPV6_OPTIONS = 0x1 + IPV6_PATHMTU = 0x2c + IPV6_PIPEX = 0x3f + IPV6_PKTINFO = 0x2e + IPV6_PORTRANGE = 0xe + IPV6_PORTRANGE_DEFAULT = 0x0 + IPV6_PORTRANGE_HIGH = 0x1 + IPV6_PORTRANGE_LOW = 0x2 + IPV6_RECVDSTOPTS = 0x28 + IPV6_RECVDSTPORT = 0x40 + IPV6_RECVHOPLIMIT = 0x25 + IPV6_RECVHOPOPTS = 0x27 + IPV6_RECVPATHMTU = 0x2b + IPV6_RECVPKTINFO = 0x24 + IPV6_RECVRTHDR = 0x26 + IPV6_RECVTCLASS = 0x39 + IPV6_RTABLE = 0x1021 + IPV6_RTHDR = 0x33 + IPV6_RTHDRDSTOPTS = 0x23 + IPV6_RTHDR_LOOSE = 0x0 + IPV6_RTHDR_STRICT = 0x1 + IPV6_RTHDR_TYPE_0 = 0x0 + IPV6_SOCKOPT_RESERVED1 = 0x3 + IPV6_TCLASS = 0x3d + IPV6_UNICAST_HOPS = 0x4 + IPV6_USE_MIN_MTU = 0x2a + IPV6_V6ONLY = 0x1b + IPV6_VERSION = 0x60 + IPV6_VERSION_MASK = 0xf0 + IP_ADD_MEMBERSHIP = 0xc + IP_AUTH_LEVEL = 0x14 + IP_DEFAULT_MULTICAST_LOOP = 0x1 + IP_DEFAULT_MULTICAST_TTL = 0x1 + IP_DF = 0x4000 + IP_DROP_MEMBERSHIP = 0xd + IP_ESP_NETWORK_LEVEL = 0x16 + IP_ESP_TRANS_LEVEL = 0x15 + IP_HDRINCL = 0x2 + IP_IPCOMP_LEVEL = 0x1d + IP_IPDEFTTL = 0x25 + IP_IPSECFLOWINFO = 0x24 + IP_IPSEC_LOCAL_AUTH = 0x1b + IP_IPSEC_LOCAL_CRED = 0x19 + IP_IPSEC_LOCAL_ID = 0x17 + IP_IPSEC_REMOTE_AUTH = 0x1c + IP_IPSEC_REMOTE_CRED = 0x1a + IP_IPSEC_REMOTE_ID = 0x18 + IP_MAXPACKET = 0xffff + IP_MAX_MEMBERSHIPS = 0xfff + IP_MF = 0x2000 + IP_MINTTL = 0x20 + IP_MIN_MEMBERSHIPS = 0xf + IP_MSS = 0x240 + IP_MULTICAST_IF = 0x9 + IP_MULTICAST_LOOP = 0xb + IP_MULTICAST_TTL = 0xa + IP_OFFMASK = 0x1fff + IP_OPTIONS = 0x1 + IP_PIPEX = 0x22 + IP_PORTRANGE = 0x13 + IP_PORTRANGE_DEFAULT = 0x0 + IP_PORTRANGE_HIGH = 0x1 + IP_PORTRANGE_LOW = 0x2 + IP_RECVDSTADDR = 0x7 + IP_RECVDSTPORT = 0x21 + IP_RECVIF = 0x1e + IP_RECVOPTS = 0x5 + IP_RECVRETOPTS = 0x6 + IP_RECVRTABLE = 0x23 + IP_RECVTTL = 0x1f + IP_RETOPTS = 0x8 + IP_RF = 0x8000 + IP_RTABLE = 0x1021 + IP_SENDSRCADDR = 0x7 + IP_TOS = 0x3 + IP_TTL = 0x4 + ISIG = 0x80 + ISTRIP = 0x20 + ITIMER_PROF = 0x2 + ITIMER_REAL = 0x0 + ITIMER_VIRTUAL = 0x1 + IUCLC = 0x1000 + IXANY = 0x800 + IXOFF = 0x400 + IXON = 0x200 + KERN_HOSTNAME = 0xa + KERN_OSRELEASE = 0x2 + KERN_OSTYPE = 0x1 + KERN_VERSION = 0x4 + LCNT_OVERLOAD_FLUSH = 0x6 + LOCK_EX = 0x2 + LOCK_NB = 0x4 + LOCK_SH = 0x1 + LOCK_UN = 0x8 + MADV_DONTNEED = 0x4 + MADV_FREE = 0x6 + MADV_NORMAL = 0x0 + MADV_RANDOM = 0x1 + MADV_SEQUENTIAL = 0x2 + MADV_SPACEAVAIL = 0x5 + MADV_WILLNEED = 0x3 + MAP_ANON = 0x1000 + MAP_ANONYMOUS = 0x1000 + MAP_CONCEAL = 0x8000 + MAP_COPY = 0x2 + MAP_FILE = 0x0 + MAP_FIXED = 0x10 + MAP_FLAGMASK = 0xfff7 + MAP_HASSEMAPHORE = 0x0 + MAP_INHERIT = 0x0 + MAP_INHERIT_COPY = 0x1 + MAP_INHERIT_NONE = 0x2 + MAP_INHERIT_SHARE = 0x0 + MAP_INHERIT_ZERO = 0x3 + MAP_NOEXTEND = 0x0 + MAP_NORESERVE = 0x0 + MAP_PRIVATE = 0x2 + MAP_RENAME = 0x0 + MAP_SHARED = 0x1 + MAP_STACK = 0x4000 + MAP_TRYFIXED = 0x0 + MCL_CURRENT = 0x1 + MCL_FUTURE = 0x2 + MNT_ASYNC = 0x40 + MNT_DEFEXPORTED = 0x200 + MNT_DELEXPORT = 0x20000 + MNT_DOOMED = 0x8000000 + MNT_EXPORTANON = 0x400 + MNT_EXPORTED = 0x100 + MNT_EXRDONLY = 0x80 + MNT_FORCE = 0x80000 + MNT_LAZY = 0x3 + MNT_LOCAL = 0x1000 + MNT_NOATIME = 0x8000 + MNT_NODEV = 0x10 + MNT_NOEXEC = 0x4 + MNT_NOPERM = 0x20 + MNT_NOSUID = 0x8 + MNT_NOWAIT = 0x2 + MNT_QUOTA = 0x2000 + MNT_RDONLY = 0x1 + MNT_RELOAD = 0x40000 + MNT_ROOTFS = 0x4000 + MNT_SOFTDEP = 0x4000000 + MNT_STALLED = 0x100000 + MNT_SWAPPABLE = 0x200000 + MNT_SYNCHRONOUS = 0x2 + MNT_UPDATE = 0x10000 + MNT_VISFLAGMASK = 0x400ffff + MNT_WAIT = 0x1 + MNT_WANTRDWR = 0x2000000 + MNT_WXALLOWED = 0x800 + MOUNT_AFS = "afs" + MOUNT_CD9660 = "cd9660" + MOUNT_EXT2FS = "ext2fs" + MOUNT_FFS = "ffs" + MOUNT_FUSEFS = "fuse" + MOUNT_MFS = "mfs" + MOUNT_MSDOS = "msdos" + MOUNT_NCPFS = "ncpfs" + MOUNT_NFS = "nfs" + MOUNT_NTFS = "ntfs" + MOUNT_TMPFS = "tmpfs" + MOUNT_UDF = "udf" + MOUNT_UFS = "ffs" + MSG_BCAST = 0x100 + MSG_CMSG_CLOEXEC = 0x800 + MSG_CTRUNC = 0x20 + MSG_DONTROUTE = 0x4 + MSG_DONTWAIT = 0x80 + MSG_EOR = 0x8 + MSG_MCAST = 0x200 + MSG_NOSIGNAL = 0x400 + MSG_OOB = 0x1 + MSG_PEEK = 0x2 + MSG_TRUNC = 0x10 + MSG_WAITALL = 0x40 + MSG_WAITFORONE = 0x1000 + MS_ASYNC = 0x1 + MS_INVALIDATE = 0x4 + MS_SYNC = 0x2 + NAME_MAX = 0xff + NET_RT_DUMP = 0x1 + NET_RT_FLAGS = 0x2 + NET_RT_IFLIST = 0x3 + NET_RT_IFNAMES = 0x6 + NET_RT_MAXID = 0x8 + NET_RT_SOURCE = 0x7 + NET_RT_STATS = 0x4 + NET_RT_TABLE = 0x5 + NFDBITS = 0x20 + NOFLSH = 0x80000000 + NOKERNINFO = 0x2000000 + NOTE_ATTRIB = 0x8 + NOTE_CHANGE = 0x1 + NOTE_CHILD = 0x4 + NOTE_DELETE = 0x1 + NOTE_EOF = 0x2 + NOTE_EXEC = 0x20000000 + NOTE_EXIT = 0x80000000 + NOTE_EXTEND = 0x4 + NOTE_FORK = 0x40000000 + NOTE_LINK = 0x10 + NOTE_LOWAT = 0x1 + NOTE_OOB = 0x4 + NOTE_PCTRLMASK = 0xf0000000 + NOTE_PDATAMASK = 0xfffff + NOTE_RENAME = 0x20 + NOTE_REVOKE = 0x40 + NOTE_TRACK = 0x1 + NOTE_TRACKERR = 0x2 + NOTE_TRUNCATE = 0x80 + NOTE_WRITE = 0x2 + OCRNL = 0x10 + OLCUC = 0x20 + ONLCR = 0x2 + ONLRET = 0x80 + ONOCR = 0x40 + ONOEOT = 0x8 + OPOST = 0x1 + OXTABS = 0x4 + O_ACCMODE = 0x3 + O_APPEND = 0x8 + O_ASYNC = 0x40 + O_CLOEXEC = 0x10000 + O_CREAT = 0x200 + O_DIRECTORY = 0x20000 + O_DSYNC = 0x80 + O_EXCL = 0x800 + O_EXLOCK = 0x20 + O_FSYNC = 0x80 + O_NDELAY = 0x4 + O_NOCTTY = 0x8000 + O_NOFOLLOW = 0x100 + O_NONBLOCK = 0x4 + O_RDONLY = 0x0 + O_RDWR = 0x2 + O_RSYNC = 0x80 + O_SHLOCK = 0x10 + O_SYNC = 0x80 + O_TRUNC = 0x400 + O_WRONLY = 0x1 + PARENB = 0x1000 + PARMRK = 0x8 + PARODD = 0x2000 + PENDIN = 0x20000000 + PF_FLUSH = 0x1 + PRIO_PGRP = 0x1 + PRIO_PROCESS = 0x0 + PRIO_USER = 0x2 + PROT_EXEC = 0x4 + PROT_NONE = 0x0 + PROT_READ = 0x1 + PROT_WRITE = 0x2 + RLIMIT_CORE = 0x4 + RLIMIT_CPU = 0x0 + RLIMIT_DATA = 0x2 + RLIMIT_FSIZE = 0x1 + RLIMIT_MEMLOCK = 0x6 + RLIMIT_NOFILE = 0x8 + RLIMIT_NPROC = 0x7 + RLIMIT_RSS = 0x5 + RLIMIT_STACK = 0x3 + RLIM_INFINITY = 0x7fffffffffffffff + RTAX_AUTHOR = 0x6 + RTAX_BFD = 0xb + RTAX_BRD = 0x7 + RTAX_DNS = 0xc + RTAX_DST = 0x0 + RTAX_GATEWAY = 0x1 + RTAX_GENMASK = 0x3 + RTAX_IFA = 0x5 + RTAX_IFP = 0x4 + RTAX_LABEL = 0xa + RTAX_MAX = 0xf + RTAX_NETMASK = 0x2 + RTAX_SEARCH = 0xe + RTAX_SRC = 0x8 + RTAX_SRCMASK = 0x9 + RTAX_STATIC = 0xd + RTA_AUTHOR = 0x40 + RTA_BFD = 0x800 + RTA_BRD = 0x80 + RTA_DNS = 0x1000 + RTA_DST = 0x1 + RTA_GATEWAY = 0x2 + RTA_GENMASK = 0x8 + RTA_IFA = 0x20 + RTA_IFP = 0x10 + RTA_LABEL = 0x400 + RTA_NETMASK = 0x4 + RTA_SEARCH = 0x4000 + RTA_SRC = 0x100 + RTA_SRCMASK = 0x200 + RTA_STATIC = 0x2000 + RTF_ANNOUNCE = 0x4000 + RTF_BFD = 0x1000000 + RTF_BLACKHOLE = 0x1000 + RTF_BROADCAST = 0x400000 + RTF_CACHED = 0x20000 + RTF_CLONED = 0x10000 + RTF_CLONING = 0x100 + RTF_CONNECTED = 0x800000 + RTF_DONE = 0x40 + RTF_DYNAMIC = 0x10 + RTF_FMASK = 0x110fc08 + RTF_GATEWAY = 0x2 + RTF_HOST = 0x4 + RTF_LLINFO = 0x400 + RTF_LOCAL = 0x200000 + RTF_MODIFIED = 0x20 + RTF_MPATH = 0x40000 + RTF_MPLS = 0x100000 + RTF_MULTICAST = 0x200 + RTF_PERMANENT_ARP = 0x2000 + RTF_PROTO1 = 0x8000 + RTF_PROTO2 = 0x4000 + RTF_PROTO3 = 0x2000 + RTF_REJECT = 0x8 + RTF_STATIC = 0x800 + RTF_UP = 0x1 + RTF_USETRAILERS = 0x8000 + RTM_80211INFO = 0x15 + RTM_ADD = 0x1 + RTM_BFD = 0x12 + RTM_CHANGE = 0x3 + RTM_CHGADDRATTR = 0x14 + RTM_DELADDR = 0xd + RTM_DELETE = 0x2 + RTM_DESYNC = 0x10 + RTM_GET = 0x4 + RTM_IFANNOUNCE = 0xf + RTM_IFINFO = 0xe + RTM_INVALIDATE = 0x11 + RTM_LOSING = 0x5 + RTM_MAXSIZE = 0x800 + RTM_MISS = 0x7 + RTM_NEWADDR = 0xc + RTM_PROPOSAL = 0x13 + RTM_REDIRECT = 0x6 + RTM_RESOLVE = 0xb + RTM_SOURCE = 0x16 + RTM_VERSION = 0x5 + RTV_EXPIRE = 0x4 + RTV_HOPCOUNT = 0x2 + RTV_MTU = 0x1 + RTV_RPIPE = 0x8 + RTV_RTT = 0x40 + RTV_RTTVAR = 0x80 + RTV_SPIPE = 0x10 + RTV_SSTHRESH = 0x20 + RT_TABLEID_BITS = 0x8 + RT_TABLEID_MASK = 0xff + RT_TABLEID_MAX = 0xff + RUSAGE_CHILDREN = -0x1 + RUSAGE_SELF = 0x0 + RUSAGE_THREAD = 0x1 + SCM_RIGHTS = 0x1 + SCM_TIMESTAMP = 0x4 + SEEK_CUR = 0x1 + SEEK_END = 0x2 + SEEK_SET = 0x0 + SHUT_RD = 0x0 + SHUT_RDWR = 0x2 + SHUT_WR = 0x1 + SIOCADDMULTI = 0x80206931 + SIOCAIFADDR = 0x8040691a + SIOCAIFGROUP = 0x80286987 + SIOCATMARK = 0x40047307 + SIOCBRDGADD = 0x8060693c + SIOCBRDGADDL = 0x80606949 + SIOCBRDGADDS = 0x80606941 + SIOCBRDGARL = 0x808c694d + SIOCBRDGDADDR = 0x81286947 + SIOCBRDGDEL = 0x8060693d + SIOCBRDGDELS = 0x80606942 + SIOCBRDGFLUSH = 0x80606948 + SIOCBRDGFRL = 0x808c694e + SIOCBRDGGCACHE = 0xc0146941 + SIOCBRDGGFD = 0xc0146952 + SIOCBRDGGHT = 0xc0146951 + SIOCBRDGGIFFLGS = 0xc060693e + SIOCBRDGGMA = 0xc0146953 + SIOCBRDGGPARAM = 0xc0406958 + SIOCBRDGGPRI = 0xc0146950 + SIOCBRDGGRL = 0xc030694f + SIOCBRDGGTO = 0xc0146946 + SIOCBRDGIFS = 0xc0606942 + SIOCBRDGRTS = 0xc0206943 + SIOCBRDGSADDR = 0xc1286944 + SIOCBRDGSCACHE = 0x80146940 + SIOCBRDGSFD = 0x80146952 + SIOCBRDGSHT = 0x80146951 + SIOCBRDGSIFCOST = 0x80606955 + SIOCBRDGSIFFLGS = 0x8060693f + SIOCBRDGSIFPRIO = 0x80606954 + SIOCBRDGSIFPROT = 0x8060694a + SIOCBRDGSMA = 0x80146953 + SIOCBRDGSPRI = 0x80146950 + SIOCBRDGSPROTO = 0x8014695a + SIOCBRDGSTO = 0x80146945 + SIOCBRDGSTXHC = 0x80146959 + SIOCDELLABEL = 0x80206997 + SIOCDELMULTI = 0x80206932 + SIOCDIFADDR = 0x80206919 + SIOCDIFGROUP = 0x80286989 + SIOCDIFPARENT = 0x802069b4 + SIOCDIFPHYADDR = 0x80206949 + SIOCDPWE3NEIGHBOR = 0x802069de + SIOCDVNETID = 0x802069af + SIOCGETKALIVE = 0xc01869a4 + SIOCGETLABEL = 0x8020699a + SIOCGETMPWCFG = 0xc02069ae + SIOCGETPFLOW = 0xc02069fe + SIOCGETPFSYNC = 0xc02069f8 + SIOCGETSGCNT = 0xc0207534 + SIOCGETVIFCNT = 0xc0287533 + SIOCGETVLAN = 0xc0206990 + SIOCGIFADDR = 0xc0206921 + SIOCGIFBRDADDR = 0xc0206923 + SIOCGIFCONF = 0xc0106924 + SIOCGIFDATA = 0xc020691b + SIOCGIFDESCR = 0xc0206981 + SIOCGIFDSTADDR = 0xc0206922 + SIOCGIFFLAGS = 0xc0206911 + SIOCGIFGATTR = 0xc028698b + SIOCGIFGENERIC = 0xc020693a + SIOCGIFGLIST = 0xc028698d + SIOCGIFGMEMB = 0xc028698a + SIOCGIFGROUP = 0xc0286988 + SIOCGIFHARDMTU = 0xc02069a5 + SIOCGIFLLPRIO = 0xc02069b6 + SIOCGIFMEDIA = 0xc0406938 + SIOCGIFMETRIC = 0xc0206917 + SIOCGIFMTU = 0xc020697e + SIOCGIFNETMASK = 0xc0206925 + SIOCGIFPAIR = 0xc02069b1 + SIOCGIFPARENT = 0xc02069b3 + SIOCGIFPRIORITY = 0xc020699c + SIOCGIFRDOMAIN = 0xc02069a0 + SIOCGIFRTLABEL = 0xc0206983 + SIOCGIFRXR = 0x802069aa + SIOCGIFSFFPAGE = 0xc1126939 + SIOCGIFXFLAGS = 0xc020699e + SIOCGLIFPHYADDR = 0xc218694b + SIOCGLIFPHYDF = 0xc02069c2 + SIOCGLIFPHYECN = 0xc02069c8 + SIOCGLIFPHYRTABLE = 0xc02069a2 + SIOCGLIFPHYTTL = 0xc02069a9 + SIOCGPGRP = 0x40047309 + SIOCGPWE3 = 0xc0206998 + SIOCGPWE3CTRLWORD = 0xc02069dc + SIOCGPWE3FAT = 0xc02069dd + SIOCGPWE3NEIGHBOR = 0xc21869de + SIOCGRXHPRIO = 0xc02069db + SIOCGSPPPPARAMS = 0xc0206994 + SIOCGTXHPRIO = 0xc02069c6 + SIOCGUMBINFO = 0xc02069be + SIOCGUMBPARAM = 0xc02069c0 + SIOCGVH = 0xc02069f6 + SIOCGVNETFLOWID = 0xc02069c4 + SIOCGVNETID = 0xc02069a7 + SIOCIFAFATTACH = 0x801169ab + SIOCIFAFDETACH = 0x801169ac + SIOCIFCREATE = 0x8020697a + SIOCIFDESTROY = 0x80206979 + SIOCIFGCLONERS = 0xc0106978 + SIOCSETKALIVE = 0x801869a3 + SIOCSETLABEL = 0x80206999 + SIOCSETMPWCFG = 0x802069ad + SIOCSETPFLOW = 0x802069fd + SIOCSETPFSYNC = 0x802069f7 + SIOCSETVLAN = 0x8020698f + SIOCSIFADDR = 0x8020690c + SIOCSIFBRDADDR = 0x80206913 + SIOCSIFDESCR = 0x80206980 + SIOCSIFDSTADDR = 0x8020690e + SIOCSIFFLAGS = 0x80206910 + SIOCSIFGATTR = 0x8028698c + SIOCSIFGENERIC = 0x80206939 + SIOCSIFLLADDR = 0x8020691f + SIOCSIFLLPRIO = 0x802069b5 + SIOCSIFMEDIA = 0xc0206937 + SIOCSIFMETRIC = 0x80206918 + SIOCSIFMTU = 0x8020697f + SIOCSIFNETMASK = 0x80206916 + SIOCSIFPAIR = 0x802069b0 + SIOCSIFPARENT = 0x802069b2 + SIOCSIFPRIORITY = 0x8020699b + SIOCSIFRDOMAIN = 0x8020699f + SIOCSIFRTLABEL = 0x80206982 + SIOCSIFXFLAGS = 0x8020699d + SIOCSLIFPHYADDR = 0x8218694a + SIOCSLIFPHYDF = 0x802069c1 + SIOCSLIFPHYECN = 0x802069c7 + SIOCSLIFPHYRTABLE = 0x802069a1 + SIOCSLIFPHYTTL = 0x802069a8 + SIOCSPGRP = 0x80047308 + SIOCSPWE3CTRLWORD = 0x802069dc + SIOCSPWE3FAT = 0x802069dd + SIOCSPWE3NEIGHBOR = 0x821869de + SIOCSRXHPRIO = 0x802069db + SIOCSSPPPPARAMS = 0x80206993 + SIOCSTXHPRIO = 0x802069c5 + SIOCSUMBPARAM = 0x802069bf + SIOCSVH = 0xc02069f5 + SIOCSVNETFLOWID = 0x802069c3 + SIOCSVNETID = 0x802069a6 + SOCK_CLOEXEC = 0x8000 + SOCK_DGRAM = 0x2 + SOCK_DNS = 0x1000 + SOCK_NONBLOCK = 0x4000 + SOCK_RAW = 0x3 + SOCK_RDM = 0x4 + SOCK_SEQPACKET = 0x5 + SOCK_STREAM = 0x1 + SOL_SOCKET = 0xffff + SOMAXCONN = 0x80 + SO_ACCEPTCONN = 0x2 + SO_BINDANY = 0x1000 + SO_BROADCAST = 0x20 + SO_DEBUG = 0x1 + SO_DOMAIN = 0x1024 + SO_DONTROUTE = 0x10 + SO_ERROR = 0x1007 + SO_KEEPALIVE = 0x8 + SO_LINGER = 0x80 + SO_NETPROC = 0x1020 + SO_OOBINLINE = 0x100 + SO_PEERCRED = 0x1022 + SO_PROTOCOL = 0x1025 + SO_RCVBUF = 0x1002 + SO_RCVLOWAT = 0x1004 + SO_RCVTIMEO = 0x1006 + SO_REUSEADDR = 0x4 + SO_REUSEPORT = 0x200 + SO_RTABLE = 0x1021 + SO_SNDBUF = 0x1001 + SO_SNDLOWAT = 0x1003 + SO_SNDTIMEO = 0x1005 + SO_SPLICE = 0x1023 + SO_TIMESTAMP = 0x800 + SO_TYPE = 0x1008 + SO_USELOOPBACK = 0x40 + SO_ZEROIZE = 0x2000 + S_BLKSIZE = 0x200 + S_IEXEC = 0x40 + S_IFBLK = 0x6000 + S_IFCHR = 0x2000 + S_IFDIR = 0x4000 + S_IFIFO = 0x1000 + S_IFLNK = 0xa000 + S_IFMT = 0xf000 + S_IFREG = 0x8000 + S_IFSOCK = 0xc000 + S_IREAD = 0x100 + S_IRGRP = 0x20 + S_IROTH = 0x4 + S_IRUSR = 0x100 + S_IRWXG = 0x38 + S_IRWXO = 0x7 + S_IRWXU = 0x1c0 + S_ISGID = 0x400 + S_ISTXT = 0x200 + S_ISUID = 0x800 + S_ISVTX = 0x200 + S_IWGRP = 0x10 + S_IWOTH = 0x2 + S_IWRITE = 0x80 + S_IWUSR = 0x80 + S_IXGRP = 0x8 + S_IXOTH = 0x1 + S_IXUSR = 0x40 + TCIFLUSH = 0x1 + TCIOFF = 0x3 + TCIOFLUSH = 0x3 + TCION = 0x4 + TCOFLUSH = 0x2 + TCOOFF = 0x1 + TCOON = 0x2 + TCPOPT_EOL = 0x0 + TCPOPT_MAXSEG = 0x2 + TCPOPT_NOP = 0x1 + TCPOPT_SACK = 0x5 + TCPOPT_SACK_HDR = 0x1010500 + TCPOPT_SACK_PERMITTED = 0x4 + TCPOPT_SACK_PERMIT_HDR = 0x1010402 + TCPOPT_SIGNATURE = 0x13 + TCPOPT_TIMESTAMP = 0x8 + TCPOPT_TSTAMP_HDR = 0x101080a + TCPOPT_WINDOW = 0x3 + TCP_INFO = 0x9 + TCP_MAXSEG = 0x2 + TCP_MAXWIN = 0xffff + TCP_MAX_SACK = 0x3 + TCP_MAX_WINSHIFT = 0xe + TCP_MD5SIG = 0x4 + TCP_MSS = 0x200 + TCP_NODELAY = 0x1 + TCP_NOPUSH = 0x10 + TCP_SACKHOLE_LIMIT = 0x80 + TCP_SACK_ENABLE = 0x8 + TCSAFLUSH = 0x2 + TIMER_ABSTIME = 0x1 + TIMER_RELTIME = 0x0 + TIOCCBRK = 0x2000747a + TIOCCDTR = 0x20007478 + TIOCCHKVERAUTH = 0x2000741e + TIOCCLRVERAUTH = 0x2000741d + TIOCCONS = 0x80047462 + TIOCDRAIN = 0x2000745e + TIOCEXCL = 0x2000740d + TIOCEXT = 0x80047460 + TIOCFLAG_CLOCAL = 0x2 + TIOCFLAG_CRTSCTS = 0x4 + TIOCFLAG_MDMBUF = 0x8 + TIOCFLAG_PPS = 0x10 + TIOCFLAG_SOFTCAR = 0x1 + TIOCFLUSH = 0x80047410 + TIOCGETA = 0x402c7413 + TIOCGETD = 0x4004741a + TIOCGFLAGS = 0x4004745d + TIOCGPGRP = 0x40047477 + TIOCGSID = 0x40047463 + TIOCGTSTAMP = 0x4010745b + TIOCGWINSZ = 0x40087468 + TIOCMBIC = 0x8004746b + TIOCMBIS = 0x8004746c + TIOCMGET = 0x4004746a + TIOCMODG = 0x4004746a + TIOCMODS = 0x8004746d + TIOCMSET = 0x8004746d + TIOCM_CAR = 0x40 + TIOCM_CD = 0x40 + TIOCM_CTS = 0x20 + TIOCM_DSR = 0x100 + TIOCM_DTR = 0x2 + TIOCM_LE = 0x1 + TIOCM_RI = 0x80 + TIOCM_RNG = 0x80 + TIOCM_RTS = 0x4 + TIOCM_SR = 0x10 + TIOCM_ST = 0x8 + TIOCNOTTY = 0x20007471 + TIOCNXCL = 0x2000740e + TIOCOUTQ = 0x40047473 + TIOCPKT = 0x80047470 + TIOCPKT_DATA = 0x0 + TIOCPKT_DOSTOP = 0x20 + TIOCPKT_FLUSHREAD = 0x1 + TIOCPKT_FLUSHWRITE = 0x2 + TIOCPKT_IOCTL = 0x40 + TIOCPKT_NOSTOP = 0x10 + TIOCPKT_START = 0x8 + TIOCPKT_STOP = 0x4 + TIOCREMOTE = 0x80047469 + TIOCSBRK = 0x2000747b + TIOCSCTTY = 0x20007461 + TIOCSDTR = 0x20007479 + TIOCSETA = 0x802c7414 + TIOCSETAF = 0x802c7416 + TIOCSETAW = 0x802c7415 + TIOCSETD = 0x8004741b + TIOCSETVERAUTH = 0x8004741c + TIOCSFLAGS = 0x8004745c + TIOCSIG = 0x8004745f + TIOCSPGRP = 0x80047476 + TIOCSTART = 0x2000746e + TIOCSTAT = 0x20007465 + TIOCSTOP = 0x2000746f + TIOCSTSTAMP = 0x8008745a + TIOCSWINSZ = 0x80087467 + TIOCUCNTL = 0x80047466 + TIOCUCNTL_CBRK = 0x7a + TIOCUCNTL_SBRK = 0x7b + TOSTOP = 0x400000 + UTIME_NOW = -0x2 + UTIME_OMIT = -0x1 + VDISCARD = 0xf + VDSUSP = 0xb + VEOF = 0x0 + VEOL = 0x1 + VEOL2 = 0x2 + VERASE = 0x3 + VINTR = 0x8 + VKILL = 0x5 + VLNEXT = 0xe + VMIN = 0x10 + VM_ANONMIN = 0x7 + VM_LOADAVG = 0x2 + VM_MALLOC_CONF = 0xc + VM_MAXID = 0xd + VM_MAXSLP = 0xa + VM_METER = 0x1 + VM_NKMEMPAGES = 0x6 + VM_PSSTRINGS = 0x3 + VM_SWAPENCRYPT = 0x5 + VM_USPACE = 0xb + VM_UVMEXP = 0x4 + VM_VNODEMIN = 0x9 + VM_VTEXTMIN = 0x8 + VQUIT = 0x9 + VREPRINT = 0x6 + VSTART = 0xc + VSTATUS = 0x12 + VSTOP = 0xd + VSUSP = 0xa + VTIME = 0x11 + VWERASE = 0x4 + WALTSIG = 0x4 + WCONTINUED = 0x8 + WCOREFLAG = 0x80 + WNOHANG = 0x1 + WUNTRACED = 0x2 + XCASE = 0x1000000 +) + +// Errors +const ( + E2BIG = syscall.Errno(0x7) + EACCES = syscall.Errno(0xd) + EADDRINUSE = syscall.Errno(0x30) + EADDRNOTAVAIL = syscall.Errno(0x31) + EAFNOSUPPORT = syscall.Errno(0x2f) + EAGAIN = syscall.Errno(0x23) + EALREADY = syscall.Errno(0x25) + EAUTH = syscall.Errno(0x50) + EBADF = syscall.Errno(0x9) + EBADMSG = syscall.Errno(0x5c) + EBADRPC = syscall.Errno(0x48) + EBUSY = syscall.Errno(0x10) + ECANCELED = syscall.Errno(0x58) + ECHILD = syscall.Errno(0xa) + ECONNABORTED = syscall.Errno(0x35) + ECONNREFUSED = syscall.Errno(0x3d) + ECONNRESET = syscall.Errno(0x36) + EDEADLK = syscall.Errno(0xb) + EDESTADDRREQ = syscall.Errno(0x27) + EDOM = syscall.Errno(0x21) + EDQUOT = syscall.Errno(0x45) + EEXIST = syscall.Errno(0x11) + EFAULT = syscall.Errno(0xe) + EFBIG = syscall.Errno(0x1b) + EFTYPE = syscall.Errno(0x4f) + EHOSTDOWN = syscall.Errno(0x40) + EHOSTUNREACH = syscall.Errno(0x41) + EIDRM = syscall.Errno(0x59) + EILSEQ = syscall.Errno(0x54) + EINPROGRESS = syscall.Errno(0x24) + EINTR = syscall.Errno(0x4) + EINVAL = syscall.Errno(0x16) + EIO = syscall.Errno(0x5) + EIPSEC = syscall.Errno(0x52) + EISCONN = syscall.Errno(0x38) + EISDIR = syscall.Errno(0x15) + ELAST = syscall.Errno(0x5f) + ELOOP = syscall.Errno(0x3e) + EMEDIUMTYPE = syscall.Errno(0x56) + EMFILE = syscall.Errno(0x18) + EMLINK = syscall.Errno(0x1f) + EMSGSIZE = syscall.Errno(0x28) + ENAMETOOLONG = syscall.Errno(0x3f) + ENEEDAUTH = syscall.Errno(0x51) + ENETDOWN = syscall.Errno(0x32) + ENETRESET = syscall.Errno(0x34) + ENETUNREACH = syscall.Errno(0x33) + ENFILE = syscall.Errno(0x17) + ENOATTR = syscall.Errno(0x53) + ENOBUFS = syscall.Errno(0x37) + ENODEV = syscall.Errno(0x13) + ENOENT = syscall.Errno(0x2) + ENOEXEC = syscall.Errno(0x8) + ENOLCK = syscall.Errno(0x4d) + ENOMEDIUM = syscall.Errno(0x55) + ENOMEM = syscall.Errno(0xc) + ENOMSG = syscall.Errno(0x5a) + ENOPROTOOPT = syscall.Errno(0x2a) + ENOSPC = syscall.Errno(0x1c) + ENOSYS = syscall.Errno(0x4e) + ENOTBLK = syscall.Errno(0xf) + ENOTCONN = syscall.Errno(0x39) + ENOTDIR = syscall.Errno(0x14) + ENOTEMPTY = syscall.Errno(0x42) + ENOTRECOVERABLE = syscall.Errno(0x5d) + ENOTSOCK = syscall.Errno(0x26) + ENOTSUP = syscall.Errno(0x5b) + ENOTTY = syscall.Errno(0x19) + ENXIO = syscall.Errno(0x6) + EOPNOTSUPP = syscall.Errno(0x2d) + EOVERFLOW = syscall.Errno(0x57) + EOWNERDEAD = syscall.Errno(0x5e) + EPERM = syscall.Errno(0x1) + EPFNOSUPPORT = syscall.Errno(0x2e) + EPIPE = syscall.Errno(0x20) + EPROCLIM = syscall.Errno(0x43) + EPROCUNAVAIL = syscall.Errno(0x4c) + EPROGMISMATCH = syscall.Errno(0x4b) + EPROGUNAVAIL = syscall.Errno(0x4a) + EPROTO = syscall.Errno(0x5f) + EPROTONOSUPPORT = syscall.Errno(0x2b) + EPROTOTYPE = syscall.Errno(0x29) + ERANGE = syscall.Errno(0x22) + EREMOTE = syscall.Errno(0x47) + EROFS = syscall.Errno(0x1e) + ERPCMISMATCH = syscall.Errno(0x49) + ESHUTDOWN = syscall.Errno(0x3a) + ESOCKTNOSUPPORT = syscall.Errno(0x2c) + ESPIPE = syscall.Errno(0x1d) + ESRCH = syscall.Errno(0x3) + ESTALE = syscall.Errno(0x46) + ETIMEDOUT = syscall.Errno(0x3c) + ETOOMANYREFS = syscall.Errno(0x3b) + ETXTBSY = syscall.Errno(0x1a) + EUSERS = syscall.Errno(0x44) + EWOULDBLOCK = syscall.Errno(0x23) + EXDEV = syscall.Errno(0x12) +) + +// Signals +const ( + SIGABRT = syscall.Signal(0x6) + SIGALRM = syscall.Signal(0xe) + SIGBUS = syscall.Signal(0xa) + SIGCHLD = syscall.Signal(0x14) + SIGCONT = syscall.Signal(0x13) + SIGEMT = syscall.Signal(0x7) + SIGFPE = syscall.Signal(0x8) + SIGHUP = syscall.Signal(0x1) + SIGILL = syscall.Signal(0x4) + SIGINFO = syscall.Signal(0x1d) + SIGINT = syscall.Signal(0x2) + SIGIO = syscall.Signal(0x17) + SIGIOT = syscall.Signal(0x6) + SIGKILL = syscall.Signal(0x9) + SIGPIPE = syscall.Signal(0xd) + SIGPROF = syscall.Signal(0x1b) + SIGQUIT = syscall.Signal(0x3) + SIGSEGV = syscall.Signal(0xb) + SIGSTOP = syscall.Signal(0x11) + SIGSYS = syscall.Signal(0xc) + SIGTERM = syscall.Signal(0xf) + SIGTHR = syscall.Signal(0x20) + SIGTRAP = syscall.Signal(0x5) + SIGTSTP = syscall.Signal(0x12) + SIGTTIN = syscall.Signal(0x15) + SIGTTOU = syscall.Signal(0x16) + SIGURG = syscall.Signal(0x10) + SIGUSR1 = syscall.Signal(0x1e) + SIGUSR2 = syscall.Signal(0x1f) + SIGVTALRM = syscall.Signal(0x1a) + SIGWINCH = syscall.Signal(0x1c) + SIGXCPU = syscall.Signal(0x18) + SIGXFSZ = syscall.Signal(0x19) +) + +// Error table +var errorList = [...]struct { + num syscall.Errno + name string + desc string +}{ + {1, "EPERM", "operation not permitted"}, + {2, "ENOENT", "no such file or directory"}, + {3, "ESRCH", "no such process"}, + {4, "EINTR", "interrupted system call"}, + {5, "EIO", "input/output error"}, + {6, "ENXIO", "device not configured"}, + {7, "E2BIG", "argument list too long"}, + {8, "ENOEXEC", "exec format error"}, + {9, "EBADF", "bad file descriptor"}, + {10, "ECHILD", "no child processes"}, + {11, "EDEADLK", "resource deadlock avoided"}, + {12, "ENOMEM", "cannot allocate memory"}, + {13, "EACCES", "permission denied"}, + {14, "EFAULT", "bad address"}, + {15, "ENOTBLK", "block device required"}, + {16, "EBUSY", "device busy"}, + {17, "EEXIST", "file exists"}, + {18, "EXDEV", "cross-device link"}, + {19, "ENODEV", "operation not supported by device"}, + {20, "ENOTDIR", "not a directory"}, + {21, "EISDIR", "is a directory"}, + {22, "EINVAL", "invalid argument"}, + {23, "ENFILE", "too many open files in system"}, + {24, "EMFILE", "too many open files"}, + {25, "ENOTTY", "inappropriate ioctl for device"}, + {26, "ETXTBSY", "text file busy"}, + {27, "EFBIG", "file too large"}, + {28, "ENOSPC", "no space left on device"}, + {29, "ESPIPE", "illegal seek"}, + {30, "EROFS", "read-only file system"}, + {31, "EMLINK", "too many links"}, + {32, "EPIPE", "broken pipe"}, + {33, "EDOM", "numerical argument out of domain"}, + {34, "ERANGE", "result too large"}, + {35, "EAGAIN", "resource temporarily unavailable"}, + {36, "EINPROGRESS", "operation now in progress"}, + {37, "EALREADY", "operation already in progress"}, + {38, "ENOTSOCK", "socket operation on non-socket"}, + {39, "EDESTADDRREQ", "destination address required"}, + {40, "EMSGSIZE", "message too long"}, + {41, "EPROTOTYPE", "protocol wrong type for socket"}, + {42, "ENOPROTOOPT", "protocol not available"}, + {43, "EPROTONOSUPPORT", "protocol not supported"}, + {44, "ESOCKTNOSUPPORT", "socket type not supported"}, + {45, "EOPNOTSUPP", "operation not supported"}, + {46, "EPFNOSUPPORT", "protocol family not supported"}, + {47, "EAFNOSUPPORT", "address family not supported by protocol family"}, + {48, "EADDRINUSE", "address already in use"}, + {49, "EADDRNOTAVAIL", "can't assign requested address"}, + {50, "ENETDOWN", "network is down"}, + {51, "ENETUNREACH", "network is unreachable"}, + {52, "ENETRESET", "network dropped connection on reset"}, + {53, "ECONNABORTED", "software caused connection abort"}, + {54, "ECONNRESET", "connection reset by peer"}, + {55, "ENOBUFS", "no buffer space available"}, + {56, "EISCONN", "socket is already connected"}, + {57, "ENOTCONN", "socket is not connected"}, + {58, "ESHUTDOWN", "can't send after socket shutdown"}, + {59, "ETOOMANYREFS", "too many references: can't splice"}, + {60, "ETIMEDOUT", "operation timed out"}, + {61, "ECONNREFUSED", "connection refused"}, + {62, "ELOOP", "too many levels of symbolic links"}, + {63, "ENAMETOOLONG", "file name too long"}, + {64, "EHOSTDOWN", "host is down"}, + {65, "EHOSTUNREACH", "no route to host"}, + {66, "ENOTEMPTY", "directory not empty"}, + {67, "EPROCLIM", "too many processes"}, + {68, "EUSERS", "too many users"}, + {69, "EDQUOT", "disk quota exceeded"}, + {70, "ESTALE", "stale NFS file handle"}, + {71, "EREMOTE", "too many levels of remote in path"}, + {72, "EBADRPC", "RPC struct is bad"}, + {73, "ERPCMISMATCH", "RPC version wrong"}, + {74, "EPROGUNAVAIL", "RPC program not available"}, + {75, "EPROGMISMATCH", "program version wrong"}, + {76, "EPROCUNAVAIL", "bad procedure for program"}, + {77, "ENOLCK", "no locks available"}, + {78, "ENOSYS", "function not implemented"}, + {79, "EFTYPE", "inappropriate file type or format"}, + {80, "EAUTH", "authentication error"}, + {81, "ENEEDAUTH", "need authenticator"}, + {82, "EIPSEC", "IPsec processing failure"}, + {83, "ENOATTR", "attribute not found"}, + {84, "EILSEQ", "illegal byte sequence"}, + {85, "ENOMEDIUM", "no medium found"}, + {86, "EMEDIUMTYPE", "wrong medium type"}, + {87, "EOVERFLOW", "value too large to be stored in data type"}, + {88, "ECANCELED", "operation canceled"}, + {89, "EIDRM", "identifier removed"}, + {90, "ENOMSG", "no message of desired type"}, + {91, "ENOTSUP", "not supported"}, + {92, "EBADMSG", "bad message"}, + {93, "ENOTRECOVERABLE", "state not recoverable"}, + {94, "EOWNERDEAD", "previous owner died"}, + {95, "ELAST", "protocol error"}, +} + +// Signal table +var signalList = [...]struct { + num syscall.Signal + name string + desc string +}{ + {1, "SIGHUP", "hangup"}, + {2, "SIGINT", "interrupt"}, + {3, "SIGQUIT", "quit"}, + {4, "SIGILL", "illegal instruction"}, + {5, "SIGTRAP", "trace/BPT trap"}, + {6, "SIGABRT", "abort trap"}, + {7, "SIGEMT", "EMT trap"}, + {8, "SIGFPE", "floating point exception"}, + {9, "SIGKILL", "killed"}, + {10, "SIGBUS", "bus error"}, + {11, "SIGSEGV", "segmentation fault"}, + {12, "SIGSYS", "bad system call"}, + {13, "SIGPIPE", "broken pipe"}, + {14, "SIGALRM", "alarm clock"}, + {15, "SIGTERM", "terminated"}, + {16, "SIGURG", "urgent I/O condition"}, + {17, "SIGSTOP", "suspended (signal)"}, + {18, "SIGTSTP", "suspended"}, + {19, "SIGCONT", "continued"}, + {20, "SIGCHLD", "child exited"}, + {21, "SIGTTIN", "stopped (tty input)"}, + {22, "SIGTTOU", "stopped (tty output)"}, + {23, "SIGIO", "I/O possible"}, + {24, "SIGXCPU", "cputime limit exceeded"}, + {25, "SIGXFSZ", "filesize limit exceeded"}, + {26, "SIGVTALRM", "virtual timer expired"}, + {27, "SIGPROF", "profiling timer expired"}, + {28, "SIGWINCH", "window size changes"}, + {29, "SIGINFO", "information request"}, + {30, "SIGUSR1", "user defined signal 1"}, + {31, "SIGUSR2", "user defined signal 2"}, + {32, "SIGTHR", "thread AST"}, +} diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_riscv64.go new file mode 100644 index 0000000..13d4030 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_riscv64.go @@ -0,0 +1,1904 @@ +// mkerrors.sh -m64 +// Code generated by the command above; see README.md. DO NOT EDIT. + +//go:build riscv64 && openbsd +// +build riscv64,openbsd + +// Code generated by cmd/cgo -godefs; DO NOT EDIT. +// cgo -godefs -- -m64 _const.go + +package unix + +import "syscall" + +const ( + AF_APPLETALK = 0x10 + AF_BLUETOOTH = 0x20 + AF_CCITT = 0xa + AF_CHAOS = 0x5 + AF_CNT = 0x15 + AF_COIP = 0x14 + AF_DATAKIT = 0x9 + AF_DECnet = 0xc + AF_DLI = 0xd + AF_E164 = 0x1a + AF_ECMA = 0x8 + AF_ENCAP = 0x1c + AF_HYLINK = 0xf + AF_IMPLINK = 0x3 + AF_INET = 0x2 + AF_INET6 = 0x18 + AF_IPX = 0x17 + AF_ISDN = 0x1a + AF_ISO = 0x7 + AF_KEY = 0x1e + AF_LAT = 0xe + AF_LINK = 0x12 + AF_LOCAL = 0x1 + AF_MAX = 0x24 + AF_MPLS = 0x21 + AF_NATM = 0x1b + AF_NS = 0x6 + AF_OSI = 0x7 + AF_PUP = 0x4 + AF_ROUTE = 0x11 + AF_SIP = 0x1d + AF_SNA = 0xb + AF_UNIX = 0x1 + AF_UNSPEC = 0x0 + ALTWERASE = 0x200 + ARPHRD_ETHER = 0x1 + ARPHRD_FRELAY = 0xf + ARPHRD_IEEE1394 = 0x18 + ARPHRD_IEEE802 = 0x6 + B0 = 0x0 + B110 = 0x6e + B115200 = 0x1c200 + B1200 = 0x4b0 + B134 = 0x86 + B14400 = 0x3840 + B150 = 0x96 + B1800 = 0x708 + B19200 = 0x4b00 + B200 = 0xc8 + B230400 = 0x38400 + B2400 = 0x960 + B28800 = 0x7080 + B300 = 0x12c + B38400 = 0x9600 + B4800 = 0x12c0 + B50 = 0x32 + B57600 = 0xe100 + B600 = 0x258 + B7200 = 0x1c20 + B75 = 0x4b + B76800 = 0x12c00 + B9600 = 0x2580 + BIOCFLUSH = 0x20004268 + BIOCGBLEN = 0x40044266 + BIOCGDIRFILT = 0x4004427c + BIOCGDLT = 0x4004426a + BIOCGDLTLIST = 0xc010427b + BIOCGETIF = 0x4020426b + BIOCGFILDROP = 0x40044278 + BIOCGHDRCMPLT = 0x40044274 + BIOCGRSIG = 0x40044273 + BIOCGRTIMEOUT = 0x4010426e + BIOCGSTATS = 0x4008426f + BIOCIMMEDIATE = 0x80044270 + BIOCLOCK = 0x20004276 + BIOCPROMISC = 0x20004269 + BIOCSBLEN = 0xc0044266 + BIOCSDIRFILT = 0x8004427d + BIOCSDLT = 0x8004427a + BIOCSETF = 0x80104267 + BIOCSETIF = 0x8020426c + BIOCSETWF = 0x80104277 + BIOCSFILDROP = 0x80044279 + BIOCSHDRCMPLT = 0x80044275 + BIOCSRSIG = 0x80044272 + BIOCSRTIMEOUT = 0x8010426d + BIOCVERSION = 0x40044271 + BPF_A = 0x10 + BPF_ABS = 0x20 + BPF_ADD = 0x0 + BPF_ALIGNMENT = 0x4 + BPF_ALU = 0x4 + BPF_AND = 0x50 + BPF_B = 0x10 + BPF_DIRECTION_IN = 0x1 + BPF_DIRECTION_OUT = 0x2 + BPF_DIV = 0x30 + BPF_FILDROP_CAPTURE = 0x1 + BPF_FILDROP_DROP = 0x2 + BPF_FILDROP_PASS = 0x0 + BPF_F_DIR_IN = 0x10 + BPF_F_DIR_MASK = 0x30 + BPF_F_DIR_OUT = 0x20 + BPF_F_DIR_SHIFT = 0x4 + BPF_F_FLOWID = 0x8 + BPF_F_PRI_MASK = 0x7 + BPF_H = 0x8 + BPF_IMM = 0x0 + BPF_IND = 0x40 + BPF_JA = 0x0 + BPF_JEQ = 0x10 + BPF_JGE = 0x30 + BPF_JGT = 0x20 + BPF_JMP = 0x5 + BPF_JSET = 0x40 + BPF_K = 0x0 + BPF_LD = 0x0 + BPF_LDX = 0x1 + BPF_LEN = 0x80 + BPF_LSH = 0x60 + BPF_MAJOR_VERSION = 0x1 + BPF_MAXBUFSIZE = 0x200000 + BPF_MAXINSNS = 0x200 + BPF_MEM = 0x60 + BPF_MEMWORDS = 0x10 + BPF_MINBUFSIZE = 0x20 + BPF_MINOR_VERSION = 0x1 + BPF_MISC = 0x7 + BPF_MSH = 0xa0 + BPF_MUL = 0x20 + BPF_NEG = 0x80 + BPF_OR = 0x40 + BPF_RELEASE = 0x30bb6 + BPF_RET = 0x6 + BPF_RND = 0xc0 + BPF_RSH = 0x70 + BPF_ST = 0x2 + BPF_STX = 0x3 + BPF_SUB = 0x10 + BPF_TAX = 0x0 + BPF_TXA = 0x80 + BPF_W = 0x0 + BPF_X = 0x8 + BRKINT = 0x2 + CFLUSH = 0xf + CLOCAL = 0x8000 + CLOCK_BOOTTIME = 0x6 + CLOCK_MONOTONIC = 0x3 + CLOCK_PROCESS_CPUTIME_ID = 0x2 + CLOCK_REALTIME = 0x0 + CLOCK_THREAD_CPUTIME_ID = 0x4 + CLOCK_UPTIME = 0x5 + CPUSTATES = 0x6 + CP_IDLE = 0x5 + CP_INTR = 0x4 + CP_NICE = 0x1 + CP_SPIN = 0x3 + CP_SYS = 0x2 + CP_USER = 0x0 + CREAD = 0x800 + CRTSCTS = 0x10000 + CS5 = 0x0 + CS6 = 0x100 + CS7 = 0x200 + CS8 = 0x300 + CSIZE = 0x300 + CSTART = 0x11 + CSTATUS = 0xff + CSTOP = 0x13 + CSTOPB = 0x400 + CSUSP = 0x1a + CTL_HW = 0x6 + CTL_KERN = 0x1 + CTL_MAXNAME = 0xc + CTL_NET = 0x4 + DIOCADDQUEUE = 0xc110445d + DIOCADDRULE = 0xcd604404 + DIOCADDSTATE = 0xc1084425 + DIOCCHANGERULE = 0xcd60441a + DIOCCLRIFFLAG = 0xc028445a + DIOCCLRSRCNODES = 0x20004455 + DIOCCLRSTATES = 0xc0e04412 + DIOCCLRSTATUS = 0xc0284416 + DIOCGETLIMIT = 0xc0084427 + DIOCGETQSTATS = 0xc1204460 + DIOCGETQUEUE = 0xc110445f + DIOCGETQUEUES = 0xc110445e + DIOCGETRULE = 0xcd604407 + DIOCGETRULES = 0xcd604406 + DIOCGETRULESET = 0xc444443b + DIOCGETRULESETS = 0xc444443a + DIOCGETSRCNODES = 0xc0104454 + DIOCGETSTATE = 0xc1084413 + DIOCGETSTATES = 0xc0104419 + DIOCGETSTATUS = 0xc1e84415 + DIOCGETSYNFLWATS = 0xc0084463 + DIOCGETTIMEOUT = 0xc008441e + DIOCIGETIFACES = 0xc0284457 + DIOCKILLSRCNODES = 0xc080445b + DIOCKILLSTATES = 0xc0e04429 + DIOCNATLOOK = 0xc0504417 + DIOCOSFPADD = 0xc088444f + DIOCOSFPFLUSH = 0x2000444e + DIOCOSFPGET = 0xc0884450 + DIOCRADDADDRS = 0xc4504443 + DIOCRADDTABLES = 0xc450443d + DIOCRCLRADDRS = 0xc4504442 + DIOCRCLRASTATS = 0xc4504448 + DIOCRCLRTABLES = 0xc450443c + DIOCRCLRTSTATS = 0xc4504441 + DIOCRDELADDRS = 0xc4504444 + DIOCRDELTABLES = 0xc450443e + DIOCRGETADDRS = 0xc4504446 + DIOCRGETASTATS = 0xc4504447 + DIOCRGETTABLES = 0xc450443f + DIOCRGETTSTATS = 0xc4504440 + DIOCRINADEFINE = 0xc450444d + DIOCRSETADDRS = 0xc4504445 + DIOCRSETTFLAGS = 0xc450444a + DIOCRTSTADDRS = 0xc4504449 + DIOCSETDEBUG = 0xc0044418 + DIOCSETHOSTID = 0xc0044456 + DIOCSETIFFLAG = 0xc0284459 + DIOCSETLIMIT = 0xc0084428 + DIOCSETREASS = 0xc004445c + DIOCSETSTATUSIF = 0xc0284414 + DIOCSETSYNCOOKIES = 0xc0014462 + DIOCSETSYNFLWATS = 0xc0084461 + DIOCSETTIMEOUT = 0xc008441d + DIOCSTART = 0x20004401 + DIOCSTOP = 0x20004402 + DIOCXBEGIN = 0xc0104451 + DIOCXCOMMIT = 0xc0104452 + DIOCXROLLBACK = 0xc0104453 + DLT_ARCNET = 0x7 + DLT_ATM_RFC1483 = 0xb + DLT_AX25 = 0x3 + DLT_CHAOS = 0x5 + DLT_C_HDLC = 0x68 + DLT_EN10MB = 0x1 + DLT_EN3MB = 0x2 + DLT_ENC = 0xd + DLT_FDDI = 0xa + DLT_IEEE802 = 0x6 + DLT_IEEE802_11 = 0x69 + DLT_IEEE802_11_RADIO = 0x7f + DLT_LOOP = 0xc + DLT_MPLS = 0xdb + DLT_NULL = 0x0 + DLT_OPENFLOW = 0x10b + DLT_PFLOG = 0x75 + DLT_PFSYNC = 0x12 + DLT_PPP = 0x9 + DLT_PPP_BSDOS = 0x10 + DLT_PPP_ETHER = 0x33 + DLT_PPP_SERIAL = 0x32 + DLT_PRONET = 0x4 + DLT_RAW = 0xe + DLT_SLIP = 0x8 + DLT_SLIP_BSDOS = 0xf + DLT_USBPCAP = 0xf9 + DLT_USER0 = 0x93 + DLT_USER1 = 0x94 + DLT_USER10 = 0x9d + DLT_USER11 = 0x9e + DLT_USER12 = 0x9f + DLT_USER13 = 0xa0 + DLT_USER14 = 0xa1 + DLT_USER15 = 0xa2 + DLT_USER2 = 0x95 + DLT_USER3 = 0x96 + DLT_USER4 = 0x97 + DLT_USER5 = 0x98 + DLT_USER6 = 0x99 + DLT_USER7 = 0x9a + DLT_USER8 = 0x9b + DLT_USER9 = 0x9c + DT_BLK = 0x6 + DT_CHR = 0x2 + DT_DIR = 0x4 + DT_FIFO = 0x1 + DT_LNK = 0xa + DT_REG = 0x8 + DT_SOCK = 0xc + DT_UNKNOWN = 0x0 + ECHO = 0x8 + ECHOCTL = 0x40 + ECHOE = 0x2 + ECHOK = 0x4 + ECHOKE = 0x1 + ECHONL = 0x10 + ECHOPRT = 0x20 + EMT_TAGOVF = 0x1 + EMUL_ENABLED = 0x1 + EMUL_NATIVE = 0x2 + ENDRUNDISC = 0x9 + ETH64_8021_RSVD_MASK = 0xfffffffffff0 + ETH64_8021_RSVD_PREFIX = 0x180c2000000 + ETHERMIN = 0x2e + ETHERMTU = 0x5dc + ETHERTYPE_8023 = 0x4 + ETHERTYPE_AARP = 0x80f3 + ETHERTYPE_ACCTON = 0x8390 + ETHERTYPE_AEONIC = 0x8036 + ETHERTYPE_ALPHA = 0x814a + ETHERTYPE_AMBER = 0x6008 + ETHERTYPE_AMOEBA = 0x8145 + ETHERTYPE_AOE = 0x88a2 + ETHERTYPE_APOLLO = 0x80f7 + ETHERTYPE_APOLLODOMAIN = 0x8019 + ETHERTYPE_APPLETALK = 0x809b + ETHERTYPE_APPLITEK = 0x80c7 + ETHERTYPE_ARGONAUT = 0x803a + ETHERTYPE_ARP = 0x806 + ETHERTYPE_AT = 0x809b + ETHERTYPE_ATALK = 0x809b + ETHERTYPE_ATOMIC = 0x86df + ETHERTYPE_ATT = 0x8069 + ETHERTYPE_ATTSTANFORD = 0x8008 + ETHERTYPE_AUTOPHON = 0x806a + ETHERTYPE_AXIS = 0x8856 + ETHERTYPE_BCLOOP = 0x9003 + ETHERTYPE_BOFL = 0x8102 + ETHERTYPE_CABLETRON = 0x7034 + ETHERTYPE_CHAOS = 0x804 + ETHERTYPE_COMDESIGN = 0x806c + ETHERTYPE_COMPUGRAPHIC = 0x806d + ETHERTYPE_COUNTERPOINT = 0x8062 + ETHERTYPE_CRONUS = 0x8004 + ETHERTYPE_CRONUSVLN = 0x8003 + ETHERTYPE_DCA = 0x1234 + ETHERTYPE_DDE = 0x807b + ETHERTYPE_DEBNI = 0xaaaa + ETHERTYPE_DECAM = 0x8048 + ETHERTYPE_DECCUST = 0x6006 + ETHERTYPE_DECDIAG = 0x6005 + ETHERTYPE_DECDNS = 0x803c + ETHERTYPE_DECDTS = 0x803e + ETHERTYPE_DECEXPER = 0x6000 + ETHERTYPE_DECLAST = 0x8041 + ETHERTYPE_DECLTM = 0x803f + ETHERTYPE_DECMUMPS = 0x6009 + ETHERTYPE_DECNETBIOS = 0x8040 + ETHERTYPE_DELTACON = 0x86de + ETHERTYPE_DIDDLE = 0x4321 + ETHERTYPE_DLOG1 = 0x660 + ETHERTYPE_DLOG2 = 0x661 + ETHERTYPE_DN = 0x6003 + ETHERTYPE_DOGFIGHT = 0x1989 + ETHERTYPE_DSMD = 0x8039 + ETHERTYPE_EAPOL = 0x888e + ETHERTYPE_ECMA = 0x803 + ETHERTYPE_ENCRYPT = 0x803d + ETHERTYPE_ES = 0x805d + ETHERTYPE_EXCELAN = 0x8010 + ETHERTYPE_EXPERDATA = 0x8049 + ETHERTYPE_FLIP = 0x8146 + ETHERTYPE_FLOWCONTROL = 0x8808 + ETHERTYPE_FRARP = 0x808 + ETHERTYPE_GENDYN = 0x8068 + ETHERTYPE_HAYES = 0x8130 + ETHERTYPE_HIPPI_FP = 0x8180 + ETHERTYPE_HITACHI = 0x8820 + ETHERTYPE_HP = 0x8005 + ETHERTYPE_IEEEPUP = 0xa00 + ETHERTYPE_IEEEPUPAT = 0xa01 + ETHERTYPE_IMLBL = 0x4c42 + ETHERTYPE_IMLBLDIAG = 0x424c + ETHERTYPE_IP = 0x800 + ETHERTYPE_IPAS = 0x876c + ETHERTYPE_IPV6 = 0x86dd + ETHERTYPE_IPX = 0x8137 + ETHERTYPE_IPXNEW = 0x8037 + ETHERTYPE_KALPANA = 0x8582 + ETHERTYPE_LANBRIDGE = 0x8038 + ETHERTYPE_LANPROBE = 0x8888 + ETHERTYPE_LAT = 0x6004 + ETHERTYPE_LBACK = 0x9000 + ETHERTYPE_LITTLE = 0x8060 + ETHERTYPE_LLDP = 0x88cc + ETHERTYPE_LOGICRAFT = 0x8148 + ETHERTYPE_LOOPBACK = 0x9000 + ETHERTYPE_MACSEC = 0x88e5 + ETHERTYPE_MATRA = 0x807a + ETHERTYPE_MAX = 0xffff + ETHERTYPE_MERIT = 0x807c + ETHERTYPE_MICP = 0x873a + ETHERTYPE_MOPDL = 0x6001 + ETHERTYPE_MOPRC = 0x6002 + ETHERTYPE_MOTOROLA = 0x818d + ETHERTYPE_MPLS = 0x8847 + ETHERTYPE_MPLS_MCAST = 0x8848 + ETHERTYPE_MUMPS = 0x813f + ETHERTYPE_NBPCC = 0x3c04 + ETHERTYPE_NBPCLAIM = 0x3c09 + ETHERTYPE_NBPCLREQ = 0x3c05 + ETHERTYPE_NBPCLRSP = 0x3c06 + ETHERTYPE_NBPCREQ = 0x3c02 + ETHERTYPE_NBPCRSP = 0x3c03 + ETHERTYPE_NBPDG = 0x3c07 + ETHERTYPE_NBPDGB = 0x3c08 + ETHERTYPE_NBPDLTE = 0x3c0a + ETHERTYPE_NBPRAR = 0x3c0c + ETHERTYPE_NBPRAS = 0x3c0b + ETHERTYPE_NBPRST = 0x3c0d + ETHERTYPE_NBPSCD = 0x3c01 + ETHERTYPE_NBPVCD = 0x3c00 + ETHERTYPE_NBS = 0x802 + ETHERTYPE_NCD = 0x8149 + ETHERTYPE_NESTAR = 0x8006 + ETHERTYPE_NETBEUI = 0x8191 + ETHERTYPE_NHRP = 0x2001 + ETHERTYPE_NOVELL = 0x8138 + ETHERTYPE_NS = 0x600 + ETHERTYPE_NSAT = 0x601 + ETHERTYPE_NSCOMPAT = 0x807 + ETHERTYPE_NSH = 0x984f + ETHERTYPE_NTRAILER = 0x10 + ETHERTYPE_OS9 = 0x7007 + ETHERTYPE_OS9NET = 0x7009 + ETHERTYPE_PACER = 0x80c6 + ETHERTYPE_PBB = 0x88e7 + ETHERTYPE_PCS = 0x4242 + ETHERTYPE_PLANNING = 0x8044 + ETHERTYPE_PPP = 0x880b + ETHERTYPE_PPPOE = 0x8864 + ETHERTYPE_PPPOEDISC = 0x8863 + ETHERTYPE_PRIMENTS = 0x7031 + ETHERTYPE_PUP = 0x200 + ETHERTYPE_PUPAT = 0x200 + ETHERTYPE_QINQ = 0x88a8 + ETHERTYPE_RACAL = 0x7030 + ETHERTYPE_RATIONAL = 0x8150 + ETHERTYPE_RAWFR = 0x6559 + ETHERTYPE_RCL = 0x1995 + ETHERTYPE_RDP = 0x8739 + ETHERTYPE_RETIX = 0x80f2 + ETHERTYPE_REVARP = 0x8035 + ETHERTYPE_SCA = 0x6007 + ETHERTYPE_SECTRA = 0x86db + ETHERTYPE_SECUREDATA = 0x876d + ETHERTYPE_SGITW = 0x817e + ETHERTYPE_SG_BOUNCE = 0x8016 + ETHERTYPE_SG_DIAG = 0x8013 + ETHERTYPE_SG_NETGAMES = 0x8014 + ETHERTYPE_SG_RESV = 0x8015 + ETHERTYPE_SIMNET = 0x5208 + ETHERTYPE_SLOW = 0x8809 + ETHERTYPE_SNA = 0x80d5 + ETHERTYPE_SNMP = 0x814c + ETHERTYPE_SONIX = 0xfaf5 + ETHERTYPE_SPIDER = 0x809f + ETHERTYPE_SPRITE = 0x500 + ETHERTYPE_STP = 0x8181 + ETHERTYPE_TALARIS = 0x812b + ETHERTYPE_TALARISMC = 0x852b + ETHERTYPE_TCPCOMP = 0x876b + ETHERTYPE_TCPSM = 0x9002 + ETHERTYPE_TEC = 0x814f + ETHERTYPE_TIGAN = 0x802f + ETHERTYPE_TRAIL = 0x1000 + ETHERTYPE_TRANSETHER = 0x6558 + ETHERTYPE_TYMSHARE = 0x802e + ETHERTYPE_UBBST = 0x7005 + ETHERTYPE_UBDEBUG = 0x900 + ETHERTYPE_UBDIAGLOOP = 0x7002 + ETHERTYPE_UBDL = 0x7000 + ETHERTYPE_UBNIU = 0x7001 + ETHERTYPE_UBNMC = 0x7003 + ETHERTYPE_VALID = 0x1600 + ETHERTYPE_VARIAN = 0x80dd + ETHERTYPE_VAXELN = 0x803b + ETHERTYPE_VEECO = 0x8067 + ETHERTYPE_VEXP = 0x805b + ETHERTYPE_VGLAB = 0x8131 + ETHERTYPE_VINES = 0xbad + ETHERTYPE_VINESECHO = 0xbaf + ETHERTYPE_VINESLOOP = 0xbae + ETHERTYPE_VITAL = 0xff00 + ETHERTYPE_VLAN = 0x8100 + ETHERTYPE_VLTLMAN = 0x8080 + ETHERTYPE_VPROD = 0x805c + ETHERTYPE_VURESERVED = 0x8147 + ETHERTYPE_WATERLOO = 0x8130 + ETHERTYPE_WELLFLEET = 0x8103 + ETHERTYPE_X25 = 0x805 + ETHERTYPE_X75 = 0x801 + ETHERTYPE_XNSSM = 0x9001 + ETHERTYPE_XTP = 0x817d + ETHER_ADDR_LEN = 0x6 + ETHER_ALIGN = 0x2 + ETHER_CRC_LEN = 0x4 + ETHER_CRC_POLY_BE = 0x4c11db6 + ETHER_CRC_POLY_LE = 0xedb88320 + ETHER_HDR_LEN = 0xe + ETHER_MAX_DIX_LEN = 0x600 + ETHER_MAX_HARDMTU_LEN = 0xff9b + ETHER_MAX_LEN = 0x5ee + ETHER_MIN_LEN = 0x40 + ETHER_TYPE_LEN = 0x2 + ETHER_VLAN_ENCAP_LEN = 0x4 + EVFILT_AIO = -0x3 + EVFILT_DEVICE = -0x8 + EVFILT_EXCEPT = -0x9 + EVFILT_PROC = -0x5 + EVFILT_READ = -0x1 + EVFILT_SIGNAL = -0x6 + EVFILT_SYSCOUNT = 0x9 + EVFILT_TIMER = -0x7 + EVFILT_VNODE = -0x4 + EVFILT_WRITE = -0x2 + EVL_ENCAPLEN = 0x4 + EVL_PRIO_BITS = 0xd + EVL_PRIO_MAX = 0x7 + EVL_VLID_MASK = 0xfff + EVL_VLID_MAX = 0xffe + EVL_VLID_MIN = 0x1 + EVL_VLID_NULL = 0x0 + EV_ADD = 0x1 + EV_CLEAR = 0x20 + EV_DELETE = 0x2 + EV_DISABLE = 0x8 + EV_DISPATCH = 0x80 + EV_ENABLE = 0x4 + EV_EOF = 0x8000 + EV_ERROR = 0x4000 + EV_FLAG1 = 0x2000 + EV_ONESHOT = 0x10 + EV_RECEIPT = 0x40 + EV_SYSFLAGS = 0xf800 + EXTA = 0x4b00 + EXTB = 0x9600 + EXTPROC = 0x800 + FD_CLOEXEC = 0x1 + FD_SETSIZE = 0x400 + FLUSHO = 0x800000 + F_DUPFD = 0x0 + F_DUPFD_CLOEXEC = 0xa + F_GETFD = 0x1 + F_GETFL = 0x3 + F_GETLK = 0x7 + F_GETOWN = 0x5 + F_ISATTY = 0xb + F_OK = 0x0 + F_RDLCK = 0x1 + F_SETFD = 0x2 + F_SETFL = 0x4 + F_SETLK = 0x8 + F_SETLKW = 0x9 + F_SETOWN = 0x6 + F_UNLCK = 0x2 + F_WRLCK = 0x3 + HUPCL = 0x4000 + HW_MACHINE = 0x1 + ICANON = 0x100 + ICMP6_FILTER = 0x12 + ICRNL = 0x100 + IEXTEN = 0x400 + IFAN_ARRIVAL = 0x0 + IFAN_DEPARTURE = 0x1 + IFF_ALLMULTI = 0x200 + IFF_BROADCAST = 0x2 + IFF_CANTCHANGE = 0x8e52 + IFF_DEBUG = 0x4 + IFF_LINK0 = 0x1000 + IFF_LINK1 = 0x2000 + IFF_LINK2 = 0x4000 + IFF_LOOPBACK = 0x8 + IFF_MULTICAST = 0x8000 + IFF_NOARP = 0x80 + IFF_OACTIVE = 0x400 + IFF_POINTOPOINT = 0x10 + IFF_PROMISC = 0x100 + IFF_RUNNING = 0x40 + IFF_SIMPLEX = 0x800 + IFF_STATICARP = 0x20 + IFF_UP = 0x1 + IFNAMSIZ = 0x10 + IFT_1822 = 0x2 + IFT_A12MPPSWITCH = 0x82 + IFT_AAL2 = 0xbb + IFT_AAL5 = 0x31 + IFT_ADSL = 0x5e + IFT_AFLANE8023 = 0x3b + IFT_AFLANE8025 = 0x3c + IFT_ARAP = 0x58 + IFT_ARCNET = 0x23 + IFT_ARCNETPLUS = 0x24 + IFT_ASYNC = 0x54 + IFT_ATM = 0x25 + IFT_ATMDXI = 0x69 + IFT_ATMFUNI = 0x6a + IFT_ATMIMA = 0x6b + IFT_ATMLOGICAL = 0x50 + IFT_ATMRADIO = 0xbd + IFT_ATMSUBINTERFACE = 0x86 + IFT_ATMVCIENDPT = 0xc2 + IFT_ATMVIRTUAL = 0x95 + IFT_BGPPOLICYACCOUNTING = 0xa2 + IFT_BLUETOOTH = 0xf8 + IFT_BRIDGE = 0xd1 + IFT_BSC = 0x53 + IFT_CARP = 0xf7 + IFT_CCTEMUL = 0x3d + IFT_CEPT = 0x13 + IFT_CES = 0x85 + IFT_CHANNEL = 0x46 + IFT_CNR = 0x55 + IFT_COFFEE = 0x84 + IFT_COMPOSITELINK = 0x9b + IFT_DCN = 0x8d + IFT_DIGITALPOWERLINE = 0x8a + IFT_DIGITALWRAPPEROVERHEADCHANNEL = 0xba + IFT_DLSW = 0x4a + IFT_DOCSCABLEDOWNSTREAM = 0x80 + IFT_DOCSCABLEMACLAYER = 0x7f + IFT_DOCSCABLEUPSTREAM = 0x81 + IFT_DOCSCABLEUPSTREAMCHANNEL = 0xcd + IFT_DS0 = 0x51 + IFT_DS0BUNDLE = 0x52 + IFT_DS1FDL = 0xaa + IFT_DS3 = 0x1e + IFT_DTM = 0x8c + IFT_DUMMY = 0xf1 + IFT_DVBASILN = 0xac + IFT_DVBASIOUT = 0xad + IFT_DVBRCCDOWNSTREAM = 0x93 + IFT_DVBRCCMACLAYER = 0x92 + IFT_DVBRCCUPSTREAM = 0x94 + IFT_ECONET = 0xce + IFT_ENC = 0xf4 + IFT_EON = 0x19 + IFT_EPLRS = 0x57 + IFT_ESCON = 0x49 + IFT_ETHER = 0x6 + IFT_FAITH = 0xf3 + IFT_FAST = 0x7d + IFT_FASTETHER = 0x3e + IFT_FASTETHERFX = 0x45 + IFT_FDDI = 0xf + IFT_FIBRECHANNEL = 0x38 + IFT_FRAMERELAYINTERCONNECT = 0x3a + IFT_FRAMERELAYMPI = 0x5c + IFT_FRDLCIENDPT = 0xc1 + IFT_FRELAY = 0x20 + IFT_FRELAYDCE = 0x2c + IFT_FRF16MFRBUNDLE = 0xa3 + IFT_FRFORWARD = 0x9e + IFT_G703AT2MB = 0x43 + IFT_G703AT64K = 0x42 + IFT_GIF = 0xf0 + IFT_GIGABITETHERNET = 0x75 + IFT_GR303IDT = 0xb2 + IFT_GR303RDT = 0xb1 + IFT_H323GATEKEEPER = 0xa4 + IFT_H323PROXY = 0xa5 + IFT_HDH1822 = 0x3 + IFT_HDLC = 0x76 + IFT_HDSL2 = 0xa8 + IFT_HIPERLAN2 = 0xb7 + IFT_HIPPI = 0x2f + IFT_HIPPIINTERFACE = 0x39 + IFT_HOSTPAD = 0x5a + IFT_HSSI = 0x2e + IFT_HY = 0xe + IFT_IBM370PARCHAN = 0x48 + IFT_IDSL = 0x9a + IFT_IEEE1394 = 0x90 + IFT_IEEE80211 = 0x47 + IFT_IEEE80212 = 0x37 + IFT_IEEE8023ADLAG = 0xa1 + IFT_IFGSN = 0x91 + IFT_IMT = 0xbe + IFT_INFINIBAND = 0xc7 + IFT_INTERLEAVE = 0x7c + IFT_IP = 0x7e + IFT_IPFORWARD = 0x8e + IFT_IPOVERATM = 0x72 + IFT_IPOVERCDLC = 0x6d + IFT_IPOVERCLAW = 0x6e + IFT_IPSWITCH = 0x4e + IFT_ISDN = 0x3f + IFT_ISDNBASIC = 0x14 + IFT_ISDNPRIMARY = 0x15 + IFT_ISDNS = 0x4b + IFT_ISDNU = 0x4c + IFT_ISO88022LLC = 0x29 + IFT_ISO88023 = 0x7 + IFT_ISO88024 = 0x8 + IFT_ISO88025 = 0x9 + IFT_ISO88025CRFPINT = 0x62 + IFT_ISO88025DTR = 0x56 + IFT_ISO88025FIBER = 0x73 + IFT_ISO88026 = 0xa + IFT_ISUP = 0xb3 + IFT_L2VLAN = 0x87 + IFT_L3IPVLAN = 0x88 + IFT_L3IPXVLAN = 0x89 + IFT_LAPB = 0x10 + IFT_LAPD = 0x4d + IFT_LAPF = 0x77 + IFT_LINEGROUP = 0xd2 + IFT_LOCALTALK = 0x2a + IFT_LOOP = 0x18 + IFT_MBIM = 0xfa + IFT_MEDIAMAILOVERIP = 0x8b + IFT_MFSIGLINK = 0xa7 + IFT_MIOX25 = 0x26 + IFT_MODEM = 0x30 + IFT_MPC = 0x71 + IFT_MPLS = 0xa6 + IFT_MPLSTUNNEL = 0x96 + IFT_MSDSL = 0x8f + IFT_MVL = 0xbf + IFT_MYRINET = 0x63 + IFT_NFAS = 0xaf + IFT_NSIP = 0x1b + IFT_OPTICALCHANNEL = 0xc3 + IFT_OPTICALTRANSPORT = 0xc4 + IFT_OTHER = 0x1 + IFT_P10 = 0xc + IFT_P80 = 0xd + IFT_PARA = 0x22 + IFT_PFLOG = 0xf5 + IFT_PFLOW = 0xf9 + IFT_PFSYNC = 0xf6 + IFT_PLC = 0xae + IFT_PON155 = 0xcf + IFT_PON622 = 0xd0 + IFT_POS = 0xab + IFT_PPP = 0x17 + IFT_PPPMULTILINKBUNDLE = 0x6c + IFT_PROPATM = 0xc5 + IFT_PROPBWAP2MP = 0xb8 + IFT_PROPCNLS = 0x59 + IFT_PROPDOCSWIRELESSDOWNSTREAM = 0xb5 + IFT_PROPDOCSWIRELESSMACLAYER = 0xb4 + IFT_PROPDOCSWIRELESSUPSTREAM = 0xb6 + IFT_PROPMUX = 0x36 + IFT_PROPVIRTUAL = 0x35 + IFT_PROPWIRELESSP2P = 0x9d + IFT_PTPSERIAL = 0x16 + IFT_PVC = 0xf2 + IFT_Q2931 = 0xc9 + IFT_QLLC = 0x44 + IFT_RADIOMAC = 0xbc + IFT_RADSL = 0x5f + IFT_REACHDSL = 0xc0 + IFT_RFC1483 = 0x9f + IFT_RS232 = 0x21 + IFT_RSRB = 0x4f + IFT_SDLC = 0x11 + IFT_SDSL = 0x60 + IFT_SHDSL = 0xa9 + IFT_SIP = 0x1f + IFT_SIPSIG = 0xcc + IFT_SIPTG = 0xcb + IFT_SLIP = 0x1c + IFT_SMDSDXI = 0x2b + IFT_SMDSICIP = 0x34 + IFT_SONET = 0x27 + IFT_SONETOVERHEADCHANNEL = 0xb9 + IFT_SONETPATH = 0x32 + IFT_SONETVT = 0x33 + IFT_SRP = 0x97 + IFT_SS7SIGLINK = 0x9c + IFT_STACKTOSTACK = 0x6f + IFT_STARLAN = 0xb + IFT_T1 = 0x12 + IFT_TDLC = 0x74 + IFT_TELINK = 0xc8 + IFT_TERMPAD = 0x5b + IFT_TR008 = 0xb0 + IFT_TRANSPHDLC = 0x7b + IFT_TUNNEL = 0x83 + IFT_ULTRA = 0x1d + IFT_USB = 0xa0 + IFT_V11 = 0x40 + IFT_V35 = 0x2d + IFT_V36 = 0x41 + IFT_V37 = 0x78 + IFT_VDSL = 0x61 + IFT_VIRTUALIPADDRESS = 0x70 + IFT_VIRTUALTG = 0xca + IFT_VOICEDID = 0xd5 + IFT_VOICEEM = 0x64 + IFT_VOICEEMFGD = 0xd3 + IFT_VOICEENCAP = 0x67 + IFT_VOICEFGDEANA = 0xd4 + IFT_VOICEFXO = 0x65 + IFT_VOICEFXS = 0x66 + IFT_VOICEOVERATM = 0x98 + IFT_VOICEOVERCABLE = 0xc6 + IFT_VOICEOVERFRAMERELAY = 0x99 + IFT_VOICEOVERIP = 0x68 + IFT_WIREGUARD = 0xfb + IFT_X213 = 0x5d + IFT_X25 = 0x5 + IFT_X25DDN = 0x4 + IFT_X25HUNTGROUP = 0x7a + IFT_X25MLP = 0x79 + IFT_X25PLE = 0x28 + IFT_XETHER = 0x1a + IGNBRK = 0x1 + IGNCR = 0x80 + IGNPAR = 0x4 + IMAXBEL = 0x2000 + INLCR = 0x40 + INPCK = 0x10 + IN_CLASSA_HOST = 0xffffff + IN_CLASSA_MAX = 0x80 + IN_CLASSA_NET = 0xff000000 + IN_CLASSA_NSHIFT = 0x18 + IN_CLASSB_HOST = 0xffff + IN_CLASSB_MAX = 0x10000 + IN_CLASSB_NET = 0xffff0000 + IN_CLASSB_NSHIFT = 0x10 + IN_CLASSC_HOST = 0xff + IN_CLASSC_NET = 0xffffff00 + IN_CLASSC_NSHIFT = 0x8 + IN_CLASSD_HOST = 0xfffffff + IN_CLASSD_NET = 0xf0000000 + IN_CLASSD_NSHIFT = 0x1c + IN_LOOPBACKNET = 0x7f + IN_RFC3021_HOST = 0x1 + IN_RFC3021_NET = 0xfffffffe + IN_RFC3021_NSHIFT = 0x1f + IPPROTO_AH = 0x33 + IPPROTO_CARP = 0x70 + IPPROTO_DIVERT = 0x102 + IPPROTO_DONE = 0x101 + IPPROTO_DSTOPTS = 0x3c + IPPROTO_EGP = 0x8 + IPPROTO_ENCAP = 0x62 + IPPROTO_EON = 0x50 + IPPROTO_ESP = 0x32 + IPPROTO_ETHERIP = 0x61 + IPPROTO_FRAGMENT = 0x2c + IPPROTO_GGP = 0x3 + IPPROTO_GRE = 0x2f + IPPROTO_HOPOPTS = 0x0 + IPPROTO_ICMP = 0x1 + IPPROTO_ICMPV6 = 0x3a + IPPROTO_IDP = 0x16 + IPPROTO_IGMP = 0x2 + IPPROTO_IP = 0x0 + IPPROTO_IPCOMP = 0x6c + IPPROTO_IPIP = 0x4 + IPPROTO_IPV4 = 0x4 + IPPROTO_IPV6 = 0x29 + IPPROTO_MAX = 0x100 + IPPROTO_MAXID = 0x103 + IPPROTO_MOBILE = 0x37 + IPPROTO_MPLS = 0x89 + IPPROTO_NONE = 0x3b + IPPROTO_PFSYNC = 0xf0 + IPPROTO_PIM = 0x67 + IPPROTO_PUP = 0xc + IPPROTO_RAW = 0xff + IPPROTO_ROUTING = 0x2b + IPPROTO_RSVP = 0x2e + IPPROTO_SCTP = 0x84 + IPPROTO_TCP = 0x6 + IPPROTO_TP = 0x1d + IPPROTO_UDP = 0x11 + IPPROTO_UDPLITE = 0x88 + IPV6_AUTH_LEVEL = 0x35 + IPV6_AUTOFLOWLABEL = 0x3b + IPV6_CHECKSUM = 0x1a + IPV6_DEFAULT_MULTICAST_HOPS = 0x1 + IPV6_DEFAULT_MULTICAST_LOOP = 0x1 + IPV6_DEFHLIM = 0x40 + IPV6_DONTFRAG = 0x3e + IPV6_DSTOPTS = 0x32 + IPV6_ESP_NETWORK_LEVEL = 0x37 + IPV6_ESP_TRANS_LEVEL = 0x36 + IPV6_FAITH = 0x1d + IPV6_FLOWINFO_MASK = 0xffffff0f + IPV6_FLOWLABEL_MASK = 0xffff0f00 + IPV6_FRAGTTL = 0x78 + IPV6_HLIMDEC = 0x1 + IPV6_HOPLIMIT = 0x2f + IPV6_HOPOPTS = 0x31 + IPV6_IPCOMP_LEVEL = 0x3c + IPV6_JOIN_GROUP = 0xc + IPV6_LEAVE_GROUP = 0xd + IPV6_MAXHLIM = 0xff + IPV6_MAXPACKET = 0xffff + IPV6_MINHOPCOUNT = 0x41 + IPV6_MMTU = 0x500 + IPV6_MULTICAST_HOPS = 0xa + IPV6_MULTICAST_IF = 0x9 + IPV6_MULTICAST_LOOP = 0xb + IPV6_NEXTHOP = 0x30 + IPV6_OPTIONS = 0x1 + IPV6_PATHMTU = 0x2c + IPV6_PIPEX = 0x3f + IPV6_PKTINFO = 0x2e + IPV6_PORTRANGE = 0xe + IPV6_PORTRANGE_DEFAULT = 0x0 + IPV6_PORTRANGE_HIGH = 0x1 + IPV6_PORTRANGE_LOW = 0x2 + IPV6_RECVDSTOPTS = 0x28 + IPV6_RECVDSTPORT = 0x40 + IPV6_RECVHOPLIMIT = 0x25 + IPV6_RECVHOPOPTS = 0x27 + IPV6_RECVPATHMTU = 0x2b + IPV6_RECVPKTINFO = 0x24 + IPV6_RECVRTHDR = 0x26 + IPV6_RECVTCLASS = 0x39 + IPV6_RTABLE = 0x1021 + IPV6_RTHDR = 0x33 + IPV6_RTHDRDSTOPTS = 0x23 + IPV6_RTHDR_LOOSE = 0x0 + IPV6_RTHDR_STRICT = 0x1 + IPV6_RTHDR_TYPE_0 = 0x0 + IPV6_SOCKOPT_RESERVED1 = 0x3 + IPV6_TCLASS = 0x3d + IPV6_UNICAST_HOPS = 0x4 + IPV6_USE_MIN_MTU = 0x2a + IPV6_V6ONLY = 0x1b + IPV6_VERSION = 0x60 + IPV6_VERSION_MASK = 0xf0 + IP_ADD_MEMBERSHIP = 0xc + IP_AUTH_LEVEL = 0x14 + IP_DEFAULT_MULTICAST_LOOP = 0x1 + IP_DEFAULT_MULTICAST_TTL = 0x1 + IP_DF = 0x4000 + IP_DROP_MEMBERSHIP = 0xd + IP_ESP_NETWORK_LEVEL = 0x16 + IP_ESP_TRANS_LEVEL = 0x15 + IP_HDRINCL = 0x2 + IP_IPCOMP_LEVEL = 0x1d + IP_IPDEFTTL = 0x25 + IP_IPSECFLOWINFO = 0x24 + IP_IPSEC_LOCAL_AUTH = 0x1b + IP_IPSEC_LOCAL_CRED = 0x19 + IP_IPSEC_LOCAL_ID = 0x17 + IP_IPSEC_REMOTE_AUTH = 0x1c + IP_IPSEC_REMOTE_CRED = 0x1a + IP_IPSEC_REMOTE_ID = 0x18 + IP_MAXPACKET = 0xffff + IP_MAX_MEMBERSHIPS = 0xfff + IP_MF = 0x2000 + IP_MINTTL = 0x20 + IP_MIN_MEMBERSHIPS = 0xf + IP_MSS = 0x240 + IP_MULTICAST_IF = 0x9 + IP_MULTICAST_LOOP = 0xb + IP_MULTICAST_TTL = 0xa + IP_OFFMASK = 0x1fff + IP_OPTIONS = 0x1 + IP_PIPEX = 0x22 + IP_PORTRANGE = 0x13 + IP_PORTRANGE_DEFAULT = 0x0 + IP_PORTRANGE_HIGH = 0x1 + IP_PORTRANGE_LOW = 0x2 + IP_RECVDSTADDR = 0x7 + IP_RECVDSTPORT = 0x21 + IP_RECVIF = 0x1e + IP_RECVOPTS = 0x5 + IP_RECVRETOPTS = 0x6 + IP_RECVRTABLE = 0x23 + IP_RECVTTL = 0x1f + IP_RETOPTS = 0x8 + IP_RF = 0x8000 + IP_RTABLE = 0x1021 + IP_SENDSRCADDR = 0x7 + IP_TOS = 0x3 + IP_TTL = 0x4 + ISIG = 0x80 + ISTRIP = 0x20 + ITIMER_PROF = 0x2 + ITIMER_REAL = 0x0 + ITIMER_VIRTUAL = 0x1 + IUCLC = 0x1000 + IXANY = 0x800 + IXOFF = 0x400 + IXON = 0x200 + KERN_HOSTNAME = 0xa + KERN_OSRELEASE = 0x2 + KERN_OSTYPE = 0x1 + KERN_VERSION = 0x4 + LCNT_OVERLOAD_FLUSH = 0x6 + LOCK_EX = 0x2 + LOCK_NB = 0x4 + LOCK_SH = 0x1 + LOCK_UN = 0x8 + MADV_DONTNEED = 0x4 + MADV_FREE = 0x6 + MADV_NORMAL = 0x0 + MADV_RANDOM = 0x1 + MADV_SEQUENTIAL = 0x2 + MADV_SPACEAVAIL = 0x5 + MADV_WILLNEED = 0x3 + MAP_ANON = 0x1000 + MAP_ANONYMOUS = 0x1000 + MAP_CONCEAL = 0x8000 + MAP_COPY = 0x2 + MAP_FILE = 0x0 + MAP_FIXED = 0x10 + MAP_FLAGMASK = 0xfff7 + MAP_HASSEMAPHORE = 0x0 + MAP_INHERIT = 0x0 + MAP_INHERIT_COPY = 0x1 + MAP_INHERIT_NONE = 0x2 + MAP_INHERIT_SHARE = 0x0 + MAP_INHERIT_ZERO = 0x3 + MAP_NOEXTEND = 0x0 + MAP_NORESERVE = 0x0 + MAP_PRIVATE = 0x2 + MAP_RENAME = 0x0 + MAP_SHARED = 0x1 + MAP_STACK = 0x4000 + MAP_TRYFIXED = 0x0 + MCL_CURRENT = 0x1 + MCL_FUTURE = 0x2 + MNT_ASYNC = 0x40 + MNT_DEFEXPORTED = 0x200 + MNT_DELEXPORT = 0x20000 + MNT_DOOMED = 0x8000000 + MNT_EXPORTANON = 0x400 + MNT_EXPORTED = 0x100 + MNT_EXRDONLY = 0x80 + MNT_FORCE = 0x80000 + MNT_LAZY = 0x3 + MNT_LOCAL = 0x1000 + MNT_NOATIME = 0x8000 + MNT_NODEV = 0x10 + MNT_NOEXEC = 0x4 + MNT_NOPERM = 0x20 + MNT_NOSUID = 0x8 + MNT_NOWAIT = 0x2 + MNT_QUOTA = 0x2000 + MNT_RDONLY = 0x1 + MNT_RELOAD = 0x40000 + MNT_ROOTFS = 0x4000 + MNT_SOFTDEP = 0x4000000 + MNT_STALLED = 0x100000 + MNT_SWAPPABLE = 0x200000 + MNT_SYNCHRONOUS = 0x2 + MNT_UPDATE = 0x10000 + MNT_VISFLAGMASK = 0x400ffff + MNT_WAIT = 0x1 + MNT_WANTRDWR = 0x2000000 + MNT_WXALLOWED = 0x800 + MOUNT_AFS = "afs" + MOUNT_CD9660 = "cd9660" + MOUNT_EXT2FS = "ext2fs" + MOUNT_FFS = "ffs" + MOUNT_FUSEFS = "fuse" + MOUNT_MFS = "mfs" + MOUNT_MSDOS = "msdos" + MOUNT_NCPFS = "ncpfs" + MOUNT_NFS = "nfs" + MOUNT_NTFS = "ntfs" + MOUNT_TMPFS = "tmpfs" + MOUNT_UDF = "udf" + MOUNT_UFS = "ffs" + MSG_BCAST = 0x100 + MSG_CMSG_CLOEXEC = 0x800 + MSG_CTRUNC = 0x20 + MSG_DONTROUTE = 0x4 + MSG_DONTWAIT = 0x80 + MSG_EOR = 0x8 + MSG_MCAST = 0x200 + MSG_NOSIGNAL = 0x400 + MSG_OOB = 0x1 + MSG_PEEK = 0x2 + MSG_TRUNC = 0x10 + MSG_WAITALL = 0x40 + MS_ASYNC = 0x1 + MS_INVALIDATE = 0x4 + MS_SYNC = 0x2 + NAME_MAX = 0xff + NET_RT_DUMP = 0x1 + NET_RT_FLAGS = 0x2 + NET_RT_IFLIST = 0x3 + NET_RT_IFNAMES = 0x6 + NET_RT_MAXID = 0x8 + NET_RT_SOURCE = 0x7 + NET_RT_STATS = 0x4 + NET_RT_TABLE = 0x5 + NFDBITS = 0x20 + NOFLSH = 0x80000000 + NOKERNINFO = 0x2000000 + NOTE_ATTRIB = 0x8 + NOTE_CHANGE = 0x1 + NOTE_CHILD = 0x4 + NOTE_DELETE = 0x1 + NOTE_EOF = 0x2 + NOTE_EXEC = 0x20000000 + NOTE_EXIT = 0x80000000 + NOTE_EXTEND = 0x4 + NOTE_FORK = 0x40000000 + NOTE_LINK = 0x10 + NOTE_LOWAT = 0x1 + NOTE_OOB = 0x4 + NOTE_PCTRLMASK = 0xf0000000 + NOTE_PDATAMASK = 0xfffff + NOTE_RENAME = 0x20 + NOTE_REVOKE = 0x40 + NOTE_TRACK = 0x1 + NOTE_TRACKERR = 0x2 + NOTE_TRUNCATE = 0x80 + NOTE_WRITE = 0x2 + OCRNL = 0x10 + OLCUC = 0x20 + ONLCR = 0x2 + ONLRET = 0x80 + ONOCR = 0x40 + ONOEOT = 0x8 + OPOST = 0x1 + OXTABS = 0x4 + O_ACCMODE = 0x3 + O_APPEND = 0x8 + O_ASYNC = 0x40 + O_CLOEXEC = 0x10000 + O_CREAT = 0x200 + O_DIRECTORY = 0x20000 + O_DSYNC = 0x80 + O_EXCL = 0x800 + O_EXLOCK = 0x20 + O_FSYNC = 0x80 + O_NDELAY = 0x4 + O_NOCTTY = 0x8000 + O_NOFOLLOW = 0x100 + O_NONBLOCK = 0x4 + O_RDONLY = 0x0 + O_RDWR = 0x2 + O_RSYNC = 0x80 + O_SHLOCK = 0x10 + O_SYNC = 0x80 + O_TRUNC = 0x400 + O_WRONLY = 0x1 + PARENB = 0x1000 + PARMRK = 0x8 + PARODD = 0x2000 + PENDIN = 0x20000000 + PF_FLUSH = 0x1 + PRIO_PGRP = 0x1 + PRIO_PROCESS = 0x0 + PRIO_USER = 0x2 + PROT_EXEC = 0x4 + PROT_NONE = 0x0 + PROT_READ = 0x1 + PROT_WRITE = 0x2 + RLIMIT_CORE = 0x4 + RLIMIT_CPU = 0x0 + RLIMIT_DATA = 0x2 + RLIMIT_FSIZE = 0x1 + RLIMIT_MEMLOCK = 0x6 + RLIMIT_NOFILE = 0x8 + RLIMIT_NPROC = 0x7 + RLIMIT_RSS = 0x5 + RLIMIT_STACK = 0x3 + RLIM_INFINITY = 0x7fffffffffffffff + RTAX_AUTHOR = 0x6 + RTAX_BFD = 0xb + RTAX_BRD = 0x7 + RTAX_DNS = 0xc + RTAX_DST = 0x0 + RTAX_GATEWAY = 0x1 + RTAX_GENMASK = 0x3 + RTAX_IFA = 0x5 + RTAX_IFP = 0x4 + RTAX_LABEL = 0xa + RTAX_MAX = 0xf + RTAX_NETMASK = 0x2 + RTAX_SEARCH = 0xe + RTAX_SRC = 0x8 + RTAX_SRCMASK = 0x9 + RTAX_STATIC = 0xd + RTA_AUTHOR = 0x40 + RTA_BFD = 0x800 + RTA_BRD = 0x80 + RTA_DNS = 0x1000 + RTA_DST = 0x1 + RTA_GATEWAY = 0x2 + RTA_GENMASK = 0x8 + RTA_IFA = 0x20 + RTA_IFP = 0x10 + RTA_LABEL = 0x400 + RTA_NETMASK = 0x4 + RTA_SEARCH = 0x4000 + RTA_SRC = 0x100 + RTA_SRCMASK = 0x200 + RTA_STATIC = 0x2000 + RTF_ANNOUNCE = 0x4000 + RTF_BFD = 0x1000000 + RTF_BLACKHOLE = 0x1000 + RTF_BROADCAST = 0x400000 + RTF_CACHED = 0x20000 + RTF_CLONED = 0x10000 + RTF_CLONING = 0x100 + RTF_CONNECTED = 0x800000 + RTF_DONE = 0x40 + RTF_DYNAMIC = 0x10 + RTF_FMASK = 0x110fc08 + RTF_GATEWAY = 0x2 + RTF_HOST = 0x4 + RTF_LLINFO = 0x400 + RTF_LOCAL = 0x200000 + RTF_MODIFIED = 0x20 + RTF_MPATH = 0x40000 + RTF_MPLS = 0x100000 + RTF_MULTICAST = 0x200 + RTF_PERMANENT_ARP = 0x2000 + RTF_PROTO1 = 0x8000 + RTF_PROTO2 = 0x4000 + RTF_PROTO3 = 0x2000 + RTF_REJECT = 0x8 + RTF_STATIC = 0x800 + RTF_UP = 0x1 + RTF_USETRAILERS = 0x8000 + RTM_80211INFO = 0x15 + RTM_ADD = 0x1 + RTM_BFD = 0x12 + RTM_CHANGE = 0x3 + RTM_CHGADDRATTR = 0x14 + RTM_DELADDR = 0xd + RTM_DELETE = 0x2 + RTM_DESYNC = 0x10 + RTM_GET = 0x4 + RTM_IFANNOUNCE = 0xf + RTM_IFINFO = 0xe + RTM_INVALIDATE = 0x11 + RTM_LOSING = 0x5 + RTM_MAXSIZE = 0x800 + RTM_MISS = 0x7 + RTM_NEWADDR = 0xc + RTM_PROPOSAL = 0x13 + RTM_REDIRECT = 0x6 + RTM_RESOLVE = 0xb + RTM_SOURCE = 0x16 + RTM_VERSION = 0x5 + RTV_EXPIRE = 0x4 + RTV_HOPCOUNT = 0x2 + RTV_MTU = 0x1 + RTV_RPIPE = 0x8 + RTV_RTT = 0x40 + RTV_RTTVAR = 0x80 + RTV_SPIPE = 0x10 + RTV_SSTHRESH = 0x20 + RT_TABLEID_BITS = 0x8 + RT_TABLEID_MASK = 0xff + RT_TABLEID_MAX = 0xff + RUSAGE_CHILDREN = -0x1 + RUSAGE_SELF = 0x0 + RUSAGE_THREAD = 0x1 + SCM_RIGHTS = 0x1 + SCM_TIMESTAMP = 0x4 + SEEK_CUR = 0x1 + SEEK_END = 0x2 + SEEK_SET = 0x0 + SHUT_RD = 0x0 + SHUT_RDWR = 0x2 + SHUT_WR = 0x1 + SIOCADDMULTI = 0x80206931 + SIOCAIFADDR = 0x8040691a + SIOCAIFGROUP = 0x80286987 + SIOCATMARK = 0x40047307 + SIOCBRDGADD = 0x8060693c + SIOCBRDGADDL = 0x80606949 + SIOCBRDGADDS = 0x80606941 + SIOCBRDGARL = 0x808c694d + SIOCBRDGDADDR = 0x81286947 + SIOCBRDGDEL = 0x8060693d + SIOCBRDGDELS = 0x80606942 + SIOCBRDGFLUSH = 0x80606948 + SIOCBRDGFRL = 0x808c694e + SIOCBRDGGCACHE = 0xc0146941 + SIOCBRDGGFD = 0xc0146952 + SIOCBRDGGHT = 0xc0146951 + SIOCBRDGGIFFLGS = 0xc060693e + SIOCBRDGGMA = 0xc0146953 + SIOCBRDGGPARAM = 0xc0406958 + SIOCBRDGGPRI = 0xc0146950 + SIOCBRDGGRL = 0xc030694f + SIOCBRDGGTO = 0xc0146946 + SIOCBRDGIFS = 0xc0606942 + SIOCBRDGRTS = 0xc0206943 + SIOCBRDGSADDR = 0xc1286944 + SIOCBRDGSCACHE = 0x80146940 + SIOCBRDGSFD = 0x80146952 + SIOCBRDGSHT = 0x80146951 + SIOCBRDGSIFCOST = 0x80606955 + SIOCBRDGSIFFLGS = 0x8060693f + SIOCBRDGSIFPRIO = 0x80606954 + SIOCBRDGSIFPROT = 0x8060694a + SIOCBRDGSMA = 0x80146953 + SIOCBRDGSPRI = 0x80146950 + SIOCBRDGSPROTO = 0x8014695a + SIOCBRDGSTO = 0x80146945 + SIOCBRDGSTXHC = 0x80146959 + SIOCDELLABEL = 0x80206997 + SIOCDELMULTI = 0x80206932 + SIOCDIFADDR = 0x80206919 + SIOCDIFGROUP = 0x80286989 + SIOCDIFPARENT = 0x802069b4 + SIOCDIFPHYADDR = 0x80206949 + SIOCDPWE3NEIGHBOR = 0x802069de + SIOCDVNETID = 0x802069af + SIOCGETKALIVE = 0xc01869a4 + SIOCGETLABEL = 0x8020699a + SIOCGETMPWCFG = 0xc02069ae + SIOCGETPFLOW = 0xc02069fe + SIOCGETPFSYNC = 0xc02069f8 + SIOCGETSGCNT = 0xc0207534 + SIOCGETVIFCNT = 0xc0287533 + SIOCGETVLAN = 0xc0206990 + SIOCGIFADDR = 0xc0206921 + SIOCGIFBRDADDR = 0xc0206923 + SIOCGIFCONF = 0xc0106924 + SIOCGIFDATA = 0xc020691b + SIOCGIFDESCR = 0xc0206981 + SIOCGIFDSTADDR = 0xc0206922 + SIOCGIFFLAGS = 0xc0206911 + SIOCGIFGATTR = 0xc028698b + SIOCGIFGENERIC = 0xc020693a + SIOCGIFGLIST = 0xc028698d + SIOCGIFGMEMB = 0xc028698a + SIOCGIFGROUP = 0xc0286988 + SIOCGIFHARDMTU = 0xc02069a5 + SIOCGIFLLPRIO = 0xc02069b6 + SIOCGIFMEDIA = 0xc0406938 + SIOCGIFMETRIC = 0xc0206917 + SIOCGIFMTU = 0xc020697e + SIOCGIFNETMASK = 0xc0206925 + SIOCGIFPAIR = 0xc02069b1 + SIOCGIFPARENT = 0xc02069b3 + SIOCGIFPRIORITY = 0xc020699c + SIOCGIFRDOMAIN = 0xc02069a0 + SIOCGIFRTLABEL = 0xc0206983 + SIOCGIFRXR = 0x802069aa + SIOCGIFSFFPAGE = 0xc1126939 + SIOCGIFXFLAGS = 0xc020699e + SIOCGLIFPHYADDR = 0xc218694b + SIOCGLIFPHYDF = 0xc02069c2 + SIOCGLIFPHYECN = 0xc02069c8 + SIOCGLIFPHYRTABLE = 0xc02069a2 + SIOCGLIFPHYTTL = 0xc02069a9 + SIOCGPGRP = 0x40047309 + SIOCGPWE3 = 0xc0206998 + SIOCGPWE3CTRLWORD = 0xc02069dc + SIOCGPWE3FAT = 0xc02069dd + SIOCGPWE3NEIGHBOR = 0xc21869de + SIOCGRXHPRIO = 0xc02069db + SIOCGSPPPPARAMS = 0xc0206994 + SIOCGTXHPRIO = 0xc02069c6 + SIOCGUMBINFO = 0xc02069be + SIOCGUMBPARAM = 0xc02069c0 + SIOCGVH = 0xc02069f6 + SIOCGVNETFLOWID = 0xc02069c4 + SIOCGVNETID = 0xc02069a7 + SIOCIFAFATTACH = 0x801169ab + SIOCIFAFDETACH = 0x801169ac + SIOCIFCREATE = 0x8020697a + SIOCIFDESTROY = 0x80206979 + SIOCIFGCLONERS = 0xc0106978 + SIOCSETKALIVE = 0x801869a3 + SIOCSETLABEL = 0x80206999 + SIOCSETMPWCFG = 0x802069ad + SIOCSETPFLOW = 0x802069fd + SIOCSETPFSYNC = 0x802069f7 + SIOCSETVLAN = 0x8020698f + SIOCSIFADDR = 0x8020690c + SIOCSIFBRDADDR = 0x80206913 + SIOCSIFDESCR = 0x80206980 + SIOCSIFDSTADDR = 0x8020690e + SIOCSIFFLAGS = 0x80206910 + SIOCSIFGATTR = 0x8028698c + SIOCSIFGENERIC = 0x80206939 + SIOCSIFLLADDR = 0x8020691f + SIOCSIFLLPRIO = 0x802069b5 + SIOCSIFMEDIA = 0xc0206937 + SIOCSIFMETRIC = 0x80206918 + SIOCSIFMTU = 0x8020697f + SIOCSIFNETMASK = 0x80206916 + SIOCSIFPAIR = 0x802069b0 + SIOCSIFPARENT = 0x802069b2 + SIOCSIFPRIORITY = 0x8020699b + SIOCSIFRDOMAIN = 0x8020699f + SIOCSIFRTLABEL = 0x80206982 + SIOCSIFXFLAGS = 0x8020699d + SIOCSLIFPHYADDR = 0x8218694a + SIOCSLIFPHYDF = 0x802069c1 + SIOCSLIFPHYECN = 0x802069c7 + SIOCSLIFPHYRTABLE = 0x802069a1 + SIOCSLIFPHYTTL = 0x802069a8 + SIOCSPGRP = 0x80047308 + SIOCSPWE3CTRLWORD = 0x802069dc + SIOCSPWE3FAT = 0x802069dd + SIOCSPWE3NEIGHBOR = 0x821869de + SIOCSRXHPRIO = 0x802069db + SIOCSSPPPPARAMS = 0x80206993 + SIOCSTXHPRIO = 0x802069c5 + SIOCSUMBPARAM = 0x802069bf + SIOCSVH = 0xc02069f5 + SIOCSVNETFLOWID = 0x802069c3 + SIOCSVNETID = 0x802069a6 + SOCK_CLOEXEC = 0x8000 + SOCK_DGRAM = 0x2 + SOCK_DNS = 0x1000 + SOCK_NONBLOCK = 0x4000 + SOCK_RAW = 0x3 + SOCK_RDM = 0x4 + SOCK_SEQPACKET = 0x5 + SOCK_STREAM = 0x1 + SOL_SOCKET = 0xffff + SOMAXCONN = 0x80 + SO_ACCEPTCONN = 0x2 + SO_BINDANY = 0x1000 + SO_BROADCAST = 0x20 + SO_DEBUG = 0x1 + SO_DOMAIN = 0x1024 + SO_DONTROUTE = 0x10 + SO_ERROR = 0x1007 + SO_KEEPALIVE = 0x8 + SO_LINGER = 0x80 + SO_NETPROC = 0x1020 + SO_OOBINLINE = 0x100 + SO_PEERCRED = 0x1022 + SO_PROTOCOL = 0x1025 + SO_RCVBUF = 0x1002 + SO_RCVLOWAT = 0x1004 + SO_RCVTIMEO = 0x1006 + SO_REUSEADDR = 0x4 + SO_REUSEPORT = 0x200 + SO_RTABLE = 0x1021 + SO_SNDBUF = 0x1001 + SO_SNDLOWAT = 0x1003 + SO_SNDTIMEO = 0x1005 + SO_SPLICE = 0x1023 + SO_TIMESTAMP = 0x800 + SO_TYPE = 0x1008 + SO_USELOOPBACK = 0x40 + SO_ZEROIZE = 0x2000 + S_BLKSIZE = 0x200 + S_IEXEC = 0x40 + S_IFBLK = 0x6000 + S_IFCHR = 0x2000 + S_IFDIR = 0x4000 + S_IFIFO = 0x1000 + S_IFLNK = 0xa000 + S_IFMT = 0xf000 + S_IFREG = 0x8000 + S_IFSOCK = 0xc000 + S_IREAD = 0x100 + S_IRGRP = 0x20 + S_IROTH = 0x4 + S_IRUSR = 0x100 + S_IRWXG = 0x38 + S_IRWXO = 0x7 + S_IRWXU = 0x1c0 + S_ISGID = 0x400 + S_ISTXT = 0x200 + S_ISUID = 0x800 + S_ISVTX = 0x200 + S_IWGRP = 0x10 + S_IWOTH = 0x2 + S_IWRITE = 0x80 + S_IWUSR = 0x80 + S_IXGRP = 0x8 + S_IXOTH = 0x1 + S_IXUSR = 0x40 + TCIFLUSH = 0x1 + TCIOFF = 0x3 + TCIOFLUSH = 0x3 + TCION = 0x4 + TCOFLUSH = 0x2 + TCOOFF = 0x1 + TCOON = 0x2 + TCPOPT_EOL = 0x0 + TCPOPT_MAXSEG = 0x2 + TCPOPT_NOP = 0x1 + TCPOPT_SACK = 0x5 + TCPOPT_SACK_HDR = 0x1010500 + TCPOPT_SACK_PERMITTED = 0x4 + TCPOPT_SACK_PERMIT_HDR = 0x1010402 + TCPOPT_SIGNATURE = 0x13 + TCPOPT_TIMESTAMP = 0x8 + TCPOPT_TSTAMP_HDR = 0x101080a + TCPOPT_WINDOW = 0x3 + TCP_INFO = 0x9 + TCP_MAXSEG = 0x2 + TCP_MAXWIN = 0xffff + TCP_MAX_SACK = 0x3 + TCP_MAX_WINSHIFT = 0xe + TCP_MD5SIG = 0x4 + TCP_MSS = 0x200 + TCP_NODELAY = 0x1 + TCP_NOPUSH = 0x10 + TCP_SACKHOLE_LIMIT = 0x80 + TCP_SACK_ENABLE = 0x8 + TCSAFLUSH = 0x2 + TIMER_ABSTIME = 0x1 + TIMER_RELTIME = 0x0 + TIOCCBRK = 0x2000747a + TIOCCDTR = 0x20007478 + TIOCCHKVERAUTH = 0x2000741e + TIOCCLRVERAUTH = 0x2000741d + TIOCCONS = 0x80047462 + TIOCDRAIN = 0x2000745e + TIOCEXCL = 0x2000740d + TIOCEXT = 0x80047460 + TIOCFLAG_CLOCAL = 0x2 + TIOCFLAG_CRTSCTS = 0x4 + TIOCFLAG_MDMBUF = 0x8 + TIOCFLAG_PPS = 0x10 + TIOCFLAG_SOFTCAR = 0x1 + TIOCFLUSH = 0x80047410 + TIOCGETA = 0x402c7413 + TIOCGETD = 0x4004741a + TIOCGFLAGS = 0x4004745d + TIOCGPGRP = 0x40047477 + TIOCGSID = 0x40047463 + TIOCGTSTAMP = 0x4010745b + TIOCGWINSZ = 0x40087468 + TIOCMBIC = 0x8004746b + TIOCMBIS = 0x8004746c + TIOCMGET = 0x4004746a + TIOCMODG = 0x4004746a + TIOCMODS = 0x8004746d + TIOCMSET = 0x8004746d + TIOCM_CAR = 0x40 + TIOCM_CD = 0x40 + TIOCM_CTS = 0x20 + TIOCM_DSR = 0x100 + TIOCM_DTR = 0x2 + TIOCM_LE = 0x1 + TIOCM_RI = 0x80 + TIOCM_RNG = 0x80 + TIOCM_RTS = 0x4 + TIOCM_SR = 0x10 + TIOCM_ST = 0x8 + TIOCNOTTY = 0x20007471 + TIOCNXCL = 0x2000740e + TIOCOUTQ = 0x40047473 + TIOCPKT = 0x80047470 + TIOCPKT_DATA = 0x0 + TIOCPKT_DOSTOP = 0x20 + TIOCPKT_FLUSHREAD = 0x1 + TIOCPKT_FLUSHWRITE = 0x2 + TIOCPKT_IOCTL = 0x40 + TIOCPKT_NOSTOP = 0x10 + TIOCPKT_START = 0x8 + TIOCPKT_STOP = 0x4 + TIOCREMOTE = 0x80047469 + TIOCSBRK = 0x2000747b + TIOCSCTTY = 0x20007461 + TIOCSDTR = 0x20007479 + TIOCSETA = 0x802c7414 + TIOCSETAF = 0x802c7416 + TIOCSETAW = 0x802c7415 + TIOCSETD = 0x8004741b + TIOCSETVERAUTH = 0x8004741c + TIOCSFLAGS = 0x8004745c + TIOCSIG = 0x8004745f + TIOCSPGRP = 0x80047476 + TIOCSTART = 0x2000746e + TIOCSTAT = 0x20007465 + TIOCSTOP = 0x2000746f + TIOCSTSTAMP = 0x8008745a + TIOCSWINSZ = 0x80087467 + TIOCUCNTL = 0x80047466 + TIOCUCNTL_CBRK = 0x7a + TIOCUCNTL_SBRK = 0x7b + TOSTOP = 0x400000 + UTIME_NOW = -0x2 + UTIME_OMIT = -0x1 + VDISCARD = 0xf + VDSUSP = 0xb + VEOF = 0x0 + VEOL = 0x1 + VEOL2 = 0x2 + VERASE = 0x3 + VINTR = 0x8 + VKILL = 0x5 + VLNEXT = 0xe + VMIN = 0x10 + VM_ANONMIN = 0x7 + VM_LOADAVG = 0x2 + VM_MALLOC_CONF = 0xc + VM_MAXID = 0xd + VM_MAXSLP = 0xa + VM_METER = 0x1 + VM_NKMEMPAGES = 0x6 + VM_PSSTRINGS = 0x3 + VM_SWAPENCRYPT = 0x5 + VM_USPACE = 0xb + VM_UVMEXP = 0x4 + VM_VNODEMIN = 0x9 + VM_VTEXTMIN = 0x8 + VQUIT = 0x9 + VREPRINT = 0x6 + VSTART = 0xc + VSTATUS = 0x12 + VSTOP = 0xd + VSUSP = 0xa + VTIME = 0x11 + VWERASE = 0x4 + WALTSIG = 0x4 + WCONTINUED = 0x8 + WCOREFLAG = 0x80 + WNOHANG = 0x1 + WUNTRACED = 0x2 + XCASE = 0x1000000 +) + +// Errors +const ( + E2BIG = syscall.Errno(0x7) + EACCES = syscall.Errno(0xd) + EADDRINUSE = syscall.Errno(0x30) + EADDRNOTAVAIL = syscall.Errno(0x31) + EAFNOSUPPORT = syscall.Errno(0x2f) + EAGAIN = syscall.Errno(0x23) + EALREADY = syscall.Errno(0x25) + EAUTH = syscall.Errno(0x50) + EBADF = syscall.Errno(0x9) + EBADMSG = syscall.Errno(0x5c) + EBADRPC = syscall.Errno(0x48) + EBUSY = syscall.Errno(0x10) + ECANCELED = syscall.Errno(0x58) + ECHILD = syscall.Errno(0xa) + ECONNABORTED = syscall.Errno(0x35) + ECONNREFUSED = syscall.Errno(0x3d) + ECONNRESET = syscall.Errno(0x36) + EDEADLK = syscall.Errno(0xb) + EDESTADDRREQ = syscall.Errno(0x27) + EDOM = syscall.Errno(0x21) + EDQUOT = syscall.Errno(0x45) + EEXIST = syscall.Errno(0x11) + EFAULT = syscall.Errno(0xe) + EFBIG = syscall.Errno(0x1b) + EFTYPE = syscall.Errno(0x4f) + EHOSTDOWN = syscall.Errno(0x40) + EHOSTUNREACH = syscall.Errno(0x41) + EIDRM = syscall.Errno(0x59) + EILSEQ = syscall.Errno(0x54) + EINPROGRESS = syscall.Errno(0x24) + EINTR = syscall.Errno(0x4) + EINVAL = syscall.Errno(0x16) + EIO = syscall.Errno(0x5) + EIPSEC = syscall.Errno(0x52) + EISCONN = syscall.Errno(0x38) + EISDIR = syscall.Errno(0x15) + ELAST = syscall.Errno(0x5f) + ELOOP = syscall.Errno(0x3e) + EMEDIUMTYPE = syscall.Errno(0x56) + EMFILE = syscall.Errno(0x18) + EMLINK = syscall.Errno(0x1f) + EMSGSIZE = syscall.Errno(0x28) + ENAMETOOLONG = syscall.Errno(0x3f) + ENEEDAUTH = syscall.Errno(0x51) + ENETDOWN = syscall.Errno(0x32) + ENETRESET = syscall.Errno(0x34) + ENETUNREACH = syscall.Errno(0x33) + ENFILE = syscall.Errno(0x17) + ENOATTR = syscall.Errno(0x53) + ENOBUFS = syscall.Errno(0x37) + ENODEV = syscall.Errno(0x13) + ENOENT = syscall.Errno(0x2) + ENOEXEC = syscall.Errno(0x8) + ENOLCK = syscall.Errno(0x4d) + ENOMEDIUM = syscall.Errno(0x55) + ENOMEM = syscall.Errno(0xc) + ENOMSG = syscall.Errno(0x5a) + ENOPROTOOPT = syscall.Errno(0x2a) + ENOSPC = syscall.Errno(0x1c) + ENOSYS = syscall.Errno(0x4e) + ENOTBLK = syscall.Errno(0xf) + ENOTCONN = syscall.Errno(0x39) + ENOTDIR = syscall.Errno(0x14) + ENOTEMPTY = syscall.Errno(0x42) + ENOTRECOVERABLE = syscall.Errno(0x5d) + ENOTSOCK = syscall.Errno(0x26) + ENOTSUP = syscall.Errno(0x5b) + ENOTTY = syscall.Errno(0x19) + ENXIO = syscall.Errno(0x6) + EOPNOTSUPP = syscall.Errno(0x2d) + EOVERFLOW = syscall.Errno(0x57) + EOWNERDEAD = syscall.Errno(0x5e) + EPERM = syscall.Errno(0x1) + EPFNOSUPPORT = syscall.Errno(0x2e) + EPIPE = syscall.Errno(0x20) + EPROCLIM = syscall.Errno(0x43) + EPROCUNAVAIL = syscall.Errno(0x4c) + EPROGMISMATCH = syscall.Errno(0x4b) + EPROGUNAVAIL = syscall.Errno(0x4a) + EPROTO = syscall.Errno(0x5f) + EPROTONOSUPPORT = syscall.Errno(0x2b) + EPROTOTYPE = syscall.Errno(0x29) + ERANGE = syscall.Errno(0x22) + EREMOTE = syscall.Errno(0x47) + EROFS = syscall.Errno(0x1e) + ERPCMISMATCH = syscall.Errno(0x49) + ESHUTDOWN = syscall.Errno(0x3a) + ESOCKTNOSUPPORT = syscall.Errno(0x2c) + ESPIPE = syscall.Errno(0x1d) + ESRCH = syscall.Errno(0x3) + ESTALE = syscall.Errno(0x46) + ETIMEDOUT = syscall.Errno(0x3c) + ETOOMANYREFS = syscall.Errno(0x3b) + ETXTBSY = syscall.Errno(0x1a) + EUSERS = syscall.Errno(0x44) + EWOULDBLOCK = syscall.Errno(0x23) + EXDEV = syscall.Errno(0x12) +) + +// Signals +const ( + SIGABRT = syscall.Signal(0x6) + SIGALRM = syscall.Signal(0xe) + SIGBUS = syscall.Signal(0xa) + SIGCHLD = syscall.Signal(0x14) + SIGCONT = syscall.Signal(0x13) + SIGEMT = syscall.Signal(0x7) + SIGFPE = syscall.Signal(0x8) + SIGHUP = syscall.Signal(0x1) + SIGILL = syscall.Signal(0x4) + SIGINFO = syscall.Signal(0x1d) + SIGINT = syscall.Signal(0x2) + SIGIO = syscall.Signal(0x17) + SIGIOT = syscall.Signal(0x6) + SIGKILL = syscall.Signal(0x9) + SIGPIPE = syscall.Signal(0xd) + SIGPROF = syscall.Signal(0x1b) + SIGQUIT = syscall.Signal(0x3) + SIGSEGV = syscall.Signal(0xb) + SIGSTOP = syscall.Signal(0x11) + SIGSYS = syscall.Signal(0xc) + SIGTERM = syscall.Signal(0xf) + SIGTHR = syscall.Signal(0x20) + SIGTRAP = syscall.Signal(0x5) + SIGTSTP = syscall.Signal(0x12) + SIGTTIN = syscall.Signal(0x15) + SIGTTOU = syscall.Signal(0x16) + SIGURG = syscall.Signal(0x10) + SIGUSR1 = syscall.Signal(0x1e) + SIGUSR2 = syscall.Signal(0x1f) + SIGVTALRM = syscall.Signal(0x1a) + SIGWINCH = syscall.Signal(0x1c) + SIGXCPU = syscall.Signal(0x18) + SIGXFSZ = syscall.Signal(0x19) +) + +// Error table +var errorList = [...]struct { + num syscall.Errno + name string + desc string +}{ + {1, "EPERM", "operation not permitted"}, + {2, "ENOENT", "no such file or directory"}, + {3, "ESRCH", "no such process"}, + {4, "EINTR", "interrupted system call"}, + {5, "EIO", "input/output error"}, + {6, "ENXIO", "device not configured"}, + {7, "E2BIG", "argument list too long"}, + {8, "ENOEXEC", "exec format error"}, + {9, "EBADF", "bad file descriptor"}, + {10, "ECHILD", "no child processes"}, + {11, "EDEADLK", "resource deadlock avoided"}, + {12, "ENOMEM", "cannot allocate memory"}, + {13, "EACCES", "permission denied"}, + {14, "EFAULT", "bad address"}, + {15, "ENOTBLK", "block device required"}, + {16, "EBUSY", "device busy"}, + {17, "EEXIST", "file exists"}, + {18, "EXDEV", "cross-device link"}, + {19, "ENODEV", "operation not supported by device"}, + {20, "ENOTDIR", "not a directory"}, + {21, "EISDIR", "is a directory"}, + {22, "EINVAL", "invalid argument"}, + {23, "ENFILE", "too many open files in system"}, + {24, "EMFILE", "too many open files"}, + {25, "ENOTTY", "inappropriate ioctl for device"}, + {26, "ETXTBSY", "text file busy"}, + {27, "EFBIG", "file too large"}, + {28, "ENOSPC", "no space left on device"}, + {29, "ESPIPE", "illegal seek"}, + {30, "EROFS", "read-only file system"}, + {31, "EMLINK", "too many links"}, + {32, "EPIPE", "broken pipe"}, + {33, "EDOM", "numerical argument out of domain"}, + {34, "ERANGE", "result too large"}, + {35, "EAGAIN", "resource temporarily unavailable"}, + {36, "EINPROGRESS", "operation now in progress"}, + {37, "EALREADY", "operation already in progress"}, + {38, "ENOTSOCK", "socket operation on non-socket"}, + {39, "EDESTADDRREQ", "destination address required"}, + {40, "EMSGSIZE", "message too long"}, + {41, "EPROTOTYPE", "protocol wrong type for socket"}, + {42, "ENOPROTOOPT", "protocol not available"}, + {43, "EPROTONOSUPPORT", "protocol not supported"}, + {44, "ESOCKTNOSUPPORT", "socket type not supported"}, + {45, "EOPNOTSUPP", "operation not supported"}, + {46, "EPFNOSUPPORT", "protocol family not supported"}, + {47, "EAFNOSUPPORT", "address family not supported by protocol family"}, + {48, "EADDRINUSE", "address already in use"}, + {49, "EADDRNOTAVAIL", "can't assign requested address"}, + {50, "ENETDOWN", "network is down"}, + {51, "ENETUNREACH", "network is unreachable"}, + {52, "ENETRESET", "network dropped connection on reset"}, + {53, "ECONNABORTED", "software caused connection abort"}, + {54, "ECONNRESET", "connection reset by peer"}, + {55, "ENOBUFS", "no buffer space available"}, + {56, "EISCONN", "socket is already connected"}, + {57, "ENOTCONN", "socket is not connected"}, + {58, "ESHUTDOWN", "can't send after socket shutdown"}, + {59, "ETOOMANYREFS", "too many references: can't splice"}, + {60, "ETIMEDOUT", "operation timed out"}, + {61, "ECONNREFUSED", "connection refused"}, + {62, "ELOOP", "too many levels of symbolic links"}, + {63, "ENAMETOOLONG", "file name too long"}, + {64, "EHOSTDOWN", "host is down"}, + {65, "EHOSTUNREACH", "no route to host"}, + {66, "ENOTEMPTY", "directory not empty"}, + {67, "EPROCLIM", "too many processes"}, + {68, "EUSERS", "too many users"}, + {69, "EDQUOT", "disk quota exceeded"}, + {70, "ESTALE", "stale NFS file handle"}, + {71, "EREMOTE", "too many levels of remote in path"}, + {72, "EBADRPC", "RPC struct is bad"}, + {73, "ERPCMISMATCH", "RPC version wrong"}, + {74, "EPROGUNAVAIL", "RPC program not available"}, + {75, "EPROGMISMATCH", "program version wrong"}, + {76, "EPROCUNAVAIL", "bad procedure for program"}, + {77, "ENOLCK", "no locks available"}, + {78, "ENOSYS", "function not implemented"}, + {79, "EFTYPE", "inappropriate file type or format"}, + {80, "EAUTH", "authentication error"}, + {81, "ENEEDAUTH", "need authenticator"}, + {82, "EIPSEC", "IPsec processing failure"}, + {83, "ENOATTR", "attribute not found"}, + {84, "EILSEQ", "illegal byte sequence"}, + {85, "ENOMEDIUM", "no medium found"}, + {86, "EMEDIUMTYPE", "wrong medium type"}, + {87, "EOVERFLOW", "value too large to be stored in data type"}, + {88, "ECANCELED", "operation canceled"}, + {89, "EIDRM", "identifier removed"}, + {90, "ENOMSG", "no message of desired type"}, + {91, "ENOTSUP", "not supported"}, + {92, "EBADMSG", "bad message"}, + {93, "ENOTRECOVERABLE", "state not recoverable"}, + {94, "EOWNERDEAD", "previous owner died"}, + {95, "ELAST", "protocol error"}, +} + +// Signal table +var signalList = [...]struct { + num syscall.Signal + name string + desc string +}{ + {1, "SIGHUP", "hangup"}, + {2, "SIGINT", "interrupt"}, + {3, "SIGQUIT", "quit"}, + {4, "SIGILL", "illegal instruction"}, + {5, "SIGTRAP", "trace/BPT trap"}, + {6, "SIGABRT", "abort trap"}, + {7, "SIGEMT", "EMT trap"}, + {8, "SIGFPE", "floating point exception"}, + {9, "SIGKILL", "killed"}, + {10, "SIGBUS", "bus error"}, + {11, "SIGSEGV", "segmentation fault"}, + {12, "SIGSYS", "bad system call"}, + {13, "SIGPIPE", "broken pipe"}, + {14, "SIGALRM", "alarm clock"}, + {15, "SIGTERM", "terminated"}, + {16, "SIGURG", "urgent I/O condition"}, + {17, "SIGSTOP", "suspended (signal)"}, + {18, "SIGTSTP", "suspended"}, + {19, "SIGCONT", "continued"}, + {20, "SIGCHLD", "child exited"}, + {21, "SIGTTIN", "stopped (tty input)"}, + {22, "SIGTTOU", "stopped (tty output)"}, + {23, "SIGIO", "I/O possible"}, + {24, "SIGXCPU", "cputime limit exceeded"}, + {25, "SIGXFSZ", "filesize limit exceeded"}, + {26, "SIGVTALRM", "virtual timer expired"}, + {27, "SIGPROF", "profiling timer expired"}, + {28, "SIGWINCH", "window size changes"}, + {29, "SIGINFO", "information request"}, + {30, "SIGUSR1", "user defined signal 1"}, + {31, "SIGUSR2", "user defined signal 2"}, + {32, "SIGTHR", "thread AST"}, +} diff --git a/vendor/golang.org/x/sys/unix/zptrace_armnn_linux.go b/vendor/golang.org/x/sys/unix/zptrace_armnn_linux.go index bd001a6..97f20ca 100644 --- a/vendor/golang.org/x/sys/unix/zptrace_armnn_linux.go +++ b/vendor/golang.org/x/sys/unix/zptrace_armnn_linux.go @@ -15,12 +15,12 @@ type PtraceRegsArm struct { // PtraceGetRegsArm fetches the registers used by arm binaries. func PtraceGetRegsArm(pid int, regsout *PtraceRegsArm) error { - return ptrace(PTRACE_GETREGS, pid, 0, uintptr(unsafe.Pointer(regsout))) + return ptracePtr(PTRACE_GETREGS, pid, 0, unsafe.Pointer(regsout)) } // PtraceSetRegsArm sets the registers used by arm binaries. func PtraceSetRegsArm(pid int, regs *PtraceRegsArm) error { - return ptrace(PTRACE_SETREGS, pid, 0, uintptr(unsafe.Pointer(regs))) + return ptracePtr(PTRACE_SETREGS, pid, 0, unsafe.Pointer(regs)) } // PtraceRegsArm64 is the registers used by arm64 binaries. @@ -33,10 +33,10 @@ type PtraceRegsArm64 struct { // PtraceGetRegsArm64 fetches the registers used by arm64 binaries. func PtraceGetRegsArm64(pid int, regsout *PtraceRegsArm64) error { - return ptrace(PTRACE_GETREGS, pid, 0, uintptr(unsafe.Pointer(regsout))) + return ptracePtr(PTRACE_GETREGS, pid, 0, unsafe.Pointer(regsout)) } // PtraceSetRegsArm64 sets the registers used by arm64 binaries. func PtraceSetRegsArm64(pid int, regs *PtraceRegsArm64) error { - return ptrace(PTRACE_SETREGS, pid, 0, uintptr(unsafe.Pointer(regs))) + return ptracePtr(PTRACE_SETREGS, pid, 0, unsafe.Pointer(regs)) } diff --git a/vendor/golang.org/x/sys/unix/zptrace_linux_arm64.go b/vendor/golang.org/x/sys/unix/zptrace_linux_arm64.go index 6cb6d68..834d285 100644 --- a/vendor/golang.org/x/sys/unix/zptrace_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/zptrace_linux_arm64.go @@ -7,11 +7,11 @@ import "unsafe" // PtraceGetRegSetArm64 fetches the registers used by arm64 binaries. func PtraceGetRegSetArm64(pid, addr int, regsout *PtraceRegsArm64) error { iovec := Iovec{(*byte)(unsafe.Pointer(regsout)), uint64(unsafe.Sizeof(*regsout))} - return ptrace(PTRACE_GETREGSET, pid, uintptr(addr), uintptr(unsafe.Pointer(&iovec))) + return ptracePtr(PTRACE_GETREGSET, pid, uintptr(addr), unsafe.Pointer(&iovec)) } // PtraceSetRegSetArm64 sets the registers used by arm64 binaries. func PtraceSetRegSetArm64(pid, addr int, regs *PtraceRegsArm64) error { iovec := Iovec{(*byte)(unsafe.Pointer(regs)), uint64(unsafe.Sizeof(*regs))} - return ptrace(PTRACE_SETREGSET, pid, uintptr(addr), uintptr(unsafe.Pointer(&iovec))) + return ptracePtr(PTRACE_SETREGSET, pid, uintptr(addr), unsafe.Pointer(&iovec)) } diff --git a/vendor/golang.org/x/sys/unix/zptrace_mipsnn_linux.go b/vendor/golang.org/x/sys/unix/zptrace_mipsnn_linux.go index c34d063..0b5f794 100644 --- a/vendor/golang.org/x/sys/unix/zptrace_mipsnn_linux.go +++ b/vendor/golang.org/x/sys/unix/zptrace_mipsnn_linux.go @@ -21,12 +21,12 @@ type PtraceRegsMips struct { // PtraceGetRegsMips fetches the registers used by mips binaries. func PtraceGetRegsMips(pid int, regsout *PtraceRegsMips) error { - return ptrace(PTRACE_GETREGS, pid, 0, uintptr(unsafe.Pointer(regsout))) + return ptracePtr(PTRACE_GETREGS, pid, 0, unsafe.Pointer(regsout)) } // PtraceSetRegsMips sets the registers used by mips binaries. func PtraceSetRegsMips(pid int, regs *PtraceRegsMips) error { - return ptrace(PTRACE_SETREGS, pid, 0, uintptr(unsafe.Pointer(regs))) + return ptracePtr(PTRACE_SETREGS, pid, 0, unsafe.Pointer(regs)) } // PtraceRegsMips64 is the registers used by mips64 binaries. @@ -42,10 +42,10 @@ type PtraceRegsMips64 struct { // PtraceGetRegsMips64 fetches the registers used by mips64 binaries. func PtraceGetRegsMips64(pid int, regsout *PtraceRegsMips64) error { - return ptrace(PTRACE_GETREGS, pid, 0, uintptr(unsafe.Pointer(regsout))) + return ptracePtr(PTRACE_GETREGS, pid, 0, unsafe.Pointer(regsout)) } // PtraceSetRegsMips64 sets the registers used by mips64 binaries. func PtraceSetRegsMips64(pid int, regs *PtraceRegsMips64) error { - return ptrace(PTRACE_SETREGS, pid, 0, uintptr(unsafe.Pointer(regs))) + return ptracePtr(PTRACE_SETREGS, pid, 0, unsafe.Pointer(regs)) } diff --git a/vendor/golang.org/x/sys/unix/zptrace_mipsnnle_linux.go b/vendor/golang.org/x/sys/unix/zptrace_mipsnnle_linux.go index 3ccf0c0..2807f7e 100644 --- a/vendor/golang.org/x/sys/unix/zptrace_mipsnnle_linux.go +++ b/vendor/golang.org/x/sys/unix/zptrace_mipsnnle_linux.go @@ -21,12 +21,12 @@ type PtraceRegsMipsle struct { // PtraceGetRegsMipsle fetches the registers used by mipsle binaries. func PtraceGetRegsMipsle(pid int, regsout *PtraceRegsMipsle) error { - return ptrace(PTRACE_GETREGS, pid, 0, uintptr(unsafe.Pointer(regsout))) + return ptracePtr(PTRACE_GETREGS, pid, 0, unsafe.Pointer(regsout)) } // PtraceSetRegsMipsle sets the registers used by mipsle binaries. func PtraceSetRegsMipsle(pid int, regs *PtraceRegsMipsle) error { - return ptrace(PTRACE_SETREGS, pid, 0, uintptr(unsafe.Pointer(regs))) + return ptracePtr(PTRACE_SETREGS, pid, 0, unsafe.Pointer(regs)) } // PtraceRegsMips64le is the registers used by mips64le binaries. @@ -42,10 +42,10 @@ type PtraceRegsMips64le struct { // PtraceGetRegsMips64le fetches the registers used by mips64le binaries. func PtraceGetRegsMips64le(pid int, regsout *PtraceRegsMips64le) error { - return ptrace(PTRACE_GETREGS, pid, 0, uintptr(unsafe.Pointer(regsout))) + return ptracePtr(PTRACE_GETREGS, pid, 0, unsafe.Pointer(regsout)) } // PtraceSetRegsMips64le sets the registers used by mips64le binaries. func PtraceSetRegsMips64le(pid int, regs *PtraceRegsMips64le) error { - return ptrace(PTRACE_SETREGS, pid, 0, uintptr(unsafe.Pointer(regs))) + return ptracePtr(PTRACE_SETREGS, pid, 0, unsafe.Pointer(regs)) } diff --git a/vendor/golang.org/x/sys/unix/zptrace_x86_linux.go b/vendor/golang.org/x/sys/unix/zptrace_x86_linux.go index 7d65857..281ea64 100644 --- a/vendor/golang.org/x/sys/unix/zptrace_x86_linux.go +++ b/vendor/golang.org/x/sys/unix/zptrace_x86_linux.go @@ -31,12 +31,12 @@ type PtraceRegs386 struct { // PtraceGetRegs386 fetches the registers used by 386 binaries. func PtraceGetRegs386(pid int, regsout *PtraceRegs386) error { - return ptrace(PTRACE_GETREGS, pid, 0, uintptr(unsafe.Pointer(regsout))) + return ptracePtr(PTRACE_GETREGS, pid, 0, unsafe.Pointer(regsout)) } // PtraceSetRegs386 sets the registers used by 386 binaries. func PtraceSetRegs386(pid int, regs *PtraceRegs386) error { - return ptrace(PTRACE_SETREGS, pid, 0, uintptr(unsafe.Pointer(regs))) + return ptracePtr(PTRACE_SETREGS, pid, 0, unsafe.Pointer(regs)) } // PtraceRegsAmd64 is the registers used by amd64 binaries. @@ -72,10 +72,10 @@ type PtraceRegsAmd64 struct { // PtraceGetRegsAmd64 fetches the registers used by amd64 binaries. func PtraceGetRegsAmd64(pid int, regsout *PtraceRegsAmd64) error { - return ptrace(PTRACE_GETREGS, pid, 0, uintptr(unsafe.Pointer(regsout))) + return ptracePtr(PTRACE_GETREGS, pid, 0, unsafe.Pointer(regsout)) } // PtraceSetRegsAmd64 sets the registers used by amd64 binaries. func PtraceSetRegsAmd64(pid int, regs *PtraceRegsAmd64) error { - return ptrace(PTRACE_SETREGS, pid, 0, uintptr(unsafe.Pointer(regs))) + return ptracePtr(PTRACE_SETREGS, pid, 0, unsafe.Pointer(regs)) } diff --git a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go index 870215d..9a25721 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go @@ -124,7 +124,6 @@ int utime(uintptr_t, uintptr_t); unsigned long long getsystemcfg(int); int umount(uintptr_t); int getrlimit64(int, uintptr_t); -int setrlimit64(int, uintptr_t); long long lseek64(int, long long, int); uintptr_t mmap(uintptr_t, uintptr_t, int, int, int, long long); @@ -213,7 +212,7 @@ func wait4(pid Pid_t, status *_C_int, options int, rusage *Rusage) (wpid Pid_t, // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func ioctl(fd int, req uint, arg uintptr) (err error) { +func ioctl(fd int, req int, arg uintptr) (err error) { r0, er := C.ioctl(C.int(fd), C.int(req), C.uintptr_t(arg)) if r0 == -1 && er != nil { err = er @@ -223,6 +222,16 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) { + r0, er := C.ioctl(C.int(fd), C.int(req), C.uintptr_t(uintptr(arg))) + if r0 == -1 && er != nil { + err = er + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func FcntlInt(fd uintptr, cmd int, arg int) (r int, err error) { r0, er := C.fcntl(C.uintptr_t(fd), C.int(cmd), C.uintptr_t(arg)) r = int(r0) @@ -1454,16 +1463,6 @@ func Getrlimit(resource int, rlim *Rlimit) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - r0, er := C.setrlimit64(C.int(resource), C.uintptr_t(uintptr(unsafe.Pointer(rlim)))) - if r0 == -1 && er != nil { - err = er - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Seek(fd int, offset int64, whence int) (off int64, err error) { r0, er := C.lseek64(C.int(fd), C.longlong(offset), C.int(whence)) off = int64(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go index a89b0bf..6de80c2 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go @@ -93,8 +93,18 @@ func wait4(pid Pid_t, status *_C_int, options int, rusage *Rusage) (wpid Pid_t, // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func ioctl(fd int, req uint, arg uintptr) (err error) { - _, e1 := callioctl(fd, int(req), arg) +func ioctl(fd int, req int, arg uintptr) (err error) { + _, e1 := callioctl(fd, req, arg) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) { + _, e1 := callioctl_ptr(fd, req, arg) if e1 != 0 { err = errnoErr(e1) } @@ -1412,16 +1422,6 @@ func Getrlimit(resource int, rlim *Rlimit) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, e1 := callsetrlimit(resource, uintptr(unsafe.Pointer(rlim))) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Seek(fd int, offset int64, whence int) (off int64, err error) { r0, e1 := calllseek(fd, offset, whence) off = int64(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gc.go b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gc.go index 2caa5ad..c4d50ae 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gc.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gc.go @@ -124,7 +124,6 @@ import ( //go:cgo_import_dynamic libc_getsystemcfg getsystemcfg "libc.a/shr_64.o" //go:cgo_import_dynamic libc_umount umount "libc.a/shr_64.o" //go:cgo_import_dynamic libc_getrlimit getrlimit "libc.a/shr_64.o" -//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.a/shr_64.o" //go:cgo_import_dynamic libc_lseek lseek "libc.a/shr_64.o" //go:cgo_import_dynamic libc_mmap64 mmap64 "libc.a/shr_64.o" @@ -242,7 +241,6 @@ import ( //go:linkname libc_getsystemcfg libc_getsystemcfg //go:linkname libc_umount libc_umount //go:linkname libc_getrlimit libc_getrlimit -//go:linkname libc_setrlimit libc_setrlimit //go:linkname libc_lseek libc_lseek //go:linkname libc_mmap64 libc_mmap64 @@ -363,7 +361,6 @@ var ( libc_getsystemcfg, libc_umount, libc_getrlimit, - libc_setrlimit, libc_lseek, libc_mmap64 syscallFunc ) @@ -423,6 +420,13 @@ func callioctl(fd int, req int, arg uintptr) (r1 uintptr, e1 Errno) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func callioctl_ptr(fd int, req int, arg unsafe.Pointer) (r1 uintptr, e1 Errno) { + r1, _, e1 = syscall6(uintptr(unsafe.Pointer(&libc_ioctl)), 3, uintptr(fd), uintptr(req), uintptr(arg), 0, 0, 0) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func callfcntl(fd uintptr, cmd int, arg uintptr) (r1 uintptr, e1 Errno) { r1, _, e1 = syscall6(uintptr(unsafe.Pointer(&libc_fcntl)), 3, fd, uintptr(cmd), arg, 0, 0, 0) return @@ -1172,13 +1176,6 @@ func callgetrlimit(resource int, rlim uintptr) (r1 uintptr, e1 Errno) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func callsetrlimit(resource int, rlim uintptr) (r1 uintptr, e1 Errno) { - r1, _, e1 = rawSyscall6(uintptr(unsafe.Pointer(&libc_setrlimit)), 2, uintptr(resource), rlim, 0, 0, 0, 0) - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func calllseek(fd int, offset int64, whence int) (r1 uintptr, e1 Errno) { r1, _, e1 = syscall6(uintptr(unsafe.Pointer(&libc_lseek)), 3, uintptr(fd), uintptr(offset), uintptr(whence), 0, 0, 0) return diff --git a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gccgo.go b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gccgo.go index 944a714..6903d3b 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gccgo.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gccgo.go @@ -123,7 +123,6 @@ int utime(uintptr_t, uintptr_t); unsigned long long getsystemcfg(int); int umount(uintptr_t); int getrlimit(int, uintptr_t); -int setrlimit(int, uintptr_t); long long lseek(int, long long, int); uintptr_t mmap64(uintptr_t, uintptr_t, int, int, int, long long); @@ -131,6 +130,7 @@ uintptr_t mmap64(uintptr_t, uintptr_t, int, int, int, long long); import "C" import ( "syscall" + "unsafe" ) // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -191,6 +191,14 @@ func callioctl(fd int, req int, arg uintptr) (r1 uintptr, e1 Errno) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func callioctl_ptr(fd int, req int, arg unsafe.Pointer) (r1 uintptr, e1 Errno) { + r1 = uintptr(C.ioctl(C.int(fd), C.int(req), C.uintptr_t(uintptr(arg)))) + e1 = syscall.GetErrno() + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func callfcntl(fd uintptr, cmd int, arg uintptr) (r1 uintptr, e1 Errno) { r1 = uintptr(C.fcntl(C.uintptr_t(fd), C.int(cmd), C.uintptr_t(arg))) e1 = syscall.GetErrno() @@ -1047,14 +1055,6 @@ func callgetrlimit(resource int, rlim uintptr) (r1 uintptr, e1 Errno) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func callsetrlimit(resource int, rlim uintptr) (r1 uintptr, e1 Errno) { - r1 = uintptr(C.setrlimit(C.int(resource), C.uintptr_t(rlim))) - e1 = syscall.GetErrno() - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func calllseek(fd int, offset int64, whence int) (r1 uintptr, e1 Errno) { r1 = uintptr(C.lseek(C.int(fd), C.longlong(offset), C.int(whence))) e1 = syscall.GetErrno() diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.1_13.go b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.1_13.go deleted file mode 100644 index a06eb09..0000000 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.1_13.go +++ /dev/null @@ -1,40 +0,0 @@ -// go run mksyscall.go -tags darwin,amd64,go1.13 syscall_darwin.1_13.go -// Code generated by the command above; see README.md. DO NOT EDIT. - -//go:build darwin && amd64 && go1.13 -// +build darwin,amd64,go1.13 - -package unix - -import ( - "syscall" - "unsafe" -) - -var _ syscall.Errno - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func closedir(dir uintptr) (err error) { - _, _, e1 := syscall_syscall(libc_closedir_trampoline_addr, uintptr(dir), 0, 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_closedir_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_closedir closedir "/usr/lib/libSystem.B.dylib" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func readdir_r(dir uintptr, entry *Dirent, result **Dirent) (res Errno) { - r0, _, _ := syscall_syscall(libc_readdir_r_trampoline_addr, uintptr(dir), uintptr(unsafe.Pointer(entry)), uintptr(unsafe.Pointer(result))) - res = Errno(r0) - return -} - -var libc_readdir_r_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_readdir_r readdir_r "/usr/lib/libSystem.B.dylib" diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.1_13.s b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.1_13.s deleted file mode 100644 index d6c3e25..0000000 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.1_13.s +++ /dev/null @@ -1,25 +0,0 @@ -// go run mkasm_darwin.go amd64 -// Code generated by the command above; DO NOT EDIT. - -//go:build go1.13 -// +build go1.13 - -#include "textflag.h" - -TEXT libc_fdopendir_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_fdopendir(SB) - -GLOBL ·libc_fdopendir_trampoline_addr(SB), RODATA, $8 -DATA ·libc_fdopendir_trampoline_addr(SB)/8, $libc_fdopendir_trampoline<>(SB) - -TEXT libc_closedir_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_closedir(SB) - -GLOBL ·libc_closedir_trampoline_addr(SB), RODATA, $8 -DATA ·libc_closedir_trampoline_addr(SB)/8, $libc_closedir_trampoline<>(SB) - -TEXT libc_readdir_r_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_readdir_r(SB) - -GLOBL ·libc_readdir_r_trampoline_addr(SB), RODATA, $8 -DATA ·libc_readdir_r_trampoline_addr(SB)/8, $libc_readdir_r_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go index 467deed..4037ccf 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go @@ -1,8 +1,8 @@ -// go run mksyscall.go -tags darwin,amd64,go1.12 syscall_bsd.go syscall_darwin.go syscall_darwin_amd64.go +// go run mksyscall.go -tags darwin,amd64 syscall_bsd.go syscall_darwin.go syscall_darwin_amd64.go // Code generated by the command above; see README.md. DO NOT EDIT. -//go:build darwin && amd64 && go1.12 -// +build darwin,amd64,go1.12 +//go:build darwin && amd64 +// +build darwin,amd64 package unix @@ -463,6 +463,32 @@ var libc_munlockall_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func closedir(dir uintptr) (err error) { + _, _, e1 := syscall_syscall(libc_closedir_trampoline_addr, uintptr(dir), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_closedir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_closedir closedir "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func readdir_r(dir uintptr, entry *Dirent, result **Dirent) (res Errno) { + r0, _, _ := syscall_syscall(libc_readdir_r_trampoline_addr, uintptr(dir), uintptr(unsafe.Pointer(entry)), uintptr(unsafe.Pointer(result))) + res = Errno(r0) + return +} + +var libc_readdir_r_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_readdir_r readdir_r "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func pipe(p *[2]int32) (err error) { _, _, e1 := syscall_rawSyscall(libc_pipe_trampoline_addr, uintptr(unsafe.Pointer(p)), 0, 0) if e1 != 0 { @@ -699,6 +725,14 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { + _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + var libc_ioctl_trampoline_addr uintptr //go:cgo_import_dynamic libc_ioctl ioctl "/usr/lib/libSystem.B.dylib" @@ -1958,6 +1992,31 @@ var libc_select_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func Setattrlist(path string, attrlist *Attrlist, attrBuf []byte, options int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 unsafe.Pointer + if len(attrBuf) > 0 { + _p1 = unsafe.Pointer(&attrBuf[0]) + } else { + _p1 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall6(libc_setattrlist_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(attrlist)), uintptr(_p1), uintptr(len(attrBuf)), uintptr(options), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setattrlist_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setattrlist setattrlist "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Setegid(egid int) (err error) { _, _, e1 := syscall_syscall(libc_setegid_trampoline_addr, uintptr(egid), 0, 0) if e1 != 0 { @@ -2089,20 +2148,6 @@ var libc_setreuid_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_setrlimit_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_setrlimit setrlimit "/usr/lib/libSystem.B.dylib" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := syscall_rawSyscall(libc_setsid_trampoline_addr, 0, 0, 0) pid = int(r0) @@ -2476,6 +2521,14 @@ func ptrace1(request int, pid int, addr uintptr, data uintptr) (err error) { return } +func ptrace1Ptr(request int, pid int, addr uintptr, data unsafe.Pointer) (err error) { + _, _, e1 := syscall_syscall6(libc_ptrace_trampoline_addr, uintptr(request), uintptr(pid), addr, uintptr(data), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + var libc_ptrace_trampoline_addr uintptr //go:cgo_import_dynamic libc_ptrace ptrace "/usr/lib/libSystem.B.dylib" diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s index 7e308a4..4baaed0 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s @@ -1,11 +1,14 @@ -// go run mkasm_darwin.go amd64 +// go run mkasm.go darwin amd64 // Code generated by the command above; DO NOT EDIT. -//go:build go1.12 -// +build go1.12 - #include "textflag.h" +TEXT libc_fdopendir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fdopendir(SB) + +GLOBL ·libc_fdopendir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fdopendir_trampoline_addr(SB)/8, $libc_fdopendir_trampoline<>(SB) + TEXT libc_getgroups_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getgroups(SB) @@ -174,6 +177,18 @@ TEXT libc_munlockall_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_munlockall_trampoline_addr(SB), RODATA, $8 DATA ·libc_munlockall_trampoline_addr(SB)/8, $libc_munlockall_trampoline<>(SB) +TEXT libc_closedir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_closedir(SB) + +GLOBL ·libc_closedir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_closedir_trampoline_addr(SB)/8, $libc_closedir_trampoline<>(SB) + +TEXT libc_readdir_r_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_readdir_r(SB) + +GLOBL ·libc_readdir_r_trampoline_addr(SB), RODATA, $8 +DATA ·libc_readdir_r_trampoline_addr(SB)/8, $libc_readdir_r_trampoline<>(SB) + TEXT libc_pipe_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pipe(SB) @@ -690,6 +705,11 @@ TEXT libc_select_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_select_trampoline_addr(SB), RODATA, $8 DATA ·libc_select_trampoline_addr(SB)/8, $libc_select_trampoline<>(SB) +TEXT libc_setattrlist_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setattrlist(SB) +GLOBL ·libc_setattrlist_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setattrlist_trampoline_addr(SB)/8, $libc_setattrlist_trampoline<>(SB) + TEXT libc_setegid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setegid(SB) @@ -744,12 +764,6 @@ TEXT libc_setreuid_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_setreuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setreuid_trampoline_addr(SB)/8, $libc_setreuid_trampoline<>(SB) -TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_setrlimit(SB) - -GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $8 -DATA ·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB) - TEXT libc_setsid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setsid(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.1_13.go b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.1_13.go deleted file mode 100644 index cec595d..0000000 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.1_13.go +++ /dev/null @@ -1,40 +0,0 @@ -// go run mksyscall.go -tags darwin,arm64,go1.13 syscall_darwin.1_13.go -// Code generated by the command above; see README.md. DO NOT EDIT. - -//go:build darwin && arm64 && go1.13 -// +build darwin,arm64,go1.13 - -package unix - -import ( - "syscall" - "unsafe" -) - -var _ syscall.Errno - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func closedir(dir uintptr) (err error) { - _, _, e1 := syscall_syscall(libc_closedir_trampoline_addr, uintptr(dir), 0, 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_closedir_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_closedir closedir "/usr/lib/libSystem.B.dylib" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func readdir_r(dir uintptr, entry *Dirent, result **Dirent) (res Errno) { - r0, _, _ := syscall_syscall(libc_readdir_r_trampoline_addr, uintptr(dir), uintptr(unsafe.Pointer(entry)), uintptr(unsafe.Pointer(result))) - res = Errno(r0) - return -} - -var libc_readdir_r_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_readdir_r readdir_r "/usr/lib/libSystem.B.dylib" diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.1_13.s b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.1_13.s deleted file mode 100644 index 3579897..0000000 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.1_13.s +++ /dev/null @@ -1,25 +0,0 @@ -// go run mkasm_darwin.go arm64 -// Code generated by the command above; DO NOT EDIT. - -//go:build go1.13 -// +build go1.13 - -#include "textflag.h" - -TEXT libc_fdopendir_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_fdopendir(SB) - -GLOBL ·libc_fdopendir_trampoline_addr(SB), RODATA, $8 -DATA ·libc_fdopendir_trampoline_addr(SB)/8, $libc_fdopendir_trampoline<>(SB) - -TEXT libc_closedir_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_closedir(SB) - -GLOBL ·libc_closedir_trampoline_addr(SB), RODATA, $8 -DATA ·libc_closedir_trampoline_addr(SB)/8, $libc_closedir_trampoline<>(SB) - -TEXT libc_readdir_r_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_readdir_r(SB) - -GLOBL ·libc_readdir_r_trampoline_addr(SB), RODATA, $8 -DATA ·libc_readdir_r_trampoline_addr(SB)/8, $libc_readdir_r_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go index 35938d3..51d6f3f 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go @@ -1,8 +1,8 @@ -// go run mksyscall.go -tags darwin,arm64,go1.12 syscall_bsd.go syscall_darwin.go syscall_darwin_arm64.go +// go run mksyscall.go -tags darwin,arm64 syscall_bsd.go syscall_darwin.go syscall_darwin_arm64.go // Code generated by the command above; see README.md. DO NOT EDIT. -//go:build darwin && arm64 && go1.12 -// +build darwin,arm64,go1.12 +//go:build darwin && arm64 +// +build darwin,arm64 package unix @@ -463,6 +463,32 @@ var libc_munlockall_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func closedir(dir uintptr) (err error) { + _, _, e1 := syscall_syscall(libc_closedir_trampoline_addr, uintptr(dir), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_closedir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_closedir closedir "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func readdir_r(dir uintptr, entry *Dirent, result **Dirent) (res Errno) { + r0, _, _ := syscall_syscall(libc_readdir_r_trampoline_addr, uintptr(dir), uintptr(unsafe.Pointer(entry)), uintptr(unsafe.Pointer(result))) + res = Errno(r0) + return +} + +var libc_readdir_r_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_readdir_r readdir_r "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func pipe(p *[2]int32) (err error) { _, _, e1 := syscall_rawSyscall(libc_pipe_trampoline_addr, uintptr(unsafe.Pointer(p)), 0, 0) if e1 != 0 { @@ -699,6 +725,14 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { + _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + var libc_ioctl_trampoline_addr uintptr //go:cgo_import_dynamic libc_ioctl ioctl "/usr/lib/libSystem.B.dylib" @@ -1958,6 +1992,31 @@ var libc_select_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func Setattrlist(path string, attrlist *Attrlist, attrBuf []byte, options int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 unsafe.Pointer + if len(attrBuf) > 0 { + _p1 = unsafe.Pointer(&attrBuf[0]) + } else { + _p1 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall6(libc_setattrlist_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(attrlist)), uintptr(_p1), uintptr(len(attrBuf)), uintptr(options), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setattrlist_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setattrlist setattrlist "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Setegid(egid int) (err error) { _, _, e1 := syscall_syscall(libc_setegid_trampoline_addr, uintptr(egid), 0, 0) if e1 != 0 { @@ -2089,20 +2148,6 @@ var libc_setreuid_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_setrlimit_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_setrlimit setrlimit "/usr/lib/libSystem.B.dylib" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := syscall_rawSyscall(libc_setsid_trampoline_addr, 0, 0, 0) pid = int(r0) @@ -2476,6 +2521,14 @@ func ptrace1(request int, pid int, addr uintptr, data uintptr) (err error) { return } +func ptrace1Ptr(request int, pid int, addr uintptr, data unsafe.Pointer) (err error) { + _, _, e1 := syscall_syscall6(libc_ptrace_trampoline_addr, uintptr(request), uintptr(pid), addr, uintptr(data), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + var libc_ptrace_trampoline_addr uintptr //go:cgo_import_dynamic libc_ptrace ptrace "/usr/lib/libSystem.B.dylib" diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s index b09e5bb..c3b82c0 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s @@ -1,11 +1,14 @@ -// go run mkasm_darwin.go arm64 +// go run mkasm.go darwin arm64 // Code generated by the command above; DO NOT EDIT. -//go:build go1.12 -// +build go1.12 - #include "textflag.h" +TEXT libc_fdopendir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fdopendir(SB) + +GLOBL ·libc_fdopendir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fdopendir_trampoline_addr(SB)/8, $libc_fdopendir_trampoline<>(SB) + TEXT libc_getgroups_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getgroups(SB) @@ -174,6 +177,18 @@ TEXT libc_munlockall_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_munlockall_trampoline_addr(SB), RODATA, $8 DATA ·libc_munlockall_trampoline_addr(SB)/8, $libc_munlockall_trampoline<>(SB) +TEXT libc_closedir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_closedir(SB) + +GLOBL ·libc_closedir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_closedir_trampoline_addr(SB)/8, $libc_closedir_trampoline<>(SB) + +TEXT libc_readdir_r_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_readdir_r(SB) + +GLOBL ·libc_readdir_r_trampoline_addr(SB), RODATA, $8 +DATA ·libc_readdir_r_trampoline_addr(SB)/8, $libc_readdir_r_trampoline<>(SB) + TEXT libc_pipe_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pipe(SB) @@ -690,6 +705,11 @@ TEXT libc_select_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_select_trampoline_addr(SB), RODATA, $8 DATA ·libc_select_trampoline_addr(SB)/8, $libc_select_trampoline<>(SB) +TEXT libc_setattrlist_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setattrlist(SB) +GLOBL ·libc_setattrlist_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setattrlist_trampoline_addr(SB)/8, $libc_setattrlist_trampoline<>(SB) + TEXT libc_setegid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setegid(SB) @@ -744,12 +764,6 @@ TEXT libc_setreuid_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_setreuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setreuid_trampoline_addr(SB)/8, $libc_setreuid_trampoline<>(SB) -TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_setrlimit(SB) - -GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $8 -DATA ·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB) - TEXT libc_setsid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setsid(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go index 1b6eedf..0eabac7 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go @@ -436,6 +436,16 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { + _, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { var _p0 unsafe.Pointer if len(mib) > 0 { @@ -552,6 +562,16 @@ func Chroot(path string) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ClockGettime(clockid int32, time *Timespec) (err error) { + _, _, e1 := Syscall(SYS_CLOCK_GETTIME, uintptr(clockid), uintptr(unsafe.Pointer(time)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Close(fd int) (err error) { _, _, e1 := Syscall(SYS_CLOSE, uintptr(fd), 0, 0) if e1 != 0 { @@ -1390,16 +1410,6 @@ func Setresuid(ruid int, euid int, suid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go index 039c4aa..ee313eb 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go @@ -388,6 +388,16 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { + _, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { var _p0 unsafe.Pointer if len(mib) > 0 { @@ -414,6 +424,16 @@ func ptrace(request int, pid int, addr uintptr, data int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ptracePtr(request int, pid int, addr unsafe.Pointer, data int) (err error) { + _, _, e1 := Syscall6(SYS_PTRACE, uintptr(request), uintptr(pid), uintptr(addr), uintptr(data), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Access(path string, mode uint32) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) @@ -544,6 +564,16 @@ func Chroot(path string) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ClockGettime(clockid int32, time *Timespec) (err error) { + _, _, e1 := Syscall(SYS_CLOCK_GETTIME, uintptr(clockid), uintptr(unsafe.Pointer(time)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Close(fd int) (err error) { _, _, e1 := Syscall(SYS_CLOSE, uintptr(fd), 0, 0) if e1 != 0 { @@ -1615,16 +1645,6 @@ func Setresuid(ruid int, euid int, suid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go index 0535d3c..4c986e4 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go @@ -388,6 +388,16 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { + _, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { var _p0 unsafe.Pointer if len(mib) > 0 { @@ -414,6 +424,16 @@ func ptrace(request int, pid int, addr uintptr, data int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ptracePtr(request int, pid int, addr unsafe.Pointer, data int) (err error) { + _, _, e1 := Syscall6(SYS_PTRACE, uintptr(request), uintptr(pid), uintptr(addr), uintptr(data), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Access(path string, mode uint32) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) @@ -544,6 +564,16 @@ func Chroot(path string) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ClockGettime(clockid int32, time *Timespec) (err error) { + _, _, e1 := Syscall(SYS_CLOCK_GETTIME, uintptr(clockid), uintptr(unsafe.Pointer(time)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Close(fd int) (err error) { _, _, e1 := Syscall(SYS_CLOSE, uintptr(fd), 0, 0) if e1 != 0 { @@ -1615,16 +1645,6 @@ func Setresuid(ruid int, euid int, suid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go index 1018b52..5552169 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go @@ -388,6 +388,16 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { + _, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { var _p0 unsafe.Pointer if len(mib) > 0 { @@ -414,6 +424,16 @@ func ptrace(request int, pid int, addr uintptr, data int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ptracePtr(request int, pid int, addr unsafe.Pointer, data int) (err error) { + _, _, e1 := Syscall6(SYS_PTRACE, uintptr(request), uintptr(pid), uintptr(addr), uintptr(data), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Access(path string, mode uint32) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) @@ -544,6 +564,16 @@ func Chroot(path string) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ClockGettime(clockid int32, time *Timespec) (err error) { + _, _, e1 := Syscall(SYS_CLOCK_GETTIME, uintptr(clockid), uintptr(unsafe.Pointer(time)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Close(fd int) (err error) { _, _, e1 := Syscall(SYS_CLOSE, uintptr(fd), 0, 0) if e1 != 0 { @@ -1615,16 +1645,6 @@ func Setresuid(ruid int, euid int, suid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go index 3802f4b..67a226f 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go @@ -388,6 +388,16 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { + _, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { var _p0 unsafe.Pointer if len(mib) > 0 { @@ -414,6 +424,16 @@ func ptrace(request int, pid int, addr uintptr, data int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ptracePtr(request int, pid int, addr unsafe.Pointer, data int) (err error) { + _, _, e1 := Syscall6(SYS_PTRACE, uintptr(request), uintptr(pid), uintptr(addr), uintptr(data), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Access(path string, mode uint32) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) @@ -544,6 +564,16 @@ func Chroot(path string) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ClockGettime(clockid int32, time *Timespec) (err error) { + _, _, e1 := Syscall(SYS_CLOCK_GETTIME, uintptr(clockid), uintptr(unsafe.Pointer(time)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Close(fd int) (err error) { _, _, e1 := Syscall(SYS_CLOSE, uintptr(fd), 0, 0) if e1 != 0 { @@ -1615,16 +1645,6 @@ func Setresuid(ruid int, euid int, suid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go index 8a2db7d..f0b9dda 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go @@ -388,6 +388,16 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { + _, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { var _p0 unsafe.Pointer if len(mib) > 0 { @@ -414,6 +424,16 @@ func ptrace(request int, pid int, addr uintptr, data int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ptracePtr(request int, pid int, addr unsafe.Pointer, data int) (err error) { + _, _, e1 := Syscall6(SYS_PTRACE, uintptr(request), uintptr(pid), uintptr(addr), uintptr(data), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Access(path string, mode uint32) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) @@ -544,6 +564,16 @@ func Chroot(path string) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ClockGettime(clockid int32, time *Timespec) (err error) { + _, _, e1 := Syscall(SYS_CLOCK_GETTIME, uintptr(clockid), uintptr(unsafe.Pointer(time)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Close(fd int) (err error) { _, _, e1 := Syscall(SYS_CLOSE, uintptr(fd), 0, 0) if e1 != 0 { @@ -1615,16 +1645,6 @@ func Setresuid(ruid int, euid int, suid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_illumos_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_illumos_amd64.go index af5cb06..b57c705 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_illumos_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_illumos_amd64.go @@ -15,25 +15,19 @@ import ( //go:cgo_import_dynamic libc_writev writev "libc.so" //go:cgo_import_dynamic libc_pwritev pwritev "libc.so" //go:cgo_import_dynamic libc_accept4 accept4 "libsocket.so" -//go:cgo_import_dynamic libc_putmsg putmsg "libc.so" -//go:cgo_import_dynamic libc_getmsg getmsg "libc.so" //go:linkname procreadv libc_readv //go:linkname procpreadv libc_preadv //go:linkname procwritev libc_writev //go:linkname procpwritev libc_pwritev //go:linkname procaccept4 libc_accept4 -//go:linkname procputmsg libc_putmsg -//go:linkname procgetmsg libc_getmsg var ( procreadv, procpreadv, procwritev, procpwritev, - procaccept4, - procputmsg, - procgetmsg syscallFunc + procaccept4 syscallFunc ) // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -106,23 +100,3 @@ func accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, } return } - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func putmsg(fd int, clptr *strbuf, dataptr *strbuf, flags int) (err error) { - _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procputmsg)), 4, uintptr(fd), uintptr(unsafe.Pointer(clptr)), uintptr(unsafe.Pointer(dataptr)), uintptr(flags), 0, 0) - if e1 != 0 { - err = e1 - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func getmsg(fd int, clptr *strbuf, dataptr *strbuf, flags *int) (err error) { - _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procgetmsg)), 4, uintptr(fd), uintptr(unsafe.Pointer(clptr)), uintptr(unsafe.Pointer(dataptr)), uintptr(unsafe.Pointer(flags)), 0, 0) - if e1 != 0 { - err = e1 - } - return -} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux.go b/vendor/golang.org/x/sys/unix/zsyscall_linux.go index bc4a275..7ceec23 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux.go @@ -379,6 +379,16 @@ func ptrace(request int, pid int, addr uintptr, data uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ptracePtr(request int, pid int, addr uintptr, data unsafe.Pointer) (err error) { + _, _, e1 := Syscall6(SYS_PTRACE, uintptr(request), uintptr(pid), uintptr(addr), uintptr(data), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func reboot(magic1 uint, magic2 uint, cmd int, arg string) (err error) { var _p0 *byte _p0, err = BytePtrFromString(arg) @@ -537,6 +547,17 @@ func Chroot(path string) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ClockAdjtime(clockid int32, buf *Timex) (state int, err error) { + r0, _, e1 := Syscall(SYS_CLOCK_ADJTIME, uintptr(clockid), uintptr(unsafe.Pointer(buf)), 0) + state = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ClockGetres(clockid int32, res *Timespec) (err error) { _, _, e1 := Syscall(SYS_CLOCK_GETRES, uintptr(clockid), uintptr(unsafe.Pointer(res)), 0) if e1 != 0 { @@ -1325,16 +1346,6 @@ func PivotRoot(newroot string, putold string) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Prlimit(pid int, resource int, newlimit *Rlimit, old *Rlimit) (err error) { - _, _, e1 := RawSyscall6(SYS_PRLIMIT64, uintptr(pid), uintptr(resource), uintptr(unsafe.Pointer(newlimit)), uintptr(unsafe.Pointer(old)), 0, 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Prctl(option int, arg2 uintptr, arg3 uintptr, arg4 uintptr, arg5 uintptr) (err error) { _, _, e1 := Syscall6(SYS_PRCTL, uintptr(option), uintptr(arg2), uintptr(arg3), uintptr(arg4), uintptr(arg5), 0) if e1 != 0 { @@ -1857,6 +1868,17 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func mremap(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldaddr), uintptr(oldlength), uintptr(newlength), uintptr(flags), uintptr(newaddr), 0) + xaddr = uintptr(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Madvise(b []byte, advice int) (err error) { var _p0 unsafe.Pointer if len(b) > 0 { @@ -2151,3 +2173,27 @@ func setitimer(which int, newValue *Itimerval, oldValue *Itimerval) (err error) } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func rtSigprocmask(how int, set *Sigset_t, oldset *Sigset_t, sigsetsize uintptr) (err error) { + _, _, e1 := RawSyscall6(SYS_RT_SIGPROCMASK, uintptr(how), uintptr(unsafe.Pointer(set)), uintptr(unsafe.Pointer(oldset)), uintptr(sigsetsize), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + RawSyscallNoError(SYS_GETRESUID, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + RawSyscallNoError(SYS_GETRESGID, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go index 88af526..07b549c 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go @@ -287,46 +287,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID32, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID32, uintptr(rgid), uintptr(egid), uintptr(sgid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID32, uintptr(ruid), uintptr(euid), uintptr(suid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID32, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int, err error) { r0, _, e1 := Syscall6(SYS_SPLICE, uintptr(rfd), uintptr(unsafe.Pointer(roff)), uintptr(wfd), uintptr(unsafe.Pointer(woff)), uintptr(len), uintptr(flags)) n = int(r0) @@ -451,16 +411,6 @@ func getrlimit(resource int, rlim *rlimit32) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func setrlimit(resource int, rlim *rlimit32) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func futimesat(dirfd int, path string, times *[2]Timeval) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go index 2a0c4aa..5f481bf 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go @@ -334,56 +334,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go index 4882bde..824cd52 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go @@ -412,46 +412,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID32, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID32, uintptr(rgid), uintptr(egid), uintptr(sgid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID32, uintptr(ruid), uintptr(euid), uintptr(suid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID32, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { @@ -618,16 +578,6 @@ func getrlimit(resource int, rlim *rlimit32) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func setrlimit(resource int, rlim *rlimit32) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func armSyncFileRange(fd int, flags int, off int64, n int64) (err error) { _, _, e1 := Syscall6(SYS_ARM_SYNC_FILE_RANGE, uintptr(fd), uintptr(flags), uintptr(off), uintptr(off>>32), uintptr(n), uintptr(n>>32)) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go index 9f8c24e..e77aecf 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go @@ -289,56 +289,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go index 523f2ba..806ffd1 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go @@ -223,46 +223,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go index d7d6f42..961a3af 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go @@ -248,46 +248,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { @@ -684,16 +644,6 @@ func getrlimit(resource int, rlim *rlimit32) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func setrlimit(resource int, rlim *rlimit32) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Alarm(seconds uint) (remaining uint, err error) { r0, _, e1 := Syscall(SYS_ALARM, uintptr(seconds), 0, 0) remaining = uint(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go index 7f1f8e6..ed05005 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go @@ -278,56 +278,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go index f933d0f..d365b71 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go @@ -278,56 +278,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go index 297d0a9..c3f1b8b 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go @@ -248,46 +248,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { @@ -684,16 +644,6 @@ func getrlimit(resource int, rlim *rlimit32) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func setrlimit(resource int, rlim *rlimit32) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Alarm(seconds uint) (remaining uint, err error) { r0, _, e1 := Syscall(SYS_ALARM, uintptr(seconds), 0, 0) remaining = uint(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go index 2e32e7a..a6574cf 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go @@ -308,46 +308,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { @@ -664,16 +624,6 @@ func getrlimit(resource int, rlim *rlimit32) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func setrlimit(resource int, rlim *rlimit32) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func syncFileRange2(fd int, flags int, off int64, n int64) (err error) { _, _, e1 := Syscall6(SYS_SYNC_FILE_RANGE2, uintptr(fd), uintptr(flags), uintptr(off>>32), uintptr(off), uintptr(n>>32), uintptr(n)) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go index 3c53170..f409902 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go @@ -349,56 +349,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go index a00c674..9dfcc29 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go @@ -349,56 +349,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go index 1239cc2..0b29239 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go @@ -269,56 +269,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go index e0dabc6..6cde322 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go @@ -319,56 +319,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) { r0, _, e1 := Syscall6(SYS_SPLICE, uintptr(rfd), uintptr(unsafe.Pointer(roff)), uintptr(wfd), uintptr(unsafe.Pointer(woff)), uintptr(len), uintptr(flags)) n = int64(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go index 368623c..5253d65 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go @@ -329,56 +329,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go index 4af561a..cdb2af5 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go @@ -405,6 +405,16 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { + _, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { var _p0 unsafe.Pointer if len(mib) > 0 { @@ -521,6 +531,16 @@ func Chroot(path string) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ClockGettime(clockid int32, time *Timespec) (err error) { + _, _, e1 := Syscall(SYS_CLOCK_GETTIME, uintptr(clockid), uintptr(unsafe.Pointer(time)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Close(fd int) (err error) { _, _, e1 := Syscall(SYS_CLOSE, uintptr(fd), 0, 0) if e1 != 0 { @@ -1587,16 +1607,6 @@ func Setreuid(ruid int, euid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go index 3b90e94..9d25f76 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go @@ -405,6 +405,16 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { + _, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { var _p0 unsafe.Pointer if len(mib) > 0 { @@ -521,6 +531,16 @@ func Chroot(path string) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ClockGettime(clockid int32, time *Timespec) (err error) { + _, _, e1 := Syscall(SYS_CLOCK_GETTIME, uintptr(clockid), uintptr(unsafe.Pointer(time)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Close(fd int) (err error) { _, _, e1 := Syscall(SYS_CLOSE, uintptr(fd), 0, 0) if e1 != 0 { @@ -1587,16 +1607,6 @@ func Setreuid(ruid int, euid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go index 890f4cc..d3f8035 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go @@ -405,6 +405,16 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { + _, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { var _p0 unsafe.Pointer if len(mib) > 0 { @@ -521,6 +531,16 @@ func Chroot(path string) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ClockGettime(clockid int32, time *Timespec) (err error) { + _, _, e1 := Syscall(SYS_CLOCK_GETTIME, uintptr(clockid), uintptr(unsafe.Pointer(time)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Close(fd int) (err error) { _, _, e1 := Syscall(SYS_CLOSE, uintptr(fd), 0, 0) if e1 != 0 { @@ -1587,16 +1607,6 @@ func Setreuid(ruid int, euid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go index c79f071..887188a 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go @@ -405,6 +405,16 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { + _, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { var _p0 unsafe.Pointer if len(mib) > 0 { @@ -521,6 +531,16 @@ func Chroot(path string) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ClockGettime(clockid int32, time *Timespec) (err error) { + _, _, e1 := Syscall(SYS_CLOCK_GETTIME, uintptr(clockid), uintptr(unsafe.Pointer(time)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Close(fd int) (err error) { _, _, e1 := Syscall(SYS_CLOSE, uintptr(fd), 0, 0) if e1 != 0 { @@ -1587,16 +1607,6 @@ func Setreuid(ruid int, euid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go index a057fc5..9ab9abf 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go @@ -1,4 +1,4 @@ -// go run mksyscall.go -l32 -openbsd -tags openbsd,386 syscall_bsd.go syscall_openbsd.go syscall_openbsd_386.go +// go run mksyscall.go -l32 -openbsd -libc -tags openbsd,386 syscall_bsd.go syscall_openbsd.go syscall_openbsd_386.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build openbsd && 386 @@ -16,7 +16,7 @@ var _ syscall.Errno // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func getgroups(ngid int, gid *_Gid_t) (n int, err error) { - r0, _, e1 := RawSyscall(SYS_GETGROUPS, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0) + r0, _, e1 := syscall_rawSyscall(libc_getgroups_trampoline_addr, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -24,20 +24,28 @@ func getgroups(ngid int, gid *_Gid_t) (n int, err error) { return } +var libc_getgroups_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getgroups getgroups "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func setgroups(ngid int, gid *_Gid_t) (err error) { - _, _, e1 := RawSyscall(SYS_SETGROUPS, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0) + _, _, e1 := syscall_rawSyscall(libc_setgroups_trampoline_addr, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setgroups_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setgroups setgroups "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func wait4(pid int, wstatus *_C_int, options int, rusage *Rusage) (wpid int, err error) { - r0, _, e1 := Syscall6(SYS_WAIT4, uintptr(pid), uintptr(unsafe.Pointer(wstatus)), uintptr(options), uintptr(unsafe.Pointer(rusage)), 0, 0) + r0, _, e1 := syscall_syscall6(libc_wait4_trampoline_addr, uintptr(pid), uintptr(unsafe.Pointer(wstatus)), uintptr(options), uintptr(unsafe.Pointer(rusage)), 0, 0) wpid = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -45,10 +53,14 @@ func wait4(pid int, wstatus *_C_int, options int, rusage *Rusage) (wpid int, err return } +var libc_wait4_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_wait4 wait4 "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { - r0, _, e1 := Syscall(SYS_ACCEPT, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + r0, _, e1 := syscall_syscall(libc_accept_trampoline_addr, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) fd = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -56,30 +68,42 @@ func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { return } +var libc_accept_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_accept accept "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { - _, _, e1 := Syscall(SYS_BIND, uintptr(s), uintptr(addr), uintptr(addrlen)) + _, _, e1 := syscall_syscall(libc_bind_trampoline_addr, uintptr(s), uintptr(addr), uintptr(addrlen)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_bind_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_bind bind "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func connect(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { - _, _, e1 := Syscall(SYS_CONNECT, uintptr(s), uintptr(addr), uintptr(addrlen)) + _, _, e1 := syscall_syscall(libc_connect_trampoline_addr, uintptr(s), uintptr(addr), uintptr(addrlen)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_connect_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_connect connect "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func socket(domain int, typ int, proto int) (fd int, err error) { - r0, _, e1 := RawSyscall(SYS_SOCKET, uintptr(domain), uintptr(typ), uintptr(proto)) + r0, _, e1 := syscall_rawSyscall(libc_socket_trampoline_addr, uintptr(domain), uintptr(typ), uintptr(proto)) fd = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -87,66 +111,94 @@ func socket(domain int, typ int, proto int) (fd int, err error) { return } +var libc_socket_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_socket socket "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func getsockopt(s int, level int, name int, val unsafe.Pointer, vallen *_Socklen) (err error) { - _, _, e1 := Syscall6(SYS_GETSOCKOPT, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(unsafe.Pointer(vallen)), 0) + _, _, e1 := syscall_syscall6(libc_getsockopt_trampoline_addr, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(unsafe.Pointer(vallen)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_getsockopt_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getsockopt getsockopt "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func setsockopt(s int, level int, name int, val unsafe.Pointer, vallen uintptr) (err error) { - _, _, e1 := Syscall6(SYS_SETSOCKOPT, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(vallen), 0) + _, _, e1 := syscall_syscall6(libc_setsockopt_trampoline_addr, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(vallen), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setsockopt_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setsockopt setsockopt "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func getpeername(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { - _, _, e1 := RawSyscall(SYS_GETPEERNAME, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + _, _, e1 := syscall_rawSyscall(libc_getpeername_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) if e1 != 0 { err = errnoErr(e1) } return } +var libc_getpeername_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpeername getpeername "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func getsockname(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { - _, _, e1 := RawSyscall(SYS_GETSOCKNAME, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + _, _, e1 := syscall_rawSyscall(libc_getsockname_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) if e1 != 0 { err = errnoErr(e1) } return } +var libc_getsockname_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getsockname getsockname "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Shutdown(s int, how int) (err error) { - _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(s), uintptr(how), 0) + _, _, e1 := syscall_syscall(libc_shutdown_trampoline_addr, uintptr(s), uintptr(how), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_shutdown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_shutdown shutdown "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func socketpair(domain int, typ int, proto int, fd *[2]int32) (err error) { - _, _, e1 := RawSyscall6(SYS_SOCKETPAIR, uintptr(domain), uintptr(typ), uintptr(proto), uintptr(unsafe.Pointer(fd)), 0, 0) + _, _, e1 := syscall_rawSyscall6(libc_socketpair_trampoline_addr, uintptr(domain), uintptr(typ), uintptr(proto), uintptr(unsafe.Pointer(fd)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_socketpair_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_socketpair socketpair "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Socklen) (n int, err error) { @@ -156,7 +208,7 @@ func recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Sockl } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall6(SYS_RECVFROM, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(flags), uintptr(unsafe.Pointer(from)), uintptr(unsafe.Pointer(fromlen))) + r0, _, e1 := syscall_syscall6(libc_recvfrom_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(flags), uintptr(unsafe.Pointer(from)), uintptr(unsafe.Pointer(fromlen))) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -164,6 +216,10 @@ func recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Sockl return } +var libc_recvfrom_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_recvfrom recvfrom "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) (err error) { @@ -173,17 +229,21 @@ func sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) ( } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall6(SYS_SENDTO, uintptr(s), uintptr(_p0), uintptr(len(buf)), uintptr(flags), uintptr(to), uintptr(addrlen)) + _, _, e1 := syscall_syscall6(libc_sendto_trampoline_addr, uintptr(s), uintptr(_p0), uintptr(len(buf)), uintptr(flags), uintptr(to), uintptr(addrlen)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_sendto_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sendto sendto "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func recvmsg(s int, msg *Msghdr, flags int) (n int, err error) { - r0, _, e1 := Syscall(SYS_RECVMSG, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) + r0, _, e1 := syscall_syscall(libc_recvmsg_trampoline_addr, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -191,10 +251,14 @@ func recvmsg(s int, msg *Msghdr, flags int) (n int, err error) { return } +var libc_recvmsg_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_recvmsg recvmsg "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) { - r0, _, e1 := Syscall(SYS_SENDMSG, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) + r0, _, e1 := syscall_syscall(libc_sendmsg_trampoline_addr, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -202,10 +266,14 @@ func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) { return } +var libc_sendmsg_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sendmsg sendmsg "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func kevent(kq int, change unsafe.Pointer, nchange int, event unsafe.Pointer, nevent int, timeout *Timespec) (n int, err error) { - r0, _, e1 := Syscall6(SYS_KEVENT, uintptr(kq), uintptr(change), uintptr(nchange), uintptr(event), uintptr(nevent), uintptr(unsafe.Pointer(timeout))) + r0, _, e1 := syscall_syscall6(libc_kevent_trampoline_addr, uintptr(kq), uintptr(change), uintptr(nchange), uintptr(event), uintptr(nevent), uintptr(unsafe.Pointer(timeout))) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -213,6 +281,10 @@ func kevent(kq int, change unsafe.Pointer, nchange int, event unsafe.Pointer, ne return } +var libc_kevent_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_kevent kevent "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func utimes(path string, timeval *[2]Timeval) (err error) { @@ -221,27 +293,35 @@ func utimes(path string, timeval *[2]Timeval) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_UTIMES, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(timeval)), 0) + _, _, e1 := syscall_syscall(libc_utimes_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(timeval)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_utimes_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_utimes utimes "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func futimes(fd int, timeval *[2]Timeval) (err error) { - _, _, e1 := Syscall(SYS_FUTIMES, uintptr(fd), uintptr(unsafe.Pointer(timeval)), 0) + _, _, e1 := syscall_syscall(libc_futimes_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(timeval)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_futimes_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_futimes futimes "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func poll(fds *PollFd, nfds int, timeout int) (n int, err error) { - r0, _, e1 := Syscall(SYS_POLL, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(timeout)) + r0, _, e1 := syscall_syscall(libc_poll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(timeout)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -249,6 +329,10 @@ func poll(fds *PollFd, nfds int, timeout int) (n int, err error) { return } +var libc_poll_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_poll poll "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Madvise(b []byte, behav int) (err error) { @@ -258,13 +342,17 @@ func Madvise(b []byte, behav int) (err error) { } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall(SYS_MADVISE, uintptr(_p0), uintptr(len(b)), uintptr(behav)) + _, _, e1 := syscall_syscall(libc_madvise_trampoline_addr, uintptr(_p0), uintptr(len(b)), uintptr(behav)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_madvise_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_madvise madvise "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mlock(b []byte) (err error) { @@ -274,23 +362,31 @@ func Mlock(b []byte) (err error) { } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall(SYS_MLOCK, uintptr(_p0), uintptr(len(b)), 0) + _, _, e1 := syscall_syscall(libc_mlock_trampoline_addr, uintptr(_p0), uintptr(len(b)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mlock_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mlock mlock "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mlockall(flags int) (err error) { - _, _, e1 := Syscall(SYS_MLOCKALL, uintptr(flags), 0, 0) + _, _, e1 := syscall_syscall(libc_mlockall_trampoline_addr, uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mlockall_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mlockall mlockall "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mprotect(b []byte, prot int) (err error) { @@ -300,13 +396,17 @@ func Mprotect(b []byte, prot int) (err error) { } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall(SYS_MPROTECT, uintptr(_p0), uintptr(len(b)), uintptr(prot)) + _, _, e1 := syscall_syscall(libc_mprotect_trampoline_addr, uintptr(_p0), uintptr(len(b)), uintptr(prot)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mprotect_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mprotect mprotect "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Msync(b []byte, flags int) (err error) { @@ -316,13 +416,17 @@ func Msync(b []byte, flags int) (err error) { } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall(SYS_MSYNC, uintptr(_p0), uintptr(len(b)), uintptr(flags)) + _, _, e1 := syscall_syscall(libc_msync_trampoline_addr, uintptr(_p0), uintptr(len(b)), uintptr(flags)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_msync_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_msync msync "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Munlock(b []byte) (err error) { @@ -332,33 +436,45 @@ func Munlock(b []byte) (err error) { } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall(SYS_MUNLOCK, uintptr(_p0), uintptr(len(b)), 0) + _, _, e1 := syscall_syscall(libc_munlock_trampoline_addr, uintptr(_p0), uintptr(len(b)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_munlock_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_munlock munlock "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Munlockall() (err error) { - _, _, e1 := Syscall(SYS_MUNLOCKALL, 0, 0, 0) + _, _, e1 := syscall_syscall(libc_munlockall_trampoline_addr, 0, 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_munlockall_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_munlockall munlockall "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func pipe2(p *[2]_C_int, flags int) (err error) { - _, _, e1 := RawSyscall(SYS_PIPE2, uintptr(unsafe.Pointer(p)), uintptr(flags), 0) + _, _, e1 := syscall_rawSyscall(libc_pipe2_trampoline_addr, uintptr(unsafe.Pointer(p)), uintptr(flags), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_pipe2_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pipe2 pipe2 "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getdents(fd int, buf []byte) (n int, err error) { @@ -368,7 +484,7 @@ func Getdents(fd int, buf []byte) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall(SYS_GETDENTS, uintptr(fd), uintptr(_p0), uintptr(len(buf))) + r0, _, e1 := syscall_syscall(libc_getdents_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(buf))) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -376,6 +492,10 @@ func Getdents(fd int, buf []byte) (n int, err error) { return } +var libc_getdents_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getdents getdents "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getcwd(buf []byte) (n int, err error) { @@ -385,7 +505,7 @@ func Getcwd(buf []byte) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall(SYS___GETCWD, uintptr(_p0), uintptr(len(buf)), 0) + r0, _, e1 := syscall_syscall(libc_getcwd_trampoline_addr, uintptr(_p0), uintptr(len(buf)), 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -393,16 +513,54 @@ func Getcwd(buf []byte) (n int, err error) { return } +var libc_getcwd_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getcwd getcwd "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func ioctl(fd int, req uint, arg uintptr) (err error) { - _, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg)) + _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { + _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -412,17 +570,21 @@ func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall6(SYS___SYSCTL, uintptr(_p0), uintptr(len(mib)), uintptr(unsafe.Pointer(old)), uintptr(unsafe.Pointer(oldlen)), uintptr(unsafe.Pointer(new)), uintptr(newlen)) + _, _, e1 := syscall_syscall6(libc_sysctl_trampoline_addr, uintptr(_p0), uintptr(len(mib)), uintptr(unsafe.Pointer(old)), uintptr(unsafe.Pointer(oldlen)), uintptr(unsafe.Pointer(new)), uintptr(newlen)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_sysctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sysctl sysctl "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { - r0, _, e1 := Syscall6(SYS_PPOLL, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) + r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -430,6 +592,10 @@ func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, return } +var libc_ppoll_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ppoll ppoll "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Access(path string, mode uint32) (err error) { @@ -438,23 +604,31 @@ func Access(path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_ACCESS, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + _, _, e1 := syscall_syscall(libc_access_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_access_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_access access "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Adjtime(delta *Timeval, olddelta *Timeval) (err error) { - _, _, e1 := Syscall(SYS_ADJTIME, uintptr(unsafe.Pointer(delta)), uintptr(unsafe.Pointer(olddelta)), 0) + _, _, e1 := syscall_syscall(libc_adjtime_trampoline_addr, uintptr(unsafe.Pointer(delta)), uintptr(unsafe.Pointer(olddelta)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_adjtime_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_adjtime adjtime "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Chdir(path string) (err error) { @@ -463,13 +637,17 @@ func Chdir(path string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_CHDIR, uintptr(unsafe.Pointer(_p0)), 0, 0) + _, _, e1 := syscall_syscall(libc_chdir_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_chdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chdir chdir "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Chflags(path string, flags int) (err error) { @@ -478,13 +656,17 @@ func Chflags(path string, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_CHFLAGS, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) + _, _, e1 := syscall_syscall(libc_chflags_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_chflags_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chflags chflags "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Chmod(path string, mode uint32) (err error) { @@ -493,13 +675,17 @@ func Chmod(path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_CHMOD, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + _, _, e1 := syscall_syscall(libc_chmod_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_chmod_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chmod chmod "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Chown(path string, uid int, gid int) (err error) { @@ -508,13 +694,17 @@ func Chown(path string, uid int, gid int) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_CHOWN, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) + _, _, e1 := syscall_syscall(libc_chown_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_chown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chown chown "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Chroot(path string) (err error) { @@ -523,27 +713,49 @@ func Chroot(path string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_CHROOT, uintptr(unsafe.Pointer(_p0)), 0, 0) + _, _, e1 := syscall_syscall(libc_chroot_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_chroot_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chroot chroot "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ClockGettime(clockid int32, time *Timespec) (err error) { + _, _, e1 := syscall_syscall(libc_clock_gettime_trampoline_addr, uintptr(clockid), uintptr(unsafe.Pointer(time)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_clock_gettime_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_clock_gettime clock_gettime "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Close(fd int) (err error) { - _, _, e1 := Syscall(SYS_CLOSE, uintptr(fd), 0, 0) + _, _, e1 := syscall_syscall(libc_close_trampoline_addr, uintptr(fd), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_close_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_close close "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Dup(fd int) (nfd int, err error) { - r0, _, e1 := Syscall(SYS_DUP, uintptr(fd), 0, 0) + r0, _, e1 := syscall_syscall(libc_dup_trampoline_addr, uintptr(fd), 0, 0) nfd = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -551,33 +763,49 @@ func Dup(fd int) (nfd int, err error) { return } +var libc_dup_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_dup dup "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Dup2(from int, to int) (err error) { - _, _, e1 := Syscall(SYS_DUP2, uintptr(from), uintptr(to), 0) + _, _, e1 := syscall_syscall(libc_dup2_trampoline_addr, uintptr(from), uintptr(to), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_dup2_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_dup2 dup2 "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Dup3(from int, to int, flags int) (err error) { - _, _, e1 := Syscall(SYS_DUP3, uintptr(from), uintptr(to), uintptr(flags)) + _, _, e1 := syscall_syscall(libc_dup3_trampoline_addr, uintptr(from), uintptr(to), uintptr(flags)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_dup3_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_dup3 dup3 "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Exit(code int) { - Syscall(SYS_EXIT, uintptr(code), 0, 0) + syscall_syscall(libc_exit_trampoline_addr, uintptr(code), 0, 0) return } +var libc_exit_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_exit exit "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) { @@ -586,43 +814,59 @@ func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_FACCESSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) + _, _, e1 := syscall_syscall6(libc_faccessat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_faccessat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_faccessat faccessat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fchdir(fd int) (err error) { - _, _, e1 := Syscall(SYS_FCHDIR, uintptr(fd), 0, 0) + _, _, e1 := syscall_syscall(libc_fchdir_trampoline_addr, uintptr(fd), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fchdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchdir fchdir "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fchflags(fd int, flags int) (err error) { - _, _, e1 := Syscall(SYS_FCHFLAGS, uintptr(fd), uintptr(flags), 0) + _, _, e1 := syscall_syscall(libc_fchflags_trampoline_addr, uintptr(fd), uintptr(flags), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fchflags_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchflags fchflags "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fchmod(fd int, mode uint32) (err error) { - _, _, e1 := Syscall(SYS_FCHMOD, uintptr(fd), uintptr(mode), 0) + _, _, e1 := syscall_syscall(libc_fchmod_trampoline_addr, uintptr(fd), uintptr(mode), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fchmod_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchmod fchmod "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) { @@ -631,23 +875,31 @@ func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_FCHMODAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) + _, _, e1 := syscall_syscall6(libc_fchmodat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fchmodat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchmodat fchmodat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fchown(fd int, uid int, gid int) (err error) { - _, _, e1 := Syscall(SYS_FCHOWN, uintptr(fd), uintptr(uid), uintptr(gid)) + _, _, e1 := syscall_syscall(libc_fchown_trampoline_addr, uintptr(fd), uintptr(uid), uintptr(gid)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fchown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchown fchown "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fchownat(dirfd int, path string, uid int, gid int, flags int) (err error) { @@ -656,27 +908,35 @@ func Fchownat(dirfd int, path string, uid int, gid int, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_FCHOWNAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), uintptr(flags), 0) + _, _, e1 := syscall_syscall6(libc_fchownat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), uintptr(flags), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fchownat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchownat fchownat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Flock(fd int, how int) (err error) { - _, _, e1 := Syscall(SYS_FLOCK, uintptr(fd), uintptr(how), 0) + _, _, e1 := syscall_syscall(libc_flock_trampoline_addr, uintptr(fd), uintptr(how), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_flock_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_flock flock "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fpathconf(fd int, name int) (val int, err error) { - r0, _, e1 := Syscall(SYS_FPATHCONF, uintptr(fd), uintptr(name), 0) + r0, _, e1 := syscall_syscall(libc_fpathconf_trampoline_addr, uintptr(fd), uintptr(name), 0) val = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -684,16 +944,24 @@ func Fpathconf(fd int, name int) (val int, err error) { return } +var libc_fpathconf_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fpathconf fpathconf "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fstat(fd int, stat *Stat_t) (err error) { - _, _, e1 := Syscall(SYS_FSTAT, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) + _, _, e1 := syscall_syscall(libc_fstat_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fstat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fstat fstat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) { @@ -702,71 +970,99 @@ func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_FSTATAT, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), uintptr(flags), 0, 0) + _, _, e1 := syscall_syscall6(libc_fstatat_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fstatat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fstatat fstatat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fstatfs(fd int, stat *Statfs_t) (err error) { - _, _, e1 := Syscall(SYS_FSTATFS, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) + _, _, e1 := syscall_syscall(libc_fstatfs_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fstatfs_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fstatfs fstatfs "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fsync(fd int) (err error) { - _, _, e1 := Syscall(SYS_FSYNC, uintptr(fd), 0, 0) + _, _, e1 := syscall_syscall(libc_fsync_trampoline_addr, uintptr(fd), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fsync_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fsync fsync "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Ftruncate(fd int, length int64) (err error) { - _, _, e1 := Syscall6(SYS_FTRUNCATE, uintptr(fd), 0, uintptr(length), uintptr(length>>32), 0, 0) + _, _, e1 := syscall_syscall(libc_ftruncate_trampoline_addr, uintptr(fd), uintptr(length), uintptr(length>>32)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_ftruncate_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ftruncate ftruncate "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getegid() (egid int) { - r0, _, _ := RawSyscall(SYS_GETEGID, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_getegid_trampoline_addr, 0, 0, 0) egid = int(r0) return } +var libc_getegid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getegid getegid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Geteuid() (uid int) { - r0, _, _ := RawSyscall(SYS_GETEUID, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_geteuid_trampoline_addr, 0, 0, 0) uid = int(r0) return } +var libc_geteuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_geteuid geteuid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getgid() (gid int) { - r0, _, _ := RawSyscall(SYS_GETGID, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_getgid_trampoline_addr, 0, 0, 0) gid = int(r0) return } +var libc_getgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getgid getgid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getpgid(pid int) (pgid int, err error) { - r0, _, e1 := RawSyscall(SYS_GETPGID, uintptr(pid), 0, 0) + r0, _, e1 := syscall_rawSyscall(libc_getpgid_trampoline_addr, uintptr(pid), 0, 0) pgid = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -774,34 +1070,50 @@ func Getpgid(pid int) (pgid int, err error) { return } +var libc_getpgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpgid getpgid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getpgrp() (pgrp int) { - r0, _, _ := RawSyscall(SYS_GETPGRP, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_getpgrp_trampoline_addr, 0, 0, 0) pgrp = int(r0) return } +var libc_getpgrp_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpgrp getpgrp "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getpid() (pid int) { - r0, _, _ := RawSyscall(SYS_GETPID, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_getpid_trampoline_addr, 0, 0, 0) pid = int(r0) return } +var libc_getpid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpid getpid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getppid() (ppid int) { - r0, _, _ := RawSyscall(SYS_GETPPID, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_getppid_trampoline_addr, 0, 0, 0) ppid = int(r0) return } +var libc_getppid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getppid getppid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getpriority(which int, who int) (prio int, err error) { - r0, _, e1 := Syscall(SYS_GETPRIORITY, uintptr(which), uintptr(who), 0) + r0, _, e1 := syscall_syscall(libc_getpriority_trampoline_addr, uintptr(which), uintptr(who), 0) prio = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -809,20 +1121,28 @@ func Getpriority(which int, who int) (prio int, err error) { return } +var libc_getpriority_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpriority getpriority "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_GETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) + _, _, e1 := syscall_rawSyscall(libc_getrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_getrlimit_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getrlimit getrlimit "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getrtable() (rtable int, err error) { - r0, _, e1 := RawSyscall(SYS_GETRTABLE, 0, 0, 0) + r0, _, e1 := syscall_rawSyscall(libc_getrtable_trampoline_addr, 0, 0, 0) rtable = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -830,20 +1150,28 @@ func Getrtable() (rtable int, err error) { return } +var libc_getrtable_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getrtable getrtable "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getrusage(who int, rusage *Rusage) (err error) { - _, _, e1 := RawSyscall(SYS_GETRUSAGE, uintptr(who), uintptr(unsafe.Pointer(rusage)), 0) + _, _, e1 := syscall_rawSyscall(libc_getrusage_trampoline_addr, uintptr(who), uintptr(unsafe.Pointer(rusage)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_getrusage_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getrusage getrusage "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getsid(pid int) (sid int, err error) { - r0, _, e1 := RawSyscall(SYS_GETSID, uintptr(pid), 0, 0) + r0, _, e1 := syscall_rawSyscall(libc_getsid_trampoline_addr, uintptr(pid), 0, 0) sid = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -851,46 +1179,66 @@ func Getsid(pid int) (sid int, err error) { return } +var libc_getsid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getsid getsid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Gettimeofday(tv *Timeval) (err error) { - _, _, e1 := RawSyscall(SYS_GETTIMEOFDAY, uintptr(unsafe.Pointer(tv)), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_gettimeofday_trampoline_addr, uintptr(unsafe.Pointer(tv)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_gettimeofday_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_gettimeofday gettimeofday "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getuid() (uid int) { - r0, _, _ := RawSyscall(SYS_GETUID, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_getuid_trampoline_addr, 0, 0, 0) uid = int(r0) return } +var libc_getuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getuid getuid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Issetugid() (tainted bool) { - r0, _, _ := Syscall(SYS_ISSETUGID, 0, 0, 0) + r0, _, _ := syscall_syscall(libc_issetugid_trampoline_addr, 0, 0, 0) tainted = bool(r0 != 0) return } +var libc_issetugid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_issetugid issetugid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Kill(pid int, signum syscall.Signal) (err error) { - _, _, e1 := Syscall(SYS_KILL, uintptr(pid), uintptr(signum), 0) + _, _, e1 := syscall_syscall(libc_kill_trampoline_addr, uintptr(pid), uintptr(signum), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_kill_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_kill kill "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Kqueue() (fd int, err error) { - r0, _, e1 := Syscall(SYS_KQUEUE, 0, 0, 0) + r0, _, e1 := syscall_syscall(libc_kqueue_trampoline_addr, 0, 0, 0) fd = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -898,6 +1246,10 @@ func Kqueue() (fd int, err error) { return } +var libc_kqueue_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_kqueue kqueue "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Lchown(path string, uid int, gid int) (err error) { @@ -906,13 +1258,17 @@ func Lchown(path string, uid int, gid int) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_LCHOWN, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) + _, _, e1 := syscall_syscall(libc_lchown_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_lchown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_lchown lchown "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Link(path string, link string) (err error) { @@ -926,13 +1282,17 @@ func Link(path string, link string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_LINK, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) + _, _, e1 := syscall_syscall(libc_link_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_link_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_link link "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Linkat(pathfd int, path string, linkfd int, link string, flags int) (err error) { @@ -946,23 +1306,31 @@ func Linkat(pathfd int, path string, linkfd int, link string, flags int) (err er if err != nil { return } - _, _, e1 := Syscall6(SYS_LINKAT, uintptr(pathfd), uintptr(unsafe.Pointer(_p0)), uintptr(linkfd), uintptr(unsafe.Pointer(_p1)), uintptr(flags), 0) + _, _, e1 := syscall_syscall6(libc_linkat_trampoline_addr, uintptr(pathfd), uintptr(unsafe.Pointer(_p0)), uintptr(linkfd), uintptr(unsafe.Pointer(_p1)), uintptr(flags), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_linkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_linkat linkat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Listen(s int, backlog int) (err error) { - _, _, e1 := Syscall(SYS_LISTEN, uintptr(s), uintptr(backlog), 0) + _, _, e1 := syscall_syscall(libc_listen_trampoline_addr, uintptr(s), uintptr(backlog), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_listen_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_listen listen "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Lstat(path string, stat *Stat_t) (err error) { @@ -971,13 +1339,17 @@ func Lstat(path string, stat *Stat_t) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_LSTAT, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) + _, _, e1 := syscall_syscall(libc_lstat_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_lstat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_lstat lstat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mkdir(path string, mode uint32) (err error) { @@ -986,13 +1358,17 @@ func Mkdir(path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_MKDIR, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + _, _, e1 := syscall_syscall(libc_mkdir_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mkdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkdir mkdir "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mkdirat(dirfd int, path string, mode uint32) (err error) { @@ -1001,13 +1377,17 @@ func Mkdirat(dirfd int, path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_MKDIRAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) + _, _, e1 := syscall_syscall(libc_mkdirat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mkdirat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkdirat mkdirat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mkfifo(path string, mode uint32) (err error) { @@ -1016,13 +1396,17 @@ func Mkfifo(path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_MKFIFO, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + _, _, e1 := syscall_syscall(libc_mkfifo_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mkfifo_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkfifo mkfifo "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mkfifoat(dirfd int, path string, mode uint32) (err error) { @@ -1031,13 +1415,17 @@ func Mkfifoat(dirfd int, path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_MKFIFOAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) + _, _, e1 := syscall_syscall(libc_mkfifoat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mkfifoat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkfifoat mkfifoat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mknod(path string, mode uint32, dev int) (err error) { @@ -1046,13 +1434,17 @@ func Mknod(path string, mode uint32, dev int) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_MKNOD, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev)) + _, _, e1 := syscall_syscall(libc_mknod_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mknod_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mknod mknod "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mknodat(dirfd int, path string, mode uint32, dev int) (err error) { @@ -1061,23 +1453,31 @@ func Mknodat(dirfd int, path string, mode uint32, dev int) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_MKNODAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0) + _, _, e1 := syscall_syscall6(libc_mknodat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mknodat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mknodat mknodat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Nanosleep(time *Timespec, leftover *Timespec) (err error) { - _, _, e1 := Syscall(SYS_NANOSLEEP, uintptr(unsafe.Pointer(time)), uintptr(unsafe.Pointer(leftover)), 0) + _, _, e1 := syscall_syscall(libc_nanosleep_trampoline_addr, uintptr(unsafe.Pointer(time)), uintptr(unsafe.Pointer(leftover)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_nanosleep_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_nanosleep nanosleep "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Open(path string, mode int, perm uint32) (fd int, err error) { @@ -1086,7 +1486,7 @@ func Open(path string, mode int, perm uint32) (fd int, err error) { if err != nil { return } - r0, _, e1 := Syscall(SYS_OPEN, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm)) + r0, _, e1 := syscall_syscall(libc_open_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm)) fd = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1094,6 +1494,10 @@ func Open(path string, mode int, perm uint32) (fd int, err error) { return } +var libc_open_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_open open "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Openat(dirfd int, path string, mode int, perm uint32) (fd int, err error) { @@ -1102,7 +1506,7 @@ func Openat(dirfd int, path string, mode int, perm uint32) (fd int, err error) { if err != nil { return } - r0, _, e1 := Syscall6(SYS_OPENAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm), 0, 0) + r0, _, e1 := syscall_syscall6(libc_openat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm), 0, 0) fd = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1110,6 +1514,10 @@ func Openat(dirfd int, path string, mode int, perm uint32) (fd int, err error) { return } +var libc_openat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_openat openat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Pathconf(path string, name int) (val int, err error) { @@ -1118,7 +1526,7 @@ func Pathconf(path string, name int) (val int, err error) { if err != nil { return } - r0, _, e1 := Syscall(SYS_PATHCONF, uintptr(unsafe.Pointer(_p0)), uintptr(name), 0) + r0, _, e1 := syscall_syscall(libc_pathconf_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(name), 0) val = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1126,6 +1534,10 @@ func Pathconf(path string, name int) (val int, err error) { return } +var libc_pathconf_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pathconf pathconf "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func pread(fd int, p []byte, offset int64) (n int, err error) { @@ -1135,7 +1547,7 @@ func pread(fd int, p []byte, offset int64) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall6(SYS_PREAD, uintptr(fd), uintptr(_p0), uintptr(len(p)), 0, uintptr(offset), uintptr(offset>>32)) + r0, _, e1 := syscall_syscall6(libc_pread_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(offset), uintptr(offset>>32), 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1143,6 +1555,10 @@ func pread(fd int, p []byte, offset int64) (n int, err error) { return } +var libc_pread_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pread pread "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func pwrite(fd int, p []byte, offset int64) (n int, err error) { @@ -1152,7 +1568,7 @@ func pwrite(fd int, p []byte, offset int64) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall6(SYS_PWRITE, uintptr(fd), uintptr(_p0), uintptr(len(p)), 0, uintptr(offset), uintptr(offset>>32)) + r0, _, e1 := syscall_syscall6(libc_pwrite_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(offset), uintptr(offset>>32), 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1160,6 +1576,10 @@ func pwrite(fd int, p []byte, offset int64) (n int, err error) { return } +var libc_pwrite_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pwrite pwrite "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func read(fd int, p []byte) (n int, err error) { @@ -1169,7 +1589,7 @@ func read(fd int, p []byte) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(_p0), uintptr(len(p))) + r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p))) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1177,6 +1597,10 @@ func read(fd int, p []byte) (n int, err error) { return } +var libc_read_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_read read "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Readlink(path string, buf []byte) (n int, err error) { @@ -1191,7 +1615,7 @@ func Readlink(path string, buf []byte) (n int, err error) { } else { _p1 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall(SYS_READLINK, uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf))) + r0, _, e1 := syscall_syscall(libc_readlink_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf))) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1199,6 +1623,10 @@ func Readlink(path string, buf []byte) (n int, err error) { return } +var libc_readlink_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_readlink readlink "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Readlinkat(dirfd int, path string, buf []byte) (n int, err error) { @@ -1213,7 +1641,7 @@ func Readlinkat(dirfd int, path string, buf []byte) (n int, err error) { } else { _p1 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall6(SYS_READLINKAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf)), 0, 0) + r0, _, e1 := syscall_syscall6(libc_readlinkat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf)), 0, 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1221,6 +1649,10 @@ func Readlinkat(dirfd int, path string, buf []byte) (n int, err error) { return } +var libc_readlinkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_readlinkat readlinkat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Rename(from string, to string) (err error) { @@ -1234,13 +1666,17 @@ func Rename(from string, to string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_RENAME, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) + _, _, e1 := syscall_syscall(libc_rename_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_rename_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_rename rename "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Renameat(fromfd int, from string, tofd int, to string) (err error) { @@ -1254,13 +1690,17 @@ func Renameat(fromfd int, from string, tofd int, to string) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_RENAMEAT, uintptr(fromfd), uintptr(unsafe.Pointer(_p0)), uintptr(tofd), uintptr(unsafe.Pointer(_p1)), 0, 0) + _, _, e1 := syscall_syscall6(libc_renameat_trampoline_addr, uintptr(fromfd), uintptr(unsafe.Pointer(_p0)), uintptr(tofd), uintptr(unsafe.Pointer(_p1)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_renameat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_renameat renameat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Revoke(path string) (err error) { @@ -1269,13 +1709,17 @@ func Revoke(path string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_REVOKE, uintptr(unsafe.Pointer(_p0)), 0, 0) + _, _, e1 := syscall_syscall(libc_revoke_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_revoke_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_revoke revoke "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Rmdir(path string) (err error) { @@ -1284,17 +1728,21 @@ func Rmdir(path string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_RMDIR, uintptr(unsafe.Pointer(_p0)), 0, 0) + _, _, e1 := syscall_syscall(libc_rmdir_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_rmdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_rmdir rmdir "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Seek(fd int, offset int64, whence int) (newoffset int64, err error) { - r0, r1, e1 := Syscall6(SYS_LSEEK, uintptr(fd), 0, uintptr(offset), uintptr(offset>>32), uintptr(whence), 0) + r0, r1, e1 := syscall_syscall6(libc_lseek_trampoline_addr, uintptr(fd), uintptr(offset), uintptr(offset>>32), uintptr(whence), 0, 0) newoffset = int64(int64(r1)<<32 | int64(r0)) if e1 != 0 { err = errnoErr(e1) @@ -1302,10 +1750,14 @@ func Seek(fd int, offset int64, whence int) (newoffset int64, err error) { return } +var libc_lseek_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_lseek lseek "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err error) { - r0, _, e1 := Syscall6(SYS_SELECT, uintptr(nfd), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), 0) + r0, _, e1 := syscall_syscall6(libc_select_trampoline_addr, uintptr(nfd), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1313,36 +1765,52 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err return } +var libc_select_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_select select "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setegid(egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETEGID, uintptr(egid), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_setegid_trampoline_addr, uintptr(egid), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setegid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setegid setegid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Seteuid(euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETEUID, uintptr(euid), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_seteuid_trampoline_addr, uintptr(euid), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_seteuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_seteuid seteuid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setgid(gid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETGID, uintptr(gid), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_setgid_trampoline_addr, uintptr(gid), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setgid setgid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setlogin(name string) (err error) { @@ -1351,97 +1819,119 @@ func Setlogin(name string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_SETLOGIN, uintptr(unsafe.Pointer(_p0)), 0, 0) + _, _, e1 := syscall_syscall(libc_setlogin_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setlogin_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setlogin setlogin "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setpgid(pid int, pgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETPGID, uintptr(pid), uintptr(pgid), 0) + _, _, e1 := syscall_rawSyscall(libc_setpgid_trampoline_addr, uintptr(pid), uintptr(pgid), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setpgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setpgid setpgid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setpriority(which int, who int, prio int) (err error) { - _, _, e1 := Syscall(SYS_SETPRIORITY, uintptr(which), uintptr(who), uintptr(prio)) + _, _, e1 := syscall_syscall(libc_setpriority_trampoline_addr, uintptr(which), uintptr(who), uintptr(prio)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setpriority_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setpriority setpriority "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) + _, _, e1 := syscall_rawSyscall(libc_setregid_trampoline_addr, uintptr(rgid), uintptr(egid), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setregid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setregid setregid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) + _, _, e1 := syscall_rawSyscall(libc_setreuid_trampoline_addr, uintptr(ruid), uintptr(euid), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setreuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setreuid setreuid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) + _, _, e1 := syscall_rawSyscall(libc_setresgid_trampoline_addr, uintptr(rgid), uintptr(egid), uintptr(sgid)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setresgid setresgid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) + _, _, e1 := syscall_rawSyscall(libc_setresuid_trampoline_addr, uintptr(ruid), uintptr(euid), uintptr(suid)) if e1 != 0 { err = errnoErr(e1) } return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +var libc_setresuid_trampoline_addr uintptr -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} +//go:cgo_import_dynamic libc_setresuid setresuid "libc.so" // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setrtable(rtable int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRTABLE, uintptr(rtable), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setrtable_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setrtable setrtable "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setsid() (pid int, err error) { - r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) + r0, _, e1 := syscall_rawSyscall(libc_setsid_trampoline_addr, 0, 0, 0) pid = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1449,26 +1939,38 @@ func Setsid() (pid int, err error) { return } +var libc_setsid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setsid setsid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Settimeofday(tp *Timeval) (err error) { - _, _, e1 := RawSyscall(SYS_SETTIMEOFDAY, uintptr(unsafe.Pointer(tp)), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_settimeofday_trampoline_addr, uintptr(unsafe.Pointer(tp)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_settimeofday_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_settimeofday settimeofday "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setuid(uid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETUID, uintptr(uid), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_setuid_trampoline_addr, uintptr(uid), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setuid setuid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Stat(path string, stat *Stat_t) (err error) { @@ -1477,13 +1979,17 @@ func Stat(path string, stat *Stat_t) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_STAT, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) + _, _, e1 := syscall_syscall(libc_stat_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_stat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_stat stat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Statfs(path string, stat *Statfs_t) (err error) { @@ -1492,13 +1998,17 @@ func Statfs(path string, stat *Statfs_t) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_STATFS, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) + _, _, e1 := syscall_syscall(libc_statfs_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_statfs_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_statfs statfs "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Symlink(path string, link string) (err error) { @@ -1512,13 +2022,17 @@ func Symlink(path string, link string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_SYMLINK, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) + _, _, e1 := syscall_syscall(libc_symlink_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_symlink_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_symlink symlink "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Symlinkat(oldpath string, newdirfd int, newpath string) (err error) { @@ -1532,23 +2046,31 @@ func Symlinkat(oldpath string, newdirfd int, newpath string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_SYMLINKAT, uintptr(unsafe.Pointer(_p0)), uintptr(newdirfd), uintptr(unsafe.Pointer(_p1))) + _, _, e1 := syscall_syscall(libc_symlinkat_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(newdirfd), uintptr(unsafe.Pointer(_p1))) if e1 != 0 { err = errnoErr(e1) } return } +var libc_symlinkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_symlinkat symlinkat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Sync() (err error) { - _, _, e1 := Syscall(SYS_SYNC, 0, 0, 0) + _, _, e1 := syscall_syscall(libc_sync_trampoline_addr, 0, 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_sync_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sync sync "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Truncate(path string, length int64) (err error) { @@ -1557,21 +2079,29 @@ func Truncate(path string, length int64) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_TRUNCATE, uintptr(unsafe.Pointer(_p0)), 0, uintptr(length), uintptr(length>>32), 0, 0) + _, _, e1 := syscall_syscall(libc_truncate_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(length), uintptr(length>>32)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_truncate_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_truncate truncate "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Umask(newmask int) (oldmask int) { - r0, _, _ := Syscall(SYS_UMASK, uintptr(newmask), 0, 0) + r0, _, _ := syscall_syscall(libc_umask_trampoline_addr, uintptr(newmask), 0, 0) oldmask = int(r0) return } +var libc_umask_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_umask umask "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Unlink(path string) (err error) { @@ -1580,13 +2110,17 @@ func Unlink(path string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_UNLINK, uintptr(unsafe.Pointer(_p0)), 0, 0) + _, _, e1 := syscall_syscall(libc_unlink_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_unlink_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unlink unlink "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Unlinkat(dirfd int, path string, flags int) (err error) { @@ -1595,13 +2129,17 @@ func Unlinkat(dirfd int, path string, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_UNLINKAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(flags)) + _, _, e1 := syscall_syscall(libc_unlinkat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(flags)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_unlinkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unlinkat unlinkat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Unmount(path string, flags int) (err error) { @@ -1610,13 +2148,17 @@ func Unmount(path string, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_UNMOUNT, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) + _, _, e1 := syscall_syscall(libc_unmount_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_unmount_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unmount unmount "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func write(fd int, p []byte) (n int, err error) { @@ -1626,7 +2168,7 @@ func write(fd int, p []byte) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(_p0), uintptr(len(p))) + r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p))) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1634,10 +2176,14 @@ func write(fd int, p []byte) (n int, err error) { return } +var libc_write_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_write write "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) { - r0, _, e1 := Syscall9(SYS_MMAP, uintptr(addr), uintptr(length), uintptr(prot), uintptr(flag), uintptr(fd), 0, uintptr(pos), uintptr(pos>>32), 0) + r0, _, e1 := syscall_syscall9(libc_mmap_trampoline_addr, uintptr(addr), uintptr(length), uintptr(prot), uintptr(flag), uintptr(fd), uintptr(pos), uintptr(pos>>32), 0, 0) ret = uintptr(r0) if e1 != 0 { err = errnoErr(e1) @@ -1645,20 +2191,28 @@ func mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) ( return } +var libc_mmap_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mmap mmap "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func munmap(addr uintptr, length uintptr) (err error) { - _, _, e1 := Syscall(SYS_MUNMAP, uintptr(addr), uintptr(length), 0) + _, _, e1 := syscall_syscall(libc_munmap_trampoline_addr, uintptr(addr), uintptr(length), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_munmap_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_munmap munmap "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) + r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1669,7 +2223,7 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) + r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1685,9 +2239,13 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error if err != nil { return } - _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) + _, _, e1 := syscall_syscall6(libc_utimensat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } + +var libc_utimensat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_utimensat utimensat "libc.so" diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s new file mode 100644 index 0000000..3dcacd3 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s @@ -0,0 +1,674 @@ +// go run mkasm.go openbsd 386 +// Code generated by the command above; DO NOT EDIT. + +#include "textflag.h" + +TEXT libc_getgroups_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getgroups(SB) +GLOBL ·libc_getgroups_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getgroups_trampoline_addr(SB)/4, $libc_getgroups_trampoline<>(SB) + +TEXT libc_setgroups_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setgroups(SB) +GLOBL ·libc_setgroups_trampoline_addr(SB), RODATA, $4 +DATA ·libc_setgroups_trampoline_addr(SB)/4, $libc_setgroups_trampoline<>(SB) + +TEXT libc_wait4_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_wait4(SB) +GLOBL ·libc_wait4_trampoline_addr(SB), RODATA, $4 +DATA ·libc_wait4_trampoline_addr(SB)/4, $libc_wait4_trampoline<>(SB) + +TEXT libc_accept_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_accept(SB) +GLOBL ·libc_accept_trampoline_addr(SB), RODATA, $4 +DATA ·libc_accept_trampoline_addr(SB)/4, $libc_accept_trampoline<>(SB) + +TEXT libc_bind_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_bind(SB) +GLOBL ·libc_bind_trampoline_addr(SB), RODATA, $4 +DATA ·libc_bind_trampoline_addr(SB)/4, $libc_bind_trampoline<>(SB) + +TEXT libc_connect_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_connect(SB) +GLOBL ·libc_connect_trampoline_addr(SB), RODATA, $4 +DATA ·libc_connect_trampoline_addr(SB)/4, $libc_connect_trampoline<>(SB) + +TEXT libc_socket_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_socket(SB) +GLOBL ·libc_socket_trampoline_addr(SB), RODATA, $4 +DATA ·libc_socket_trampoline_addr(SB)/4, $libc_socket_trampoline<>(SB) + +TEXT libc_getsockopt_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getsockopt(SB) +GLOBL ·libc_getsockopt_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getsockopt_trampoline_addr(SB)/4, $libc_getsockopt_trampoline<>(SB) + +TEXT libc_setsockopt_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setsockopt(SB) +GLOBL ·libc_setsockopt_trampoline_addr(SB), RODATA, $4 +DATA ·libc_setsockopt_trampoline_addr(SB)/4, $libc_setsockopt_trampoline<>(SB) + +TEXT libc_getpeername_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpeername(SB) +GLOBL ·libc_getpeername_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getpeername_trampoline_addr(SB)/4, $libc_getpeername_trampoline<>(SB) + +TEXT libc_getsockname_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getsockname(SB) +GLOBL ·libc_getsockname_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getsockname_trampoline_addr(SB)/4, $libc_getsockname_trampoline<>(SB) + +TEXT libc_shutdown_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_shutdown(SB) +GLOBL ·libc_shutdown_trampoline_addr(SB), RODATA, $4 +DATA ·libc_shutdown_trampoline_addr(SB)/4, $libc_shutdown_trampoline<>(SB) + +TEXT libc_socketpair_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_socketpair(SB) +GLOBL ·libc_socketpair_trampoline_addr(SB), RODATA, $4 +DATA ·libc_socketpair_trampoline_addr(SB)/4, $libc_socketpair_trampoline<>(SB) + +TEXT libc_recvfrom_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_recvfrom(SB) +GLOBL ·libc_recvfrom_trampoline_addr(SB), RODATA, $4 +DATA ·libc_recvfrom_trampoline_addr(SB)/4, $libc_recvfrom_trampoline<>(SB) + +TEXT libc_sendto_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sendto(SB) +GLOBL ·libc_sendto_trampoline_addr(SB), RODATA, $4 +DATA ·libc_sendto_trampoline_addr(SB)/4, $libc_sendto_trampoline<>(SB) + +TEXT libc_recvmsg_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_recvmsg(SB) +GLOBL ·libc_recvmsg_trampoline_addr(SB), RODATA, $4 +DATA ·libc_recvmsg_trampoline_addr(SB)/4, $libc_recvmsg_trampoline<>(SB) + +TEXT libc_sendmsg_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sendmsg(SB) +GLOBL ·libc_sendmsg_trampoline_addr(SB), RODATA, $4 +DATA ·libc_sendmsg_trampoline_addr(SB)/4, $libc_sendmsg_trampoline<>(SB) + +TEXT libc_kevent_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_kevent(SB) +GLOBL ·libc_kevent_trampoline_addr(SB), RODATA, $4 +DATA ·libc_kevent_trampoline_addr(SB)/4, $libc_kevent_trampoline<>(SB) + +TEXT libc_utimes_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_utimes(SB) +GLOBL ·libc_utimes_trampoline_addr(SB), RODATA, $4 +DATA ·libc_utimes_trampoline_addr(SB)/4, $libc_utimes_trampoline<>(SB) + +TEXT libc_futimes_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_futimes(SB) +GLOBL ·libc_futimes_trampoline_addr(SB), RODATA, $4 +DATA ·libc_futimes_trampoline_addr(SB)/4, $libc_futimes_trampoline<>(SB) + +TEXT libc_poll_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_poll(SB) +GLOBL ·libc_poll_trampoline_addr(SB), RODATA, $4 +DATA ·libc_poll_trampoline_addr(SB)/4, $libc_poll_trampoline<>(SB) + +TEXT libc_madvise_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_madvise(SB) +GLOBL ·libc_madvise_trampoline_addr(SB), RODATA, $4 +DATA ·libc_madvise_trampoline_addr(SB)/4, $libc_madvise_trampoline<>(SB) + +TEXT libc_mlock_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mlock(SB) +GLOBL ·libc_mlock_trampoline_addr(SB), RODATA, $4 +DATA ·libc_mlock_trampoline_addr(SB)/4, $libc_mlock_trampoline<>(SB) + +TEXT libc_mlockall_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mlockall(SB) +GLOBL ·libc_mlockall_trampoline_addr(SB), RODATA, $4 +DATA ·libc_mlockall_trampoline_addr(SB)/4, $libc_mlockall_trampoline<>(SB) + +TEXT libc_mprotect_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mprotect(SB) +GLOBL ·libc_mprotect_trampoline_addr(SB), RODATA, $4 +DATA ·libc_mprotect_trampoline_addr(SB)/4, $libc_mprotect_trampoline<>(SB) + +TEXT libc_msync_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_msync(SB) +GLOBL ·libc_msync_trampoline_addr(SB), RODATA, $4 +DATA ·libc_msync_trampoline_addr(SB)/4, $libc_msync_trampoline<>(SB) + +TEXT libc_munlock_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_munlock(SB) +GLOBL ·libc_munlock_trampoline_addr(SB), RODATA, $4 +DATA ·libc_munlock_trampoline_addr(SB)/4, $libc_munlock_trampoline<>(SB) + +TEXT libc_munlockall_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_munlockall(SB) +GLOBL ·libc_munlockall_trampoline_addr(SB), RODATA, $4 +DATA ·libc_munlockall_trampoline_addr(SB)/4, $libc_munlockall_trampoline<>(SB) + +TEXT libc_pipe2_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pipe2(SB) +GLOBL ·libc_pipe2_trampoline_addr(SB), RODATA, $4 +DATA ·libc_pipe2_trampoline_addr(SB)/4, $libc_pipe2_trampoline<>(SB) + +TEXT libc_getdents_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getdents(SB) +GLOBL ·libc_getdents_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getdents_trampoline_addr(SB)/4, $libc_getdents_trampoline<>(SB) + +TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getcwd(SB) +GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getcwd_trampoline_addr(SB)/4, $libc_getcwd_trampoline<>(SB) + +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresuid_trampoline_addr(SB)/4, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresgid_trampoline_addr(SB)/4, $libc_getresgid_trampoline<>(SB) + +TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_ioctl(SB) +GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $4 +DATA ·libc_ioctl_trampoline_addr(SB)/4, $libc_ioctl_trampoline<>(SB) + +TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sysctl(SB) +GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $4 +DATA ·libc_sysctl_trampoline_addr(SB)/4, $libc_sysctl_trampoline<>(SB) + +TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_ppoll(SB) +GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $4 +DATA ·libc_ppoll_trampoline_addr(SB)/4, $libc_ppoll_trampoline<>(SB) + +TEXT libc_access_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_access(SB) +GLOBL ·libc_access_trampoline_addr(SB), RODATA, $4 +DATA ·libc_access_trampoline_addr(SB)/4, $libc_access_trampoline<>(SB) + +TEXT libc_adjtime_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_adjtime(SB) +GLOBL ·libc_adjtime_trampoline_addr(SB), RODATA, $4 +DATA ·libc_adjtime_trampoline_addr(SB)/4, $libc_adjtime_trampoline<>(SB) + +TEXT libc_chdir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chdir(SB) +GLOBL ·libc_chdir_trampoline_addr(SB), RODATA, $4 +DATA ·libc_chdir_trampoline_addr(SB)/4, $libc_chdir_trampoline<>(SB) + +TEXT libc_chflags_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chflags(SB) +GLOBL ·libc_chflags_trampoline_addr(SB), RODATA, $4 +DATA ·libc_chflags_trampoline_addr(SB)/4, $libc_chflags_trampoline<>(SB) + +TEXT libc_chmod_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chmod(SB) +GLOBL ·libc_chmod_trampoline_addr(SB), RODATA, $4 +DATA ·libc_chmod_trampoline_addr(SB)/4, $libc_chmod_trampoline<>(SB) + +TEXT libc_chown_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chown(SB) +GLOBL ·libc_chown_trampoline_addr(SB), RODATA, $4 +DATA ·libc_chown_trampoline_addr(SB)/4, $libc_chown_trampoline<>(SB) + +TEXT libc_chroot_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chroot(SB) +GLOBL ·libc_chroot_trampoline_addr(SB), RODATA, $4 +DATA ·libc_chroot_trampoline_addr(SB)/4, $libc_chroot_trampoline<>(SB) + +TEXT libc_clock_gettime_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_clock_gettime(SB) +GLOBL ·libc_clock_gettime_trampoline_addr(SB), RODATA, $4 +DATA ·libc_clock_gettime_trampoline_addr(SB)/4, $libc_clock_gettime_trampoline<>(SB) + +TEXT libc_close_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_close(SB) +GLOBL ·libc_close_trampoline_addr(SB), RODATA, $4 +DATA ·libc_close_trampoline_addr(SB)/4, $libc_close_trampoline<>(SB) + +TEXT libc_dup_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_dup(SB) +GLOBL ·libc_dup_trampoline_addr(SB), RODATA, $4 +DATA ·libc_dup_trampoline_addr(SB)/4, $libc_dup_trampoline<>(SB) + +TEXT libc_dup2_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_dup2(SB) +GLOBL ·libc_dup2_trampoline_addr(SB), RODATA, $4 +DATA ·libc_dup2_trampoline_addr(SB)/4, $libc_dup2_trampoline<>(SB) + +TEXT libc_dup3_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_dup3(SB) +GLOBL ·libc_dup3_trampoline_addr(SB), RODATA, $4 +DATA ·libc_dup3_trampoline_addr(SB)/4, $libc_dup3_trampoline<>(SB) + +TEXT libc_exit_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_exit(SB) +GLOBL ·libc_exit_trampoline_addr(SB), RODATA, $4 +DATA ·libc_exit_trampoline_addr(SB)/4, $libc_exit_trampoline<>(SB) + +TEXT libc_faccessat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_faccessat(SB) +GLOBL ·libc_faccessat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_faccessat_trampoline_addr(SB)/4, $libc_faccessat_trampoline<>(SB) + +TEXT libc_fchdir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchdir(SB) +GLOBL ·libc_fchdir_trampoline_addr(SB), RODATA, $4 +DATA ·libc_fchdir_trampoline_addr(SB)/4, $libc_fchdir_trampoline<>(SB) + +TEXT libc_fchflags_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchflags(SB) +GLOBL ·libc_fchflags_trampoline_addr(SB), RODATA, $4 +DATA ·libc_fchflags_trampoline_addr(SB)/4, $libc_fchflags_trampoline<>(SB) + +TEXT libc_fchmod_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchmod(SB) +GLOBL ·libc_fchmod_trampoline_addr(SB), RODATA, $4 +DATA ·libc_fchmod_trampoline_addr(SB)/4, $libc_fchmod_trampoline<>(SB) + +TEXT libc_fchmodat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchmodat(SB) +GLOBL ·libc_fchmodat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_fchmodat_trampoline_addr(SB)/4, $libc_fchmodat_trampoline<>(SB) + +TEXT libc_fchown_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchown(SB) +GLOBL ·libc_fchown_trampoline_addr(SB), RODATA, $4 +DATA ·libc_fchown_trampoline_addr(SB)/4, $libc_fchown_trampoline<>(SB) + +TEXT libc_fchownat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchownat(SB) +GLOBL ·libc_fchownat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_fchownat_trampoline_addr(SB)/4, $libc_fchownat_trampoline<>(SB) + +TEXT libc_flock_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_flock(SB) +GLOBL ·libc_flock_trampoline_addr(SB), RODATA, $4 +DATA ·libc_flock_trampoline_addr(SB)/4, $libc_flock_trampoline<>(SB) + +TEXT libc_fpathconf_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fpathconf(SB) +GLOBL ·libc_fpathconf_trampoline_addr(SB), RODATA, $4 +DATA ·libc_fpathconf_trampoline_addr(SB)/4, $libc_fpathconf_trampoline<>(SB) + +TEXT libc_fstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fstat(SB) +GLOBL ·libc_fstat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_fstat_trampoline_addr(SB)/4, $libc_fstat_trampoline<>(SB) + +TEXT libc_fstatat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fstatat(SB) +GLOBL ·libc_fstatat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_fstatat_trampoline_addr(SB)/4, $libc_fstatat_trampoline<>(SB) + +TEXT libc_fstatfs_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fstatfs(SB) +GLOBL ·libc_fstatfs_trampoline_addr(SB), RODATA, $4 +DATA ·libc_fstatfs_trampoline_addr(SB)/4, $libc_fstatfs_trampoline<>(SB) + +TEXT libc_fsync_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fsync(SB) +GLOBL ·libc_fsync_trampoline_addr(SB), RODATA, $4 +DATA ·libc_fsync_trampoline_addr(SB)/4, $libc_fsync_trampoline<>(SB) + +TEXT libc_ftruncate_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_ftruncate(SB) +GLOBL ·libc_ftruncate_trampoline_addr(SB), RODATA, $4 +DATA ·libc_ftruncate_trampoline_addr(SB)/4, $libc_ftruncate_trampoline<>(SB) + +TEXT libc_getegid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getegid(SB) +GLOBL ·libc_getegid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getegid_trampoline_addr(SB)/4, $libc_getegid_trampoline<>(SB) + +TEXT libc_geteuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_geteuid(SB) +GLOBL ·libc_geteuid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_geteuid_trampoline_addr(SB)/4, $libc_geteuid_trampoline<>(SB) + +TEXT libc_getgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getgid(SB) +GLOBL ·libc_getgid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getgid_trampoline_addr(SB)/4, $libc_getgid_trampoline<>(SB) + +TEXT libc_getpgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpgid(SB) +GLOBL ·libc_getpgid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getpgid_trampoline_addr(SB)/4, $libc_getpgid_trampoline<>(SB) + +TEXT libc_getpgrp_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpgrp(SB) +GLOBL ·libc_getpgrp_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getpgrp_trampoline_addr(SB)/4, $libc_getpgrp_trampoline<>(SB) + +TEXT libc_getpid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpid(SB) +GLOBL ·libc_getpid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getpid_trampoline_addr(SB)/4, $libc_getpid_trampoline<>(SB) + +TEXT libc_getppid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getppid(SB) +GLOBL ·libc_getppid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getppid_trampoline_addr(SB)/4, $libc_getppid_trampoline<>(SB) + +TEXT libc_getpriority_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpriority(SB) +GLOBL ·libc_getpriority_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getpriority_trampoline_addr(SB)/4, $libc_getpriority_trampoline<>(SB) + +TEXT libc_getrlimit_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getrlimit(SB) +GLOBL ·libc_getrlimit_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getrlimit_trampoline_addr(SB)/4, $libc_getrlimit_trampoline<>(SB) + +TEXT libc_getrtable_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getrtable(SB) +GLOBL ·libc_getrtable_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getrtable_trampoline_addr(SB)/4, $libc_getrtable_trampoline<>(SB) + +TEXT libc_getrusage_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getrusage(SB) +GLOBL ·libc_getrusage_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getrusage_trampoline_addr(SB)/4, $libc_getrusage_trampoline<>(SB) + +TEXT libc_getsid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getsid(SB) +GLOBL ·libc_getsid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getsid_trampoline_addr(SB)/4, $libc_getsid_trampoline<>(SB) + +TEXT libc_gettimeofday_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_gettimeofday(SB) +GLOBL ·libc_gettimeofday_trampoline_addr(SB), RODATA, $4 +DATA ·libc_gettimeofday_trampoline_addr(SB)/4, $libc_gettimeofday_trampoline<>(SB) + +TEXT libc_getuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getuid(SB) +GLOBL ·libc_getuid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getuid_trampoline_addr(SB)/4, $libc_getuid_trampoline<>(SB) + +TEXT libc_issetugid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_issetugid(SB) +GLOBL ·libc_issetugid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_issetugid_trampoline_addr(SB)/4, $libc_issetugid_trampoline<>(SB) + +TEXT libc_kill_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_kill(SB) +GLOBL ·libc_kill_trampoline_addr(SB), RODATA, $4 +DATA ·libc_kill_trampoline_addr(SB)/4, $libc_kill_trampoline<>(SB) + +TEXT libc_kqueue_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_kqueue(SB) +GLOBL ·libc_kqueue_trampoline_addr(SB), RODATA, $4 +DATA ·libc_kqueue_trampoline_addr(SB)/4, $libc_kqueue_trampoline<>(SB) + +TEXT libc_lchown_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_lchown(SB) +GLOBL ·libc_lchown_trampoline_addr(SB), RODATA, $4 +DATA ·libc_lchown_trampoline_addr(SB)/4, $libc_lchown_trampoline<>(SB) + +TEXT libc_link_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_link(SB) +GLOBL ·libc_link_trampoline_addr(SB), RODATA, $4 +DATA ·libc_link_trampoline_addr(SB)/4, $libc_link_trampoline<>(SB) + +TEXT libc_linkat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_linkat(SB) +GLOBL ·libc_linkat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_linkat_trampoline_addr(SB)/4, $libc_linkat_trampoline<>(SB) + +TEXT libc_listen_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_listen(SB) +GLOBL ·libc_listen_trampoline_addr(SB), RODATA, $4 +DATA ·libc_listen_trampoline_addr(SB)/4, $libc_listen_trampoline<>(SB) + +TEXT libc_lstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_lstat(SB) +GLOBL ·libc_lstat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_lstat_trampoline_addr(SB)/4, $libc_lstat_trampoline<>(SB) + +TEXT libc_mkdir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mkdir(SB) +GLOBL ·libc_mkdir_trampoline_addr(SB), RODATA, $4 +DATA ·libc_mkdir_trampoline_addr(SB)/4, $libc_mkdir_trampoline<>(SB) + +TEXT libc_mkdirat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mkdirat(SB) +GLOBL ·libc_mkdirat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_mkdirat_trampoline_addr(SB)/4, $libc_mkdirat_trampoline<>(SB) + +TEXT libc_mkfifo_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mkfifo(SB) +GLOBL ·libc_mkfifo_trampoline_addr(SB), RODATA, $4 +DATA ·libc_mkfifo_trampoline_addr(SB)/4, $libc_mkfifo_trampoline<>(SB) + +TEXT libc_mkfifoat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mkfifoat(SB) +GLOBL ·libc_mkfifoat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_mkfifoat_trampoline_addr(SB)/4, $libc_mkfifoat_trampoline<>(SB) + +TEXT libc_mknod_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mknod(SB) +GLOBL ·libc_mknod_trampoline_addr(SB), RODATA, $4 +DATA ·libc_mknod_trampoline_addr(SB)/4, $libc_mknod_trampoline<>(SB) + +TEXT libc_mknodat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mknodat(SB) +GLOBL ·libc_mknodat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_mknodat_trampoline_addr(SB)/4, $libc_mknodat_trampoline<>(SB) + +TEXT libc_nanosleep_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_nanosleep(SB) +GLOBL ·libc_nanosleep_trampoline_addr(SB), RODATA, $4 +DATA ·libc_nanosleep_trampoline_addr(SB)/4, $libc_nanosleep_trampoline<>(SB) + +TEXT libc_open_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_open(SB) +GLOBL ·libc_open_trampoline_addr(SB), RODATA, $4 +DATA ·libc_open_trampoline_addr(SB)/4, $libc_open_trampoline<>(SB) + +TEXT libc_openat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_openat(SB) +GLOBL ·libc_openat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_openat_trampoline_addr(SB)/4, $libc_openat_trampoline<>(SB) + +TEXT libc_pathconf_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pathconf(SB) +GLOBL ·libc_pathconf_trampoline_addr(SB), RODATA, $4 +DATA ·libc_pathconf_trampoline_addr(SB)/4, $libc_pathconf_trampoline<>(SB) + +TEXT libc_pread_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pread(SB) +GLOBL ·libc_pread_trampoline_addr(SB), RODATA, $4 +DATA ·libc_pread_trampoline_addr(SB)/4, $libc_pread_trampoline<>(SB) + +TEXT libc_pwrite_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pwrite(SB) +GLOBL ·libc_pwrite_trampoline_addr(SB), RODATA, $4 +DATA ·libc_pwrite_trampoline_addr(SB)/4, $libc_pwrite_trampoline<>(SB) + +TEXT libc_read_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_read(SB) +GLOBL ·libc_read_trampoline_addr(SB), RODATA, $4 +DATA ·libc_read_trampoline_addr(SB)/4, $libc_read_trampoline<>(SB) + +TEXT libc_readlink_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_readlink(SB) +GLOBL ·libc_readlink_trampoline_addr(SB), RODATA, $4 +DATA ·libc_readlink_trampoline_addr(SB)/4, $libc_readlink_trampoline<>(SB) + +TEXT libc_readlinkat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_readlinkat(SB) +GLOBL ·libc_readlinkat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_readlinkat_trampoline_addr(SB)/4, $libc_readlinkat_trampoline<>(SB) + +TEXT libc_rename_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_rename(SB) +GLOBL ·libc_rename_trampoline_addr(SB), RODATA, $4 +DATA ·libc_rename_trampoline_addr(SB)/4, $libc_rename_trampoline<>(SB) + +TEXT libc_renameat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_renameat(SB) +GLOBL ·libc_renameat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_renameat_trampoline_addr(SB)/4, $libc_renameat_trampoline<>(SB) + +TEXT libc_revoke_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_revoke(SB) +GLOBL ·libc_revoke_trampoline_addr(SB), RODATA, $4 +DATA ·libc_revoke_trampoline_addr(SB)/4, $libc_revoke_trampoline<>(SB) + +TEXT libc_rmdir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_rmdir(SB) +GLOBL ·libc_rmdir_trampoline_addr(SB), RODATA, $4 +DATA ·libc_rmdir_trampoline_addr(SB)/4, $libc_rmdir_trampoline<>(SB) + +TEXT libc_lseek_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_lseek(SB) +GLOBL ·libc_lseek_trampoline_addr(SB), RODATA, $4 +DATA ·libc_lseek_trampoline_addr(SB)/4, $libc_lseek_trampoline<>(SB) + +TEXT libc_select_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_select(SB) +GLOBL ·libc_select_trampoline_addr(SB), RODATA, $4 +DATA ·libc_select_trampoline_addr(SB)/4, $libc_select_trampoline<>(SB) + +TEXT libc_setegid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setegid(SB) +GLOBL ·libc_setegid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_setegid_trampoline_addr(SB)/4, $libc_setegid_trampoline<>(SB) + +TEXT libc_seteuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_seteuid(SB) +GLOBL ·libc_seteuid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_seteuid_trampoline_addr(SB)/4, $libc_seteuid_trampoline<>(SB) + +TEXT libc_setgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setgid(SB) +GLOBL ·libc_setgid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_setgid_trampoline_addr(SB)/4, $libc_setgid_trampoline<>(SB) + +TEXT libc_setlogin_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setlogin(SB) +GLOBL ·libc_setlogin_trampoline_addr(SB), RODATA, $4 +DATA ·libc_setlogin_trampoline_addr(SB)/4, $libc_setlogin_trampoline<>(SB) + +TEXT libc_setpgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setpgid(SB) +GLOBL ·libc_setpgid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_setpgid_trampoline_addr(SB)/4, $libc_setpgid_trampoline<>(SB) + +TEXT libc_setpriority_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setpriority(SB) +GLOBL ·libc_setpriority_trampoline_addr(SB), RODATA, $4 +DATA ·libc_setpriority_trampoline_addr(SB)/4, $libc_setpriority_trampoline<>(SB) + +TEXT libc_setregid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setregid(SB) +GLOBL ·libc_setregid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_setregid_trampoline_addr(SB)/4, $libc_setregid_trampoline<>(SB) + +TEXT libc_setreuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setreuid(SB) +GLOBL ·libc_setreuid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_setreuid_trampoline_addr(SB)/4, $libc_setreuid_trampoline<>(SB) + +TEXT libc_setresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setresgid(SB) +GLOBL ·libc_setresgid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_setresgid_trampoline_addr(SB)/4, $libc_setresgid_trampoline<>(SB) + +TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setresuid(SB) +GLOBL ·libc_setresuid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_setresuid_trampoline_addr(SB)/4, $libc_setresuid_trampoline<>(SB) + +TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setrtable(SB) +GLOBL ·libc_setrtable_trampoline_addr(SB), RODATA, $4 +DATA ·libc_setrtable_trampoline_addr(SB)/4, $libc_setrtable_trampoline<>(SB) + +TEXT libc_setsid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setsid(SB) +GLOBL ·libc_setsid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_setsid_trampoline_addr(SB)/4, $libc_setsid_trampoline<>(SB) + +TEXT libc_settimeofday_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_settimeofday(SB) +GLOBL ·libc_settimeofday_trampoline_addr(SB), RODATA, $4 +DATA ·libc_settimeofday_trampoline_addr(SB)/4, $libc_settimeofday_trampoline<>(SB) + +TEXT libc_setuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setuid(SB) +GLOBL ·libc_setuid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_setuid_trampoline_addr(SB)/4, $libc_setuid_trampoline<>(SB) + +TEXT libc_stat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_stat(SB) +GLOBL ·libc_stat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_stat_trampoline_addr(SB)/4, $libc_stat_trampoline<>(SB) + +TEXT libc_statfs_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_statfs(SB) +GLOBL ·libc_statfs_trampoline_addr(SB), RODATA, $4 +DATA ·libc_statfs_trampoline_addr(SB)/4, $libc_statfs_trampoline<>(SB) + +TEXT libc_symlink_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_symlink(SB) +GLOBL ·libc_symlink_trampoline_addr(SB), RODATA, $4 +DATA ·libc_symlink_trampoline_addr(SB)/4, $libc_symlink_trampoline<>(SB) + +TEXT libc_symlinkat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_symlinkat(SB) +GLOBL ·libc_symlinkat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_symlinkat_trampoline_addr(SB)/4, $libc_symlinkat_trampoline<>(SB) + +TEXT libc_sync_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sync(SB) +GLOBL ·libc_sync_trampoline_addr(SB), RODATA, $4 +DATA ·libc_sync_trampoline_addr(SB)/4, $libc_sync_trampoline<>(SB) + +TEXT libc_truncate_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_truncate(SB) +GLOBL ·libc_truncate_trampoline_addr(SB), RODATA, $4 +DATA ·libc_truncate_trampoline_addr(SB)/4, $libc_truncate_trampoline<>(SB) + +TEXT libc_umask_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_umask(SB) +GLOBL ·libc_umask_trampoline_addr(SB), RODATA, $4 +DATA ·libc_umask_trampoline_addr(SB)/4, $libc_umask_trampoline<>(SB) + +TEXT libc_unlink_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unlink(SB) +GLOBL ·libc_unlink_trampoline_addr(SB), RODATA, $4 +DATA ·libc_unlink_trampoline_addr(SB)/4, $libc_unlink_trampoline<>(SB) + +TEXT libc_unlinkat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unlinkat(SB) +GLOBL ·libc_unlinkat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_unlinkat_trampoline_addr(SB)/4, $libc_unlinkat_trampoline<>(SB) + +TEXT libc_unmount_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unmount(SB) +GLOBL ·libc_unmount_trampoline_addr(SB), RODATA, $4 +DATA ·libc_unmount_trampoline_addr(SB)/4, $libc_unmount_trampoline<>(SB) + +TEXT libc_write_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_write(SB) +GLOBL ·libc_write_trampoline_addr(SB), RODATA, $4 +DATA ·libc_write_trampoline_addr(SB)/4, $libc_write_trampoline<>(SB) + +TEXT libc_mmap_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mmap(SB) +GLOBL ·libc_mmap_trampoline_addr(SB), RODATA, $4 +DATA ·libc_mmap_trampoline_addr(SB)/4, $libc_mmap_trampoline<>(SB) + +TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_munmap(SB) +GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $4 +DATA ·libc_munmap_trampoline_addr(SB)/4, $libc_munmap_trampoline<>(SB) + +TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_utimensat(SB) +GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_utimensat_trampoline_addr(SB)/4, $libc_utimensat_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go index 04db8fa..915761e 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go @@ -1,4 +1,4 @@ -// go run mksyscall.go -openbsd -tags openbsd,amd64 syscall_bsd.go syscall_openbsd.go syscall_openbsd_amd64.go +// go run mksyscall.go -openbsd -libc -tags openbsd,amd64 syscall_bsd.go syscall_openbsd.go syscall_openbsd_amd64.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build openbsd && amd64 @@ -16,7 +16,7 @@ var _ syscall.Errno // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func getgroups(ngid int, gid *_Gid_t) (n int, err error) { - r0, _, e1 := RawSyscall(SYS_GETGROUPS, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0) + r0, _, e1 := syscall_rawSyscall(libc_getgroups_trampoline_addr, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -24,20 +24,28 @@ func getgroups(ngid int, gid *_Gid_t) (n int, err error) { return } +var libc_getgroups_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getgroups getgroups "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func setgroups(ngid int, gid *_Gid_t) (err error) { - _, _, e1 := RawSyscall(SYS_SETGROUPS, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0) + _, _, e1 := syscall_rawSyscall(libc_setgroups_trampoline_addr, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setgroups_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setgroups setgroups "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func wait4(pid int, wstatus *_C_int, options int, rusage *Rusage) (wpid int, err error) { - r0, _, e1 := Syscall6(SYS_WAIT4, uintptr(pid), uintptr(unsafe.Pointer(wstatus)), uintptr(options), uintptr(unsafe.Pointer(rusage)), 0, 0) + r0, _, e1 := syscall_syscall6(libc_wait4_trampoline_addr, uintptr(pid), uintptr(unsafe.Pointer(wstatus)), uintptr(options), uintptr(unsafe.Pointer(rusage)), 0, 0) wpid = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -45,10 +53,14 @@ func wait4(pid int, wstatus *_C_int, options int, rusage *Rusage) (wpid int, err return } +var libc_wait4_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_wait4 wait4 "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { - r0, _, e1 := Syscall(SYS_ACCEPT, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + r0, _, e1 := syscall_syscall(libc_accept_trampoline_addr, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) fd = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -56,30 +68,42 @@ func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { return } +var libc_accept_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_accept accept "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { - _, _, e1 := Syscall(SYS_BIND, uintptr(s), uintptr(addr), uintptr(addrlen)) + _, _, e1 := syscall_syscall(libc_bind_trampoline_addr, uintptr(s), uintptr(addr), uintptr(addrlen)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_bind_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_bind bind "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func connect(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { - _, _, e1 := Syscall(SYS_CONNECT, uintptr(s), uintptr(addr), uintptr(addrlen)) + _, _, e1 := syscall_syscall(libc_connect_trampoline_addr, uintptr(s), uintptr(addr), uintptr(addrlen)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_connect_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_connect connect "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func socket(domain int, typ int, proto int) (fd int, err error) { - r0, _, e1 := RawSyscall(SYS_SOCKET, uintptr(domain), uintptr(typ), uintptr(proto)) + r0, _, e1 := syscall_rawSyscall(libc_socket_trampoline_addr, uintptr(domain), uintptr(typ), uintptr(proto)) fd = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -87,66 +111,94 @@ func socket(domain int, typ int, proto int) (fd int, err error) { return } +var libc_socket_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_socket socket "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func getsockopt(s int, level int, name int, val unsafe.Pointer, vallen *_Socklen) (err error) { - _, _, e1 := Syscall6(SYS_GETSOCKOPT, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(unsafe.Pointer(vallen)), 0) + _, _, e1 := syscall_syscall6(libc_getsockopt_trampoline_addr, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(unsafe.Pointer(vallen)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_getsockopt_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getsockopt getsockopt "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func setsockopt(s int, level int, name int, val unsafe.Pointer, vallen uintptr) (err error) { - _, _, e1 := Syscall6(SYS_SETSOCKOPT, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(vallen), 0) + _, _, e1 := syscall_syscall6(libc_setsockopt_trampoline_addr, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(vallen), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setsockopt_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setsockopt setsockopt "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func getpeername(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { - _, _, e1 := RawSyscall(SYS_GETPEERNAME, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + _, _, e1 := syscall_rawSyscall(libc_getpeername_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) if e1 != 0 { err = errnoErr(e1) } return } +var libc_getpeername_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpeername getpeername "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func getsockname(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { - _, _, e1 := RawSyscall(SYS_GETSOCKNAME, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + _, _, e1 := syscall_rawSyscall(libc_getsockname_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) if e1 != 0 { err = errnoErr(e1) } return } +var libc_getsockname_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getsockname getsockname "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Shutdown(s int, how int) (err error) { - _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(s), uintptr(how), 0) + _, _, e1 := syscall_syscall(libc_shutdown_trampoline_addr, uintptr(s), uintptr(how), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_shutdown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_shutdown shutdown "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func socketpair(domain int, typ int, proto int, fd *[2]int32) (err error) { - _, _, e1 := RawSyscall6(SYS_SOCKETPAIR, uintptr(domain), uintptr(typ), uintptr(proto), uintptr(unsafe.Pointer(fd)), 0, 0) + _, _, e1 := syscall_rawSyscall6(libc_socketpair_trampoline_addr, uintptr(domain), uintptr(typ), uintptr(proto), uintptr(unsafe.Pointer(fd)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_socketpair_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_socketpair socketpair "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Socklen) (n int, err error) { @@ -156,7 +208,7 @@ func recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Sockl } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall6(SYS_RECVFROM, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(flags), uintptr(unsafe.Pointer(from)), uintptr(unsafe.Pointer(fromlen))) + r0, _, e1 := syscall_syscall6(libc_recvfrom_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(flags), uintptr(unsafe.Pointer(from)), uintptr(unsafe.Pointer(fromlen))) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -164,6 +216,10 @@ func recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Sockl return } +var libc_recvfrom_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_recvfrom recvfrom "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) (err error) { @@ -173,17 +229,21 @@ func sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) ( } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall6(SYS_SENDTO, uintptr(s), uintptr(_p0), uintptr(len(buf)), uintptr(flags), uintptr(to), uintptr(addrlen)) + _, _, e1 := syscall_syscall6(libc_sendto_trampoline_addr, uintptr(s), uintptr(_p0), uintptr(len(buf)), uintptr(flags), uintptr(to), uintptr(addrlen)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_sendto_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sendto sendto "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func recvmsg(s int, msg *Msghdr, flags int) (n int, err error) { - r0, _, e1 := Syscall(SYS_RECVMSG, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) + r0, _, e1 := syscall_syscall(libc_recvmsg_trampoline_addr, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -191,10 +251,14 @@ func recvmsg(s int, msg *Msghdr, flags int) (n int, err error) { return } +var libc_recvmsg_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_recvmsg recvmsg "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) { - r0, _, e1 := Syscall(SYS_SENDMSG, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) + r0, _, e1 := syscall_syscall(libc_sendmsg_trampoline_addr, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -202,10 +266,14 @@ func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) { return } +var libc_sendmsg_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sendmsg sendmsg "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func kevent(kq int, change unsafe.Pointer, nchange int, event unsafe.Pointer, nevent int, timeout *Timespec) (n int, err error) { - r0, _, e1 := Syscall6(SYS_KEVENT, uintptr(kq), uintptr(change), uintptr(nchange), uintptr(event), uintptr(nevent), uintptr(unsafe.Pointer(timeout))) + r0, _, e1 := syscall_syscall6(libc_kevent_trampoline_addr, uintptr(kq), uintptr(change), uintptr(nchange), uintptr(event), uintptr(nevent), uintptr(unsafe.Pointer(timeout))) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -213,6 +281,10 @@ func kevent(kq int, change unsafe.Pointer, nchange int, event unsafe.Pointer, ne return } +var libc_kevent_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_kevent kevent "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func utimes(path string, timeval *[2]Timeval) (err error) { @@ -221,27 +293,35 @@ func utimes(path string, timeval *[2]Timeval) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_UTIMES, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(timeval)), 0) + _, _, e1 := syscall_syscall(libc_utimes_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(timeval)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_utimes_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_utimes utimes "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func futimes(fd int, timeval *[2]Timeval) (err error) { - _, _, e1 := Syscall(SYS_FUTIMES, uintptr(fd), uintptr(unsafe.Pointer(timeval)), 0) + _, _, e1 := syscall_syscall(libc_futimes_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(timeval)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_futimes_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_futimes futimes "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func poll(fds *PollFd, nfds int, timeout int) (n int, err error) { - r0, _, e1 := Syscall(SYS_POLL, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(timeout)) + r0, _, e1 := syscall_syscall(libc_poll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(timeout)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -249,6 +329,10 @@ func poll(fds *PollFd, nfds int, timeout int) (n int, err error) { return } +var libc_poll_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_poll poll "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Madvise(b []byte, behav int) (err error) { @@ -258,13 +342,17 @@ func Madvise(b []byte, behav int) (err error) { } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall(SYS_MADVISE, uintptr(_p0), uintptr(len(b)), uintptr(behav)) + _, _, e1 := syscall_syscall(libc_madvise_trampoline_addr, uintptr(_p0), uintptr(len(b)), uintptr(behav)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_madvise_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_madvise madvise "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mlock(b []byte) (err error) { @@ -274,23 +362,31 @@ func Mlock(b []byte) (err error) { } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall(SYS_MLOCK, uintptr(_p0), uintptr(len(b)), 0) + _, _, e1 := syscall_syscall(libc_mlock_trampoline_addr, uintptr(_p0), uintptr(len(b)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mlock_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mlock mlock "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mlockall(flags int) (err error) { - _, _, e1 := Syscall(SYS_MLOCKALL, uintptr(flags), 0, 0) + _, _, e1 := syscall_syscall(libc_mlockall_trampoline_addr, uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mlockall_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mlockall mlockall "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mprotect(b []byte, prot int) (err error) { @@ -300,13 +396,17 @@ func Mprotect(b []byte, prot int) (err error) { } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall(SYS_MPROTECT, uintptr(_p0), uintptr(len(b)), uintptr(prot)) + _, _, e1 := syscall_syscall(libc_mprotect_trampoline_addr, uintptr(_p0), uintptr(len(b)), uintptr(prot)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mprotect_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mprotect mprotect "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Msync(b []byte, flags int) (err error) { @@ -316,13 +416,17 @@ func Msync(b []byte, flags int) (err error) { } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall(SYS_MSYNC, uintptr(_p0), uintptr(len(b)), uintptr(flags)) + _, _, e1 := syscall_syscall(libc_msync_trampoline_addr, uintptr(_p0), uintptr(len(b)), uintptr(flags)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_msync_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_msync msync "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Munlock(b []byte) (err error) { @@ -332,33 +436,45 @@ func Munlock(b []byte) (err error) { } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall(SYS_MUNLOCK, uintptr(_p0), uintptr(len(b)), 0) + _, _, e1 := syscall_syscall(libc_munlock_trampoline_addr, uintptr(_p0), uintptr(len(b)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_munlock_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_munlock munlock "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Munlockall() (err error) { - _, _, e1 := Syscall(SYS_MUNLOCKALL, 0, 0, 0) + _, _, e1 := syscall_syscall(libc_munlockall_trampoline_addr, 0, 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_munlockall_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_munlockall munlockall "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func pipe2(p *[2]_C_int, flags int) (err error) { - _, _, e1 := RawSyscall(SYS_PIPE2, uintptr(unsafe.Pointer(p)), uintptr(flags), 0) + _, _, e1 := syscall_rawSyscall(libc_pipe2_trampoline_addr, uintptr(unsafe.Pointer(p)), uintptr(flags), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_pipe2_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pipe2 pipe2 "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getdents(fd int, buf []byte) (n int, err error) { @@ -368,7 +484,7 @@ func Getdents(fd int, buf []byte) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall(SYS_GETDENTS, uintptr(fd), uintptr(_p0), uintptr(len(buf))) + r0, _, e1 := syscall_syscall(libc_getdents_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(buf))) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -376,6 +492,10 @@ func Getdents(fd int, buf []byte) (n int, err error) { return } +var libc_getdents_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getdents getdents "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getcwd(buf []byte) (n int, err error) { @@ -385,7 +505,7 @@ func Getcwd(buf []byte) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall(SYS___GETCWD, uintptr(_p0), uintptr(len(buf)), 0) + r0, _, e1 := syscall_syscall(libc_getcwd_trampoline_addr, uintptr(_p0), uintptr(len(buf)), 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -393,10 +513,50 @@ func Getcwd(buf []byte) (n int, err error) { return } +var libc_getcwd_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getcwd getcwd "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func ioctl(fd int, req uint, arg uintptr) (err error) { - _, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg)) + _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { + _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { err = errnoErr(e1) } @@ -412,17 +572,21 @@ func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall6(SYS___SYSCTL, uintptr(_p0), uintptr(len(mib)), uintptr(unsafe.Pointer(old)), uintptr(unsafe.Pointer(oldlen)), uintptr(unsafe.Pointer(new)), uintptr(newlen)) + _, _, e1 := syscall_syscall6(libc_sysctl_trampoline_addr, uintptr(_p0), uintptr(len(mib)), uintptr(unsafe.Pointer(old)), uintptr(unsafe.Pointer(oldlen)), uintptr(unsafe.Pointer(new)), uintptr(newlen)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_sysctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sysctl sysctl "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { - r0, _, e1 := Syscall6(SYS_PPOLL, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) + r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -430,6 +594,10 @@ func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, return } +var libc_ppoll_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ppoll ppoll "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Access(path string, mode uint32) (err error) { @@ -438,23 +606,31 @@ func Access(path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_ACCESS, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + _, _, e1 := syscall_syscall(libc_access_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_access_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_access access "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Adjtime(delta *Timeval, olddelta *Timeval) (err error) { - _, _, e1 := Syscall(SYS_ADJTIME, uintptr(unsafe.Pointer(delta)), uintptr(unsafe.Pointer(olddelta)), 0) + _, _, e1 := syscall_syscall(libc_adjtime_trampoline_addr, uintptr(unsafe.Pointer(delta)), uintptr(unsafe.Pointer(olddelta)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_adjtime_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_adjtime adjtime "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Chdir(path string) (err error) { @@ -463,13 +639,17 @@ func Chdir(path string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_CHDIR, uintptr(unsafe.Pointer(_p0)), 0, 0) + _, _, e1 := syscall_syscall(libc_chdir_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_chdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chdir chdir "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Chflags(path string, flags int) (err error) { @@ -478,13 +658,17 @@ func Chflags(path string, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_CHFLAGS, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) + _, _, e1 := syscall_syscall(libc_chflags_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_chflags_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chflags chflags "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Chmod(path string, mode uint32) (err error) { @@ -493,13 +677,17 @@ func Chmod(path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_CHMOD, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + _, _, e1 := syscall_syscall(libc_chmod_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_chmod_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chmod chmod "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Chown(path string, uid int, gid int) (err error) { @@ -508,13 +696,17 @@ func Chown(path string, uid int, gid int) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_CHOWN, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) + _, _, e1 := syscall_syscall(libc_chown_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_chown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chown chown "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Chroot(path string) (err error) { @@ -523,27 +715,49 @@ func Chroot(path string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_CHROOT, uintptr(unsafe.Pointer(_p0)), 0, 0) + _, _, e1 := syscall_syscall(libc_chroot_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_chroot_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chroot chroot "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ClockGettime(clockid int32, time *Timespec) (err error) { + _, _, e1 := syscall_syscall(libc_clock_gettime_trampoline_addr, uintptr(clockid), uintptr(unsafe.Pointer(time)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_clock_gettime_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_clock_gettime clock_gettime "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Close(fd int) (err error) { - _, _, e1 := Syscall(SYS_CLOSE, uintptr(fd), 0, 0) + _, _, e1 := syscall_syscall(libc_close_trampoline_addr, uintptr(fd), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_close_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_close close "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Dup(fd int) (nfd int, err error) { - r0, _, e1 := Syscall(SYS_DUP, uintptr(fd), 0, 0) + r0, _, e1 := syscall_syscall(libc_dup_trampoline_addr, uintptr(fd), 0, 0) nfd = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -551,33 +765,49 @@ func Dup(fd int) (nfd int, err error) { return } +var libc_dup_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_dup dup "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Dup2(from int, to int) (err error) { - _, _, e1 := Syscall(SYS_DUP2, uintptr(from), uintptr(to), 0) + _, _, e1 := syscall_syscall(libc_dup2_trampoline_addr, uintptr(from), uintptr(to), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_dup2_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_dup2 dup2 "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Dup3(from int, to int, flags int) (err error) { - _, _, e1 := Syscall(SYS_DUP3, uintptr(from), uintptr(to), uintptr(flags)) + _, _, e1 := syscall_syscall(libc_dup3_trampoline_addr, uintptr(from), uintptr(to), uintptr(flags)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_dup3_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_dup3 dup3 "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Exit(code int) { - Syscall(SYS_EXIT, uintptr(code), 0, 0) + syscall_syscall(libc_exit_trampoline_addr, uintptr(code), 0, 0) return } +var libc_exit_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_exit exit "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) { @@ -586,43 +816,59 @@ func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_FACCESSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) + _, _, e1 := syscall_syscall6(libc_faccessat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_faccessat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_faccessat faccessat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fchdir(fd int) (err error) { - _, _, e1 := Syscall(SYS_FCHDIR, uintptr(fd), 0, 0) + _, _, e1 := syscall_syscall(libc_fchdir_trampoline_addr, uintptr(fd), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fchdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchdir fchdir "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fchflags(fd int, flags int) (err error) { - _, _, e1 := Syscall(SYS_FCHFLAGS, uintptr(fd), uintptr(flags), 0) + _, _, e1 := syscall_syscall(libc_fchflags_trampoline_addr, uintptr(fd), uintptr(flags), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fchflags_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchflags fchflags "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fchmod(fd int, mode uint32) (err error) { - _, _, e1 := Syscall(SYS_FCHMOD, uintptr(fd), uintptr(mode), 0) + _, _, e1 := syscall_syscall(libc_fchmod_trampoline_addr, uintptr(fd), uintptr(mode), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fchmod_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchmod fchmod "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) { @@ -631,23 +877,31 @@ func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_FCHMODAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) + _, _, e1 := syscall_syscall6(libc_fchmodat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fchmodat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchmodat fchmodat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fchown(fd int, uid int, gid int) (err error) { - _, _, e1 := Syscall(SYS_FCHOWN, uintptr(fd), uintptr(uid), uintptr(gid)) + _, _, e1 := syscall_syscall(libc_fchown_trampoline_addr, uintptr(fd), uintptr(uid), uintptr(gid)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fchown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchown fchown "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fchownat(dirfd int, path string, uid int, gid int, flags int) (err error) { @@ -656,27 +910,35 @@ func Fchownat(dirfd int, path string, uid int, gid int, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_FCHOWNAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), uintptr(flags), 0) + _, _, e1 := syscall_syscall6(libc_fchownat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), uintptr(flags), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fchownat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchownat fchownat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Flock(fd int, how int) (err error) { - _, _, e1 := Syscall(SYS_FLOCK, uintptr(fd), uintptr(how), 0) + _, _, e1 := syscall_syscall(libc_flock_trampoline_addr, uintptr(fd), uintptr(how), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_flock_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_flock flock "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fpathconf(fd int, name int) (val int, err error) { - r0, _, e1 := Syscall(SYS_FPATHCONF, uintptr(fd), uintptr(name), 0) + r0, _, e1 := syscall_syscall(libc_fpathconf_trampoline_addr, uintptr(fd), uintptr(name), 0) val = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -684,16 +946,24 @@ func Fpathconf(fd int, name int) (val int, err error) { return } +var libc_fpathconf_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fpathconf fpathconf "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fstat(fd int, stat *Stat_t) (err error) { - _, _, e1 := Syscall(SYS_FSTAT, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) + _, _, e1 := syscall_syscall(libc_fstat_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fstat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fstat fstat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) { @@ -702,71 +972,99 @@ func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_FSTATAT, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), uintptr(flags), 0, 0) + _, _, e1 := syscall_syscall6(libc_fstatat_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fstatat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fstatat fstatat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fstatfs(fd int, stat *Statfs_t) (err error) { - _, _, e1 := Syscall(SYS_FSTATFS, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) + _, _, e1 := syscall_syscall(libc_fstatfs_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fstatfs_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fstatfs fstatfs "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fsync(fd int) (err error) { - _, _, e1 := Syscall(SYS_FSYNC, uintptr(fd), 0, 0) + _, _, e1 := syscall_syscall(libc_fsync_trampoline_addr, uintptr(fd), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fsync_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fsync fsync "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Ftruncate(fd int, length int64) (err error) { - _, _, e1 := Syscall(SYS_FTRUNCATE, uintptr(fd), 0, uintptr(length)) + _, _, e1 := syscall_syscall(libc_ftruncate_trampoline_addr, uintptr(fd), uintptr(length), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_ftruncate_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ftruncate ftruncate "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getegid() (egid int) { - r0, _, _ := RawSyscall(SYS_GETEGID, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_getegid_trampoline_addr, 0, 0, 0) egid = int(r0) return } +var libc_getegid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getegid getegid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Geteuid() (uid int) { - r0, _, _ := RawSyscall(SYS_GETEUID, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_geteuid_trampoline_addr, 0, 0, 0) uid = int(r0) return } +var libc_geteuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_geteuid geteuid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getgid() (gid int) { - r0, _, _ := RawSyscall(SYS_GETGID, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_getgid_trampoline_addr, 0, 0, 0) gid = int(r0) return } +var libc_getgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getgid getgid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getpgid(pid int) (pgid int, err error) { - r0, _, e1 := RawSyscall(SYS_GETPGID, uintptr(pid), 0, 0) + r0, _, e1 := syscall_rawSyscall(libc_getpgid_trampoline_addr, uintptr(pid), 0, 0) pgid = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -774,34 +1072,50 @@ func Getpgid(pid int) (pgid int, err error) { return } +var libc_getpgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpgid getpgid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getpgrp() (pgrp int) { - r0, _, _ := RawSyscall(SYS_GETPGRP, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_getpgrp_trampoline_addr, 0, 0, 0) pgrp = int(r0) return } +var libc_getpgrp_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpgrp getpgrp "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getpid() (pid int) { - r0, _, _ := RawSyscall(SYS_GETPID, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_getpid_trampoline_addr, 0, 0, 0) pid = int(r0) return } +var libc_getpid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpid getpid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getppid() (ppid int) { - r0, _, _ := RawSyscall(SYS_GETPPID, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_getppid_trampoline_addr, 0, 0, 0) ppid = int(r0) return } +var libc_getppid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getppid getppid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getpriority(which int, who int) (prio int, err error) { - r0, _, e1 := Syscall(SYS_GETPRIORITY, uintptr(which), uintptr(who), 0) + r0, _, e1 := syscall_syscall(libc_getpriority_trampoline_addr, uintptr(which), uintptr(who), 0) prio = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -809,20 +1123,28 @@ func Getpriority(which int, who int) (prio int, err error) { return } +var libc_getpriority_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpriority getpriority "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_GETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) + _, _, e1 := syscall_rawSyscall(libc_getrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_getrlimit_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getrlimit getrlimit "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getrtable() (rtable int, err error) { - r0, _, e1 := RawSyscall(SYS_GETRTABLE, 0, 0, 0) + r0, _, e1 := syscall_rawSyscall(libc_getrtable_trampoline_addr, 0, 0, 0) rtable = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -830,20 +1152,28 @@ func Getrtable() (rtable int, err error) { return } +var libc_getrtable_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getrtable getrtable "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getrusage(who int, rusage *Rusage) (err error) { - _, _, e1 := RawSyscall(SYS_GETRUSAGE, uintptr(who), uintptr(unsafe.Pointer(rusage)), 0) + _, _, e1 := syscall_rawSyscall(libc_getrusage_trampoline_addr, uintptr(who), uintptr(unsafe.Pointer(rusage)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_getrusage_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getrusage getrusage "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getsid(pid int) (sid int, err error) { - r0, _, e1 := RawSyscall(SYS_GETSID, uintptr(pid), 0, 0) + r0, _, e1 := syscall_rawSyscall(libc_getsid_trampoline_addr, uintptr(pid), 0, 0) sid = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -851,46 +1181,66 @@ func Getsid(pid int) (sid int, err error) { return } +var libc_getsid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getsid getsid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Gettimeofday(tv *Timeval) (err error) { - _, _, e1 := RawSyscall(SYS_GETTIMEOFDAY, uintptr(unsafe.Pointer(tv)), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_gettimeofday_trampoline_addr, uintptr(unsafe.Pointer(tv)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_gettimeofday_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_gettimeofday gettimeofday "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getuid() (uid int) { - r0, _, _ := RawSyscall(SYS_GETUID, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_getuid_trampoline_addr, 0, 0, 0) uid = int(r0) return } +var libc_getuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getuid getuid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Issetugid() (tainted bool) { - r0, _, _ := Syscall(SYS_ISSETUGID, 0, 0, 0) + r0, _, _ := syscall_syscall(libc_issetugid_trampoline_addr, 0, 0, 0) tainted = bool(r0 != 0) return } +var libc_issetugid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_issetugid issetugid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Kill(pid int, signum syscall.Signal) (err error) { - _, _, e1 := Syscall(SYS_KILL, uintptr(pid), uintptr(signum), 0) + _, _, e1 := syscall_syscall(libc_kill_trampoline_addr, uintptr(pid), uintptr(signum), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_kill_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_kill kill "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Kqueue() (fd int, err error) { - r0, _, e1 := Syscall(SYS_KQUEUE, 0, 0, 0) + r0, _, e1 := syscall_syscall(libc_kqueue_trampoline_addr, 0, 0, 0) fd = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -898,6 +1248,10 @@ func Kqueue() (fd int, err error) { return } +var libc_kqueue_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_kqueue kqueue "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Lchown(path string, uid int, gid int) (err error) { @@ -906,13 +1260,17 @@ func Lchown(path string, uid int, gid int) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_LCHOWN, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) + _, _, e1 := syscall_syscall(libc_lchown_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_lchown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_lchown lchown "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Link(path string, link string) (err error) { @@ -926,13 +1284,17 @@ func Link(path string, link string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_LINK, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) + _, _, e1 := syscall_syscall(libc_link_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_link_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_link link "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Linkat(pathfd int, path string, linkfd int, link string, flags int) (err error) { @@ -946,23 +1308,31 @@ func Linkat(pathfd int, path string, linkfd int, link string, flags int) (err er if err != nil { return } - _, _, e1 := Syscall6(SYS_LINKAT, uintptr(pathfd), uintptr(unsafe.Pointer(_p0)), uintptr(linkfd), uintptr(unsafe.Pointer(_p1)), uintptr(flags), 0) + _, _, e1 := syscall_syscall6(libc_linkat_trampoline_addr, uintptr(pathfd), uintptr(unsafe.Pointer(_p0)), uintptr(linkfd), uintptr(unsafe.Pointer(_p1)), uintptr(flags), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_linkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_linkat linkat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Listen(s int, backlog int) (err error) { - _, _, e1 := Syscall(SYS_LISTEN, uintptr(s), uintptr(backlog), 0) + _, _, e1 := syscall_syscall(libc_listen_trampoline_addr, uintptr(s), uintptr(backlog), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_listen_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_listen listen "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Lstat(path string, stat *Stat_t) (err error) { @@ -971,13 +1341,17 @@ func Lstat(path string, stat *Stat_t) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_LSTAT, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) + _, _, e1 := syscall_syscall(libc_lstat_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_lstat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_lstat lstat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mkdir(path string, mode uint32) (err error) { @@ -986,13 +1360,17 @@ func Mkdir(path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_MKDIR, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + _, _, e1 := syscall_syscall(libc_mkdir_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mkdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkdir mkdir "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mkdirat(dirfd int, path string, mode uint32) (err error) { @@ -1001,13 +1379,17 @@ func Mkdirat(dirfd int, path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_MKDIRAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) + _, _, e1 := syscall_syscall(libc_mkdirat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mkdirat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkdirat mkdirat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mkfifo(path string, mode uint32) (err error) { @@ -1016,13 +1398,17 @@ func Mkfifo(path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_MKFIFO, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + _, _, e1 := syscall_syscall(libc_mkfifo_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mkfifo_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkfifo mkfifo "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mkfifoat(dirfd int, path string, mode uint32) (err error) { @@ -1031,13 +1417,17 @@ func Mkfifoat(dirfd int, path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_MKFIFOAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) + _, _, e1 := syscall_syscall(libc_mkfifoat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mkfifoat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkfifoat mkfifoat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mknod(path string, mode uint32, dev int) (err error) { @@ -1046,13 +1436,17 @@ func Mknod(path string, mode uint32, dev int) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_MKNOD, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev)) + _, _, e1 := syscall_syscall(libc_mknod_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mknod_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mknod mknod "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mknodat(dirfd int, path string, mode uint32, dev int) (err error) { @@ -1061,23 +1455,31 @@ func Mknodat(dirfd int, path string, mode uint32, dev int) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_MKNODAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0) + _, _, e1 := syscall_syscall6(libc_mknodat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mknodat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mknodat mknodat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Nanosleep(time *Timespec, leftover *Timespec) (err error) { - _, _, e1 := Syscall(SYS_NANOSLEEP, uintptr(unsafe.Pointer(time)), uintptr(unsafe.Pointer(leftover)), 0) + _, _, e1 := syscall_syscall(libc_nanosleep_trampoline_addr, uintptr(unsafe.Pointer(time)), uintptr(unsafe.Pointer(leftover)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_nanosleep_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_nanosleep nanosleep "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Open(path string, mode int, perm uint32) (fd int, err error) { @@ -1086,7 +1488,7 @@ func Open(path string, mode int, perm uint32) (fd int, err error) { if err != nil { return } - r0, _, e1 := Syscall(SYS_OPEN, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm)) + r0, _, e1 := syscall_syscall(libc_open_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm)) fd = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1094,6 +1496,10 @@ func Open(path string, mode int, perm uint32) (fd int, err error) { return } +var libc_open_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_open open "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Openat(dirfd int, path string, mode int, perm uint32) (fd int, err error) { @@ -1102,7 +1508,7 @@ func Openat(dirfd int, path string, mode int, perm uint32) (fd int, err error) { if err != nil { return } - r0, _, e1 := Syscall6(SYS_OPENAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm), 0, 0) + r0, _, e1 := syscall_syscall6(libc_openat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm), 0, 0) fd = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1110,6 +1516,10 @@ func Openat(dirfd int, path string, mode int, perm uint32) (fd int, err error) { return } +var libc_openat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_openat openat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Pathconf(path string, name int) (val int, err error) { @@ -1118,7 +1528,7 @@ func Pathconf(path string, name int) (val int, err error) { if err != nil { return } - r0, _, e1 := Syscall(SYS_PATHCONF, uintptr(unsafe.Pointer(_p0)), uintptr(name), 0) + r0, _, e1 := syscall_syscall(libc_pathconf_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(name), 0) val = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1126,6 +1536,10 @@ func Pathconf(path string, name int) (val int, err error) { return } +var libc_pathconf_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pathconf pathconf "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func pread(fd int, p []byte, offset int64) (n int, err error) { @@ -1135,7 +1549,7 @@ func pread(fd int, p []byte, offset int64) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall6(SYS_PREAD, uintptr(fd), uintptr(_p0), uintptr(len(p)), 0, uintptr(offset), 0) + r0, _, e1 := syscall_syscall6(libc_pread_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(offset), 0, 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1143,6 +1557,10 @@ func pread(fd int, p []byte, offset int64) (n int, err error) { return } +var libc_pread_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pread pread "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func pwrite(fd int, p []byte, offset int64) (n int, err error) { @@ -1152,7 +1570,7 @@ func pwrite(fd int, p []byte, offset int64) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall6(SYS_PWRITE, uintptr(fd), uintptr(_p0), uintptr(len(p)), 0, uintptr(offset), 0) + r0, _, e1 := syscall_syscall6(libc_pwrite_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(offset), 0, 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1160,6 +1578,10 @@ func pwrite(fd int, p []byte, offset int64) (n int, err error) { return } +var libc_pwrite_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pwrite pwrite "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func read(fd int, p []byte) (n int, err error) { @@ -1169,7 +1591,7 @@ func read(fd int, p []byte) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(_p0), uintptr(len(p))) + r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p))) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1177,6 +1599,10 @@ func read(fd int, p []byte) (n int, err error) { return } +var libc_read_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_read read "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Readlink(path string, buf []byte) (n int, err error) { @@ -1191,7 +1617,7 @@ func Readlink(path string, buf []byte) (n int, err error) { } else { _p1 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall(SYS_READLINK, uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf))) + r0, _, e1 := syscall_syscall(libc_readlink_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf))) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1199,6 +1625,10 @@ func Readlink(path string, buf []byte) (n int, err error) { return } +var libc_readlink_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_readlink readlink "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Readlinkat(dirfd int, path string, buf []byte) (n int, err error) { @@ -1213,7 +1643,7 @@ func Readlinkat(dirfd int, path string, buf []byte) (n int, err error) { } else { _p1 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall6(SYS_READLINKAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf)), 0, 0) + r0, _, e1 := syscall_syscall6(libc_readlinkat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf)), 0, 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1221,6 +1651,10 @@ func Readlinkat(dirfd int, path string, buf []byte) (n int, err error) { return } +var libc_readlinkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_readlinkat readlinkat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Rename(from string, to string) (err error) { @@ -1234,13 +1668,17 @@ func Rename(from string, to string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_RENAME, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) + _, _, e1 := syscall_syscall(libc_rename_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_rename_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_rename rename "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Renameat(fromfd int, from string, tofd int, to string) (err error) { @@ -1254,13 +1692,17 @@ func Renameat(fromfd int, from string, tofd int, to string) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_RENAMEAT, uintptr(fromfd), uintptr(unsafe.Pointer(_p0)), uintptr(tofd), uintptr(unsafe.Pointer(_p1)), 0, 0) + _, _, e1 := syscall_syscall6(libc_renameat_trampoline_addr, uintptr(fromfd), uintptr(unsafe.Pointer(_p0)), uintptr(tofd), uintptr(unsafe.Pointer(_p1)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_renameat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_renameat renameat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Revoke(path string) (err error) { @@ -1269,13 +1711,17 @@ func Revoke(path string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_REVOKE, uintptr(unsafe.Pointer(_p0)), 0, 0) + _, _, e1 := syscall_syscall(libc_revoke_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_revoke_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_revoke revoke "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Rmdir(path string) (err error) { @@ -1284,17 +1730,21 @@ func Rmdir(path string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_RMDIR, uintptr(unsafe.Pointer(_p0)), 0, 0) + _, _, e1 := syscall_syscall(libc_rmdir_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_rmdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_rmdir rmdir "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Seek(fd int, offset int64, whence int) (newoffset int64, err error) { - r0, _, e1 := Syscall6(SYS_LSEEK, uintptr(fd), 0, uintptr(offset), uintptr(whence), 0, 0) + r0, _, e1 := syscall_syscall(libc_lseek_trampoline_addr, uintptr(fd), uintptr(offset), uintptr(whence)) newoffset = int64(r0) if e1 != 0 { err = errnoErr(e1) @@ -1302,10 +1752,14 @@ func Seek(fd int, offset int64, whence int) (newoffset int64, err error) { return } +var libc_lseek_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_lseek lseek "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err error) { - r0, _, e1 := Syscall6(SYS_SELECT, uintptr(nfd), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), 0) + r0, _, e1 := syscall_syscall6(libc_select_trampoline_addr, uintptr(nfd), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1313,36 +1767,52 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err return } +var libc_select_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_select select "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setegid(egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETEGID, uintptr(egid), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_setegid_trampoline_addr, uintptr(egid), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setegid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setegid setegid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Seteuid(euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETEUID, uintptr(euid), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_seteuid_trampoline_addr, uintptr(euid), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_seteuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_seteuid seteuid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setgid(gid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETGID, uintptr(gid), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_setgid_trampoline_addr, uintptr(gid), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setgid setgid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setlogin(name string) (err error) { @@ -1351,97 +1821,119 @@ func Setlogin(name string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_SETLOGIN, uintptr(unsafe.Pointer(_p0)), 0, 0) + _, _, e1 := syscall_syscall(libc_setlogin_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setlogin_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setlogin setlogin "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setpgid(pid int, pgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETPGID, uintptr(pid), uintptr(pgid), 0) + _, _, e1 := syscall_rawSyscall(libc_setpgid_trampoline_addr, uintptr(pid), uintptr(pgid), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setpgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setpgid setpgid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setpriority(which int, who int, prio int) (err error) { - _, _, e1 := Syscall(SYS_SETPRIORITY, uintptr(which), uintptr(who), uintptr(prio)) + _, _, e1 := syscall_syscall(libc_setpriority_trampoline_addr, uintptr(which), uintptr(who), uintptr(prio)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setpriority_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setpriority setpriority "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) + _, _, e1 := syscall_rawSyscall(libc_setregid_trampoline_addr, uintptr(rgid), uintptr(egid), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setregid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setregid setregid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) + _, _, e1 := syscall_rawSyscall(libc_setreuid_trampoline_addr, uintptr(ruid), uintptr(euid), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setreuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setreuid setreuid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) + _, _, e1 := syscall_rawSyscall(libc_setresgid_trampoline_addr, uintptr(rgid), uintptr(egid), uintptr(sgid)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setresgid setresgid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) + _, _, e1 := syscall_rawSyscall(libc_setresuid_trampoline_addr, uintptr(ruid), uintptr(euid), uintptr(suid)) if e1 != 0 { err = errnoErr(e1) } return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +var libc_setresuid_trampoline_addr uintptr -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} +//go:cgo_import_dynamic libc_setresuid setresuid "libc.so" // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setrtable(rtable int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRTABLE, uintptr(rtable), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setrtable_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setrtable setrtable "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setsid() (pid int, err error) { - r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) + r0, _, e1 := syscall_rawSyscall(libc_setsid_trampoline_addr, 0, 0, 0) pid = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1449,26 +1941,38 @@ func Setsid() (pid int, err error) { return } +var libc_setsid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setsid setsid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Settimeofday(tp *Timeval) (err error) { - _, _, e1 := RawSyscall(SYS_SETTIMEOFDAY, uintptr(unsafe.Pointer(tp)), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_settimeofday_trampoline_addr, uintptr(unsafe.Pointer(tp)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_settimeofday_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_settimeofday settimeofday "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setuid(uid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETUID, uintptr(uid), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_setuid_trampoline_addr, uintptr(uid), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setuid setuid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Stat(path string, stat *Stat_t) (err error) { @@ -1477,13 +1981,17 @@ func Stat(path string, stat *Stat_t) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_STAT, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) + _, _, e1 := syscall_syscall(libc_stat_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_stat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_stat stat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Statfs(path string, stat *Statfs_t) (err error) { @@ -1492,13 +2000,17 @@ func Statfs(path string, stat *Statfs_t) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_STATFS, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) + _, _, e1 := syscall_syscall(libc_statfs_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_statfs_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_statfs statfs "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Symlink(path string, link string) (err error) { @@ -1512,13 +2024,17 @@ func Symlink(path string, link string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_SYMLINK, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) + _, _, e1 := syscall_syscall(libc_symlink_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_symlink_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_symlink symlink "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Symlinkat(oldpath string, newdirfd int, newpath string) (err error) { @@ -1532,23 +2048,31 @@ func Symlinkat(oldpath string, newdirfd int, newpath string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_SYMLINKAT, uintptr(unsafe.Pointer(_p0)), uintptr(newdirfd), uintptr(unsafe.Pointer(_p1))) + _, _, e1 := syscall_syscall(libc_symlinkat_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(newdirfd), uintptr(unsafe.Pointer(_p1))) if e1 != 0 { err = errnoErr(e1) } return } +var libc_symlinkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_symlinkat symlinkat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Sync() (err error) { - _, _, e1 := Syscall(SYS_SYNC, 0, 0, 0) + _, _, e1 := syscall_syscall(libc_sync_trampoline_addr, 0, 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_sync_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sync sync "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Truncate(path string, length int64) (err error) { @@ -1557,21 +2081,29 @@ func Truncate(path string, length int64) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_TRUNCATE, uintptr(unsafe.Pointer(_p0)), 0, uintptr(length)) + _, _, e1 := syscall_syscall(libc_truncate_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(length), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_truncate_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_truncate truncate "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Umask(newmask int) (oldmask int) { - r0, _, _ := Syscall(SYS_UMASK, uintptr(newmask), 0, 0) + r0, _, _ := syscall_syscall(libc_umask_trampoline_addr, uintptr(newmask), 0, 0) oldmask = int(r0) return } +var libc_umask_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_umask umask "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Unlink(path string) (err error) { @@ -1580,13 +2112,17 @@ func Unlink(path string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_UNLINK, uintptr(unsafe.Pointer(_p0)), 0, 0) + _, _, e1 := syscall_syscall(libc_unlink_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_unlink_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unlink unlink "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Unlinkat(dirfd int, path string, flags int) (err error) { @@ -1595,13 +2131,17 @@ func Unlinkat(dirfd int, path string, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_UNLINKAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(flags)) + _, _, e1 := syscall_syscall(libc_unlinkat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(flags)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_unlinkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unlinkat unlinkat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Unmount(path string, flags int) (err error) { @@ -1610,13 +2150,17 @@ func Unmount(path string, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_UNMOUNT, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) + _, _, e1 := syscall_syscall(libc_unmount_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_unmount_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unmount unmount "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func write(fd int, p []byte) (n int, err error) { @@ -1626,7 +2170,7 @@ func write(fd int, p []byte) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(_p0), uintptr(len(p))) + r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p))) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1634,10 +2178,14 @@ func write(fd int, p []byte) (n int, err error) { return } +var libc_write_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_write write "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) { - r0, _, e1 := Syscall9(SYS_MMAP, uintptr(addr), uintptr(length), uintptr(prot), uintptr(flag), uintptr(fd), 0, uintptr(pos), 0, 0) + r0, _, e1 := syscall_syscall6(libc_mmap_trampoline_addr, uintptr(addr), uintptr(length), uintptr(prot), uintptr(flag), uintptr(fd), uintptr(pos)) ret = uintptr(r0) if e1 != 0 { err = errnoErr(e1) @@ -1645,20 +2193,28 @@ func mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) ( return } +var libc_mmap_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mmap mmap "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func munmap(addr uintptr, length uintptr) (err error) { - _, _, e1 := Syscall(SYS_MUNMAP, uintptr(addr), uintptr(length), 0) + _, _, e1 := syscall_syscall(libc_munmap_trampoline_addr, uintptr(addr), uintptr(length), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_munmap_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_munmap munmap "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) + r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1669,7 +2225,7 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) + r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1685,9 +2241,13 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error if err != nil { return } - _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) + _, _, e1 := syscall_syscall6(libc_utimensat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } + +var libc_utimensat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_utimensat utimensat "libc.so" diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s new file mode 100644 index 0000000..2763620 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s @@ -0,0 +1,674 @@ +// go run mkasm.go openbsd amd64 +// Code generated by the command above; DO NOT EDIT. + +#include "textflag.h" + +TEXT libc_getgroups_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getgroups(SB) +GLOBL ·libc_getgroups_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getgroups_trampoline_addr(SB)/8, $libc_getgroups_trampoline<>(SB) + +TEXT libc_setgroups_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setgroups(SB) +GLOBL ·libc_setgroups_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setgroups_trampoline_addr(SB)/8, $libc_setgroups_trampoline<>(SB) + +TEXT libc_wait4_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_wait4(SB) +GLOBL ·libc_wait4_trampoline_addr(SB), RODATA, $8 +DATA ·libc_wait4_trampoline_addr(SB)/8, $libc_wait4_trampoline<>(SB) + +TEXT libc_accept_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_accept(SB) +GLOBL ·libc_accept_trampoline_addr(SB), RODATA, $8 +DATA ·libc_accept_trampoline_addr(SB)/8, $libc_accept_trampoline<>(SB) + +TEXT libc_bind_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_bind(SB) +GLOBL ·libc_bind_trampoline_addr(SB), RODATA, $8 +DATA ·libc_bind_trampoline_addr(SB)/8, $libc_bind_trampoline<>(SB) + +TEXT libc_connect_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_connect(SB) +GLOBL ·libc_connect_trampoline_addr(SB), RODATA, $8 +DATA ·libc_connect_trampoline_addr(SB)/8, $libc_connect_trampoline<>(SB) + +TEXT libc_socket_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_socket(SB) +GLOBL ·libc_socket_trampoline_addr(SB), RODATA, $8 +DATA ·libc_socket_trampoline_addr(SB)/8, $libc_socket_trampoline<>(SB) + +TEXT libc_getsockopt_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getsockopt(SB) +GLOBL ·libc_getsockopt_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getsockopt_trampoline_addr(SB)/8, $libc_getsockopt_trampoline<>(SB) + +TEXT libc_setsockopt_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setsockopt(SB) +GLOBL ·libc_setsockopt_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setsockopt_trampoline_addr(SB)/8, $libc_setsockopt_trampoline<>(SB) + +TEXT libc_getpeername_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpeername(SB) +GLOBL ·libc_getpeername_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpeername_trampoline_addr(SB)/8, $libc_getpeername_trampoline<>(SB) + +TEXT libc_getsockname_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getsockname(SB) +GLOBL ·libc_getsockname_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getsockname_trampoline_addr(SB)/8, $libc_getsockname_trampoline<>(SB) + +TEXT libc_shutdown_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_shutdown(SB) +GLOBL ·libc_shutdown_trampoline_addr(SB), RODATA, $8 +DATA ·libc_shutdown_trampoline_addr(SB)/8, $libc_shutdown_trampoline<>(SB) + +TEXT libc_socketpair_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_socketpair(SB) +GLOBL ·libc_socketpair_trampoline_addr(SB), RODATA, $8 +DATA ·libc_socketpair_trampoline_addr(SB)/8, $libc_socketpair_trampoline<>(SB) + +TEXT libc_recvfrom_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_recvfrom(SB) +GLOBL ·libc_recvfrom_trampoline_addr(SB), RODATA, $8 +DATA ·libc_recvfrom_trampoline_addr(SB)/8, $libc_recvfrom_trampoline<>(SB) + +TEXT libc_sendto_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sendto(SB) +GLOBL ·libc_sendto_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sendto_trampoline_addr(SB)/8, $libc_sendto_trampoline<>(SB) + +TEXT libc_recvmsg_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_recvmsg(SB) +GLOBL ·libc_recvmsg_trampoline_addr(SB), RODATA, $8 +DATA ·libc_recvmsg_trampoline_addr(SB)/8, $libc_recvmsg_trampoline<>(SB) + +TEXT libc_sendmsg_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sendmsg(SB) +GLOBL ·libc_sendmsg_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sendmsg_trampoline_addr(SB)/8, $libc_sendmsg_trampoline<>(SB) + +TEXT libc_kevent_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_kevent(SB) +GLOBL ·libc_kevent_trampoline_addr(SB), RODATA, $8 +DATA ·libc_kevent_trampoline_addr(SB)/8, $libc_kevent_trampoline<>(SB) + +TEXT libc_utimes_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_utimes(SB) +GLOBL ·libc_utimes_trampoline_addr(SB), RODATA, $8 +DATA ·libc_utimes_trampoline_addr(SB)/8, $libc_utimes_trampoline<>(SB) + +TEXT libc_futimes_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_futimes(SB) +GLOBL ·libc_futimes_trampoline_addr(SB), RODATA, $8 +DATA ·libc_futimes_trampoline_addr(SB)/8, $libc_futimes_trampoline<>(SB) + +TEXT libc_poll_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_poll(SB) +GLOBL ·libc_poll_trampoline_addr(SB), RODATA, $8 +DATA ·libc_poll_trampoline_addr(SB)/8, $libc_poll_trampoline<>(SB) + +TEXT libc_madvise_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_madvise(SB) +GLOBL ·libc_madvise_trampoline_addr(SB), RODATA, $8 +DATA ·libc_madvise_trampoline_addr(SB)/8, $libc_madvise_trampoline<>(SB) + +TEXT libc_mlock_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mlock(SB) +GLOBL ·libc_mlock_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mlock_trampoline_addr(SB)/8, $libc_mlock_trampoline<>(SB) + +TEXT libc_mlockall_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mlockall(SB) +GLOBL ·libc_mlockall_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mlockall_trampoline_addr(SB)/8, $libc_mlockall_trampoline<>(SB) + +TEXT libc_mprotect_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mprotect(SB) +GLOBL ·libc_mprotect_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mprotect_trampoline_addr(SB)/8, $libc_mprotect_trampoline<>(SB) + +TEXT libc_msync_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_msync(SB) +GLOBL ·libc_msync_trampoline_addr(SB), RODATA, $8 +DATA ·libc_msync_trampoline_addr(SB)/8, $libc_msync_trampoline<>(SB) + +TEXT libc_munlock_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_munlock(SB) +GLOBL ·libc_munlock_trampoline_addr(SB), RODATA, $8 +DATA ·libc_munlock_trampoline_addr(SB)/8, $libc_munlock_trampoline<>(SB) + +TEXT libc_munlockall_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_munlockall(SB) +GLOBL ·libc_munlockall_trampoline_addr(SB), RODATA, $8 +DATA ·libc_munlockall_trampoline_addr(SB)/8, $libc_munlockall_trampoline<>(SB) + +TEXT libc_pipe2_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pipe2(SB) +GLOBL ·libc_pipe2_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pipe2_trampoline_addr(SB)/8, $libc_pipe2_trampoline<>(SB) + +TEXT libc_getdents_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getdents(SB) +GLOBL ·libc_getdents_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getdents_trampoline_addr(SB)/8, $libc_getdents_trampoline<>(SB) + +TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getcwd(SB) +GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) + +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + +TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_ioctl(SB) +GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_ioctl_trampoline_addr(SB)/8, $libc_ioctl_trampoline<>(SB) + +TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sysctl(SB) +GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) + +TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_ppoll(SB) +GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $8 +DATA ·libc_ppoll_trampoline_addr(SB)/8, $libc_ppoll_trampoline<>(SB) + +TEXT libc_access_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_access(SB) +GLOBL ·libc_access_trampoline_addr(SB), RODATA, $8 +DATA ·libc_access_trampoline_addr(SB)/8, $libc_access_trampoline<>(SB) + +TEXT libc_adjtime_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_adjtime(SB) +GLOBL ·libc_adjtime_trampoline_addr(SB), RODATA, $8 +DATA ·libc_adjtime_trampoline_addr(SB)/8, $libc_adjtime_trampoline<>(SB) + +TEXT libc_chdir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chdir(SB) +GLOBL ·libc_chdir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chdir_trampoline_addr(SB)/8, $libc_chdir_trampoline<>(SB) + +TEXT libc_chflags_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chflags(SB) +GLOBL ·libc_chflags_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chflags_trampoline_addr(SB)/8, $libc_chflags_trampoline<>(SB) + +TEXT libc_chmod_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chmod(SB) +GLOBL ·libc_chmod_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chmod_trampoline_addr(SB)/8, $libc_chmod_trampoline<>(SB) + +TEXT libc_chown_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chown(SB) +GLOBL ·libc_chown_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chown_trampoline_addr(SB)/8, $libc_chown_trampoline<>(SB) + +TEXT libc_chroot_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chroot(SB) +GLOBL ·libc_chroot_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chroot_trampoline_addr(SB)/8, $libc_chroot_trampoline<>(SB) + +TEXT libc_clock_gettime_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_clock_gettime(SB) +GLOBL ·libc_clock_gettime_trampoline_addr(SB), RODATA, $8 +DATA ·libc_clock_gettime_trampoline_addr(SB)/8, $libc_clock_gettime_trampoline<>(SB) + +TEXT libc_close_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_close(SB) +GLOBL ·libc_close_trampoline_addr(SB), RODATA, $8 +DATA ·libc_close_trampoline_addr(SB)/8, $libc_close_trampoline<>(SB) + +TEXT libc_dup_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_dup(SB) +GLOBL ·libc_dup_trampoline_addr(SB), RODATA, $8 +DATA ·libc_dup_trampoline_addr(SB)/8, $libc_dup_trampoline<>(SB) + +TEXT libc_dup2_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_dup2(SB) +GLOBL ·libc_dup2_trampoline_addr(SB), RODATA, $8 +DATA ·libc_dup2_trampoline_addr(SB)/8, $libc_dup2_trampoline<>(SB) + +TEXT libc_dup3_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_dup3(SB) +GLOBL ·libc_dup3_trampoline_addr(SB), RODATA, $8 +DATA ·libc_dup3_trampoline_addr(SB)/8, $libc_dup3_trampoline<>(SB) + +TEXT libc_exit_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_exit(SB) +GLOBL ·libc_exit_trampoline_addr(SB), RODATA, $8 +DATA ·libc_exit_trampoline_addr(SB)/8, $libc_exit_trampoline<>(SB) + +TEXT libc_faccessat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_faccessat(SB) +GLOBL ·libc_faccessat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_faccessat_trampoline_addr(SB)/8, $libc_faccessat_trampoline<>(SB) + +TEXT libc_fchdir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchdir(SB) +GLOBL ·libc_fchdir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchdir_trampoline_addr(SB)/8, $libc_fchdir_trampoline<>(SB) + +TEXT libc_fchflags_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchflags(SB) +GLOBL ·libc_fchflags_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchflags_trampoline_addr(SB)/8, $libc_fchflags_trampoline<>(SB) + +TEXT libc_fchmod_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchmod(SB) +GLOBL ·libc_fchmod_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchmod_trampoline_addr(SB)/8, $libc_fchmod_trampoline<>(SB) + +TEXT libc_fchmodat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchmodat(SB) +GLOBL ·libc_fchmodat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchmodat_trampoline_addr(SB)/8, $libc_fchmodat_trampoline<>(SB) + +TEXT libc_fchown_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchown(SB) +GLOBL ·libc_fchown_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchown_trampoline_addr(SB)/8, $libc_fchown_trampoline<>(SB) + +TEXT libc_fchownat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchownat(SB) +GLOBL ·libc_fchownat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchownat_trampoline_addr(SB)/8, $libc_fchownat_trampoline<>(SB) + +TEXT libc_flock_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_flock(SB) +GLOBL ·libc_flock_trampoline_addr(SB), RODATA, $8 +DATA ·libc_flock_trampoline_addr(SB)/8, $libc_flock_trampoline<>(SB) + +TEXT libc_fpathconf_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fpathconf(SB) +GLOBL ·libc_fpathconf_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fpathconf_trampoline_addr(SB)/8, $libc_fpathconf_trampoline<>(SB) + +TEXT libc_fstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fstat(SB) +GLOBL ·libc_fstat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fstat_trampoline_addr(SB)/8, $libc_fstat_trampoline<>(SB) + +TEXT libc_fstatat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fstatat(SB) +GLOBL ·libc_fstatat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fstatat_trampoline_addr(SB)/8, $libc_fstatat_trampoline<>(SB) + +TEXT libc_fstatfs_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fstatfs(SB) +GLOBL ·libc_fstatfs_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fstatfs_trampoline_addr(SB)/8, $libc_fstatfs_trampoline<>(SB) + +TEXT libc_fsync_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fsync(SB) +GLOBL ·libc_fsync_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fsync_trampoline_addr(SB)/8, $libc_fsync_trampoline<>(SB) + +TEXT libc_ftruncate_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_ftruncate(SB) +GLOBL ·libc_ftruncate_trampoline_addr(SB), RODATA, $8 +DATA ·libc_ftruncate_trampoline_addr(SB)/8, $libc_ftruncate_trampoline<>(SB) + +TEXT libc_getegid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getegid(SB) +GLOBL ·libc_getegid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getegid_trampoline_addr(SB)/8, $libc_getegid_trampoline<>(SB) + +TEXT libc_geteuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_geteuid(SB) +GLOBL ·libc_geteuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_geteuid_trampoline_addr(SB)/8, $libc_geteuid_trampoline<>(SB) + +TEXT libc_getgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getgid(SB) +GLOBL ·libc_getgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getgid_trampoline_addr(SB)/8, $libc_getgid_trampoline<>(SB) + +TEXT libc_getpgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpgid(SB) +GLOBL ·libc_getpgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpgid_trampoline_addr(SB)/8, $libc_getpgid_trampoline<>(SB) + +TEXT libc_getpgrp_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpgrp(SB) +GLOBL ·libc_getpgrp_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpgrp_trampoline_addr(SB)/8, $libc_getpgrp_trampoline<>(SB) + +TEXT libc_getpid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpid(SB) +GLOBL ·libc_getpid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpid_trampoline_addr(SB)/8, $libc_getpid_trampoline<>(SB) + +TEXT libc_getppid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getppid(SB) +GLOBL ·libc_getppid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getppid_trampoline_addr(SB)/8, $libc_getppid_trampoline<>(SB) + +TEXT libc_getpriority_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpriority(SB) +GLOBL ·libc_getpriority_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpriority_trampoline_addr(SB)/8, $libc_getpriority_trampoline<>(SB) + +TEXT libc_getrlimit_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getrlimit(SB) +GLOBL ·libc_getrlimit_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getrlimit_trampoline_addr(SB)/8, $libc_getrlimit_trampoline<>(SB) + +TEXT libc_getrtable_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getrtable(SB) +GLOBL ·libc_getrtable_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getrtable_trampoline_addr(SB)/8, $libc_getrtable_trampoline<>(SB) + +TEXT libc_getrusage_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getrusage(SB) +GLOBL ·libc_getrusage_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getrusage_trampoline_addr(SB)/8, $libc_getrusage_trampoline<>(SB) + +TEXT libc_getsid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getsid(SB) +GLOBL ·libc_getsid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getsid_trampoline_addr(SB)/8, $libc_getsid_trampoline<>(SB) + +TEXT libc_gettimeofday_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_gettimeofday(SB) +GLOBL ·libc_gettimeofday_trampoline_addr(SB), RODATA, $8 +DATA ·libc_gettimeofday_trampoline_addr(SB)/8, $libc_gettimeofday_trampoline<>(SB) + +TEXT libc_getuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getuid(SB) +GLOBL ·libc_getuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getuid_trampoline_addr(SB)/8, $libc_getuid_trampoline<>(SB) + +TEXT libc_issetugid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_issetugid(SB) +GLOBL ·libc_issetugid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_issetugid_trampoline_addr(SB)/8, $libc_issetugid_trampoline<>(SB) + +TEXT libc_kill_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_kill(SB) +GLOBL ·libc_kill_trampoline_addr(SB), RODATA, $8 +DATA ·libc_kill_trampoline_addr(SB)/8, $libc_kill_trampoline<>(SB) + +TEXT libc_kqueue_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_kqueue(SB) +GLOBL ·libc_kqueue_trampoline_addr(SB), RODATA, $8 +DATA ·libc_kqueue_trampoline_addr(SB)/8, $libc_kqueue_trampoline<>(SB) + +TEXT libc_lchown_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_lchown(SB) +GLOBL ·libc_lchown_trampoline_addr(SB), RODATA, $8 +DATA ·libc_lchown_trampoline_addr(SB)/8, $libc_lchown_trampoline<>(SB) + +TEXT libc_link_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_link(SB) +GLOBL ·libc_link_trampoline_addr(SB), RODATA, $8 +DATA ·libc_link_trampoline_addr(SB)/8, $libc_link_trampoline<>(SB) + +TEXT libc_linkat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_linkat(SB) +GLOBL ·libc_linkat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_linkat_trampoline_addr(SB)/8, $libc_linkat_trampoline<>(SB) + +TEXT libc_listen_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_listen(SB) +GLOBL ·libc_listen_trampoline_addr(SB), RODATA, $8 +DATA ·libc_listen_trampoline_addr(SB)/8, $libc_listen_trampoline<>(SB) + +TEXT libc_lstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_lstat(SB) +GLOBL ·libc_lstat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_lstat_trampoline_addr(SB)/8, $libc_lstat_trampoline<>(SB) + +TEXT libc_mkdir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mkdir(SB) +GLOBL ·libc_mkdir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mkdir_trampoline_addr(SB)/8, $libc_mkdir_trampoline<>(SB) + +TEXT libc_mkdirat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mkdirat(SB) +GLOBL ·libc_mkdirat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mkdirat_trampoline_addr(SB)/8, $libc_mkdirat_trampoline<>(SB) + +TEXT libc_mkfifo_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mkfifo(SB) +GLOBL ·libc_mkfifo_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mkfifo_trampoline_addr(SB)/8, $libc_mkfifo_trampoline<>(SB) + +TEXT libc_mkfifoat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mkfifoat(SB) +GLOBL ·libc_mkfifoat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mkfifoat_trampoline_addr(SB)/8, $libc_mkfifoat_trampoline<>(SB) + +TEXT libc_mknod_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mknod(SB) +GLOBL ·libc_mknod_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mknod_trampoline_addr(SB)/8, $libc_mknod_trampoline<>(SB) + +TEXT libc_mknodat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mknodat(SB) +GLOBL ·libc_mknodat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mknodat_trampoline_addr(SB)/8, $libc_mknodat_trampoline<>(SB) + +TEXT libc_nanosleep_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_nanosleep(SB) +GLOBL ·libc_nanosleep_trampoline_addr(SB), RODATA, $8 +DATA ·libc_nanosleep_trampoline_addr(SB)/8, $libc_nanosleep_trampoline<>(SB) + +TEXT libc_open_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_open(SB) +GLOBL ·libc_open_trampoline_addr(SB), RODATA, $8 +DATA ·libc_open_trampoline_addr(SB)/8, $libc_open_trampoline<>(SB) + +TEXT libc_openat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_openat(SB) +GLOBL ·libc_openat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_openat_trampoline_addr(SB)/8, $libc_openat_trampoline<>(SB) + +TEXT libc_pathconf_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pathconf(SB) +GLOBL ·libc_pathconf_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pathconf_trampoline_addr(SB)/8, $libc_pathconf_trampoline<>(SB) + +TEXT libc_pread_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pread(SB) +GLOBL ·libc_pread_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pread_trampoline_addr(SB)/8, $libc_pread_trampoline<>(SB) + +TEXT libc_pwrite_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pwrite(SB) +GLOBL ·libc_pwrite_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pwrite_trampoline_addr(SB)/8, $libc_pwrite_trampoline<>(SB) + +TEXT libc_read_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_read(SB) +GLOBL ·libc_read_trampoline_addr(SB), RODATA, $8 +DATA ·libc_read_trampoline_addr(SB)/8, $libc_read_trampoline<>(SB) + +TEXT libc_readlink_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_readlink(SB) +GLOBL ·libc_readlink_trampoline_addr(SB), RODATA, $8 +DATA ·libc_readlink_trampoline_addr(SB)/8, $libc_readlink_trampoline<>(SB) + +TEXT libc_readlinkat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_readlinkat(SB) +GLOBL ·libc_readlinkat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_readlinkat_trampoline_addr(SB)/8, $libc_readlinkat_trampoline<>(SB) + +TEXT libc_rename_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_rename(SB) +GLOBL ·libc_rename_trampoline_addr(SB), RODATA, $8 +DATA ·libc_rename_trampoline_addr(SB)/8, $libc_rename_trampoline<>(SB) + +TEXT libc_renameat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_renameat(SB) +GLOBL ·libc_renameat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_renameat_trampoline_addr(SB)/8, $libc_renameat_trampoline<>(SB) + +TEXT libc_revoke_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_revoke(SB) +GLOBL ·libc_revoke_trampoline_addr(SB), RODATA, $8 +DATA ·libc_revoke_trampoline_addr(SB)/8, $libc_revoke_trampoline<>(SB) + +TEXT libc_rmdir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_rmdir(SB) +GLOBL ·libc_rmdir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_rmdir_trampoline_addr(SB)/8, $libc_rmdir_trampoline<>(SB) + +TEXT libc_lseek_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_lseek(SB) +GLOBL ·libc_lseek_trampoline_addr(SB), RODATA, $8 +DATA ·libc_lseek_trampoline_addr(SB)/8, $libc_lseek_trampoline<>(SB) + +TEXT libc_select_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_select(SB) +GLOBL ·libc_select_trampoline_addr(SB), RODATA, $8 +DATA ·libc_select_trampoline_addr(SB)/8, $libc_select_trampoline<>(SB) + +TEXT libc_setegid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setegid(SB) +GLOBL ·libc_setegid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setegid_trampoline_addr(SB)/8, $libc_setegid_trampoline<>(SB) + +TEXT libc_seteuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_seteuid(SB) +GLOBL ·libc_seteuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_seteuid_trampoline_addr(SB)/8, $libc_seteuid_trampoline<>(SB) + +TEXT libc_setgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setgid(SB) +GLOBL ·libc_setgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setgid_trampoline_addr(SB)/8, $libc_setgid_trampoline<>(SB) + +TEXT libc_setlogin_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setlogin(SB) +GLOBL ·libc_setlogin_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setlogin_trampoline_addr(SB)/8, $libc_setlogin_trampoline<>(SB) + +TEXT libc_setpgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setpgid(SB) +GLOBL ·libc_setpgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setpgid_trampoline_addr(SB)/8, $libc_setpgid_trampoline<>(SB) + +TEXT libc_setpriority_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setpriority(SB) +GLOBL ·libc_setpriority_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setpriority_trampoline_addr(SB)/8, $libc_setpriority_trampoline<>(SB) + +TEXT libc_setregid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setregid(SB) +GLOBL ·libc_setregid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setregid_trampoline_addr(SB)/8, $libc_setregid_trampoline<>(SB) + +TEXT libc_setreuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setreuid(SB) +GLOBL ·libc_setreuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setreuid_trampoline_addr(SB)/8, $libc_setreuid_trampoline<>(SB) + +TEXT libc_setresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setresgid(SB) +GLOBL ·libc_setresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setresgid_trampoline_addr(SB)/8, $libc_setresgid_trampoline<>(SB) + +TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setresuid(SB) +GLOBL ·libc_setresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setresuid_trampoline_addr(SB)/8, $libc_setresuid_trampoline<>(SB) + +TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setrtable(SB) +GLOBL ·libc_setrtable_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setrtable_trampoline_addr(SB)/8, $libc_setrtable_trampoline<>(SB) + +TEXT libc_setsid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setsid(SB) +GLOBL ·libc_setsid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setsid_trampoline_addr(SB)/8, $libc_setsid_trampoline<>(SB) + +TEXT libc_settimeofday_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_settimeofday(SB) +GLOBL ·libc_settimeofday_trampoline_addr(SB), RODATA, $8 +DATA ·libc_settimeofday_trampoline_addr(SB)/8, $libc_settimeofday_trampoline<>(SB) + +TEXT libc_setuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setuid(SB) +GLOBL ·libc_setuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setuid_trampoline_addr(SB)/8, $libc_setuid_trampoline<>(SB) + +TEXT libc_stat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_stat(SB) +GLOBL ·libc_stat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_stat_trampoline_addr(SB)/8, $libc_stat_trampoline<>(SB) + +TEXT libc_statfs_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_statfs(SB) +GLOBL ·libc_statfs_trampoline_addr(SB), RODATA, $8 +DATA ·libc_statfs_trampoline_addr(SB)/8, $libc_statfs_trampoline<>(SB) + +TEXT libc_symlink_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_symlink(SB) +GLOBL ·libc_symlink_trampoline_addr(SB), RODATA, $8 +DATA ·libc_symlink_trampoline_addr(SB)/8, $libc_symlink_trampoline<>(SB) + +TEXT libc_symlinkat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_symlinkat(SB) +GLOBL ·libc_symlinkat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_symlinkat_trampoline_addr(SB)/8, $libc_symlinkat_trampoline<>(SB) + +TEXT libc_sync_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sync(SB) +GLOBL ·libc_sync_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sync_trampoline_addr(SB)/8, $libc_sync_trampoline<>(SB) + +TEXT libc_truncate_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_truncate(SB) +GLOBL ·libc_truncate_trampoline_addr(SB), RODATA, $8 +DATA ·libc_truncate_trampoline_addr(SB)/8, $libc_truncate_trampoline<>(SB) + +TEXT libc_umask_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_umask(SB) +GLOBL ·libc_umask_trampoline_addr(SB), RODATA, $8 +DATA ·libc_umask_trampoline_addr(SB)/8, $libc_umask_trampoline<>(SB) + +TEXT libc_unlink_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unlink(SB) +GLOBL ·libc_unlink_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unlink_trampoline_addr(SB)/8, $libc_unlink_trampoline<>(SB) + +TEXT libc_unlinkat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unlinkat(SB) +GLOBL ·libc_unlinkat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unlinkat_trampoline_addr(SB)/8, $libc_unlinkat_trampoline<>(SB) + +TEXT libc_unmount_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unmount(SB) +GLOBL ·libc_unmount_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unmount_trampoline_addr(SB)/8, $libc_unmount_trampoline<>(SB) + +TEXT libc_write_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_write(SB) +GLOBL ·libc_write_trampoline_addr(SB), RODATA, $8 +DATA ·libc_write_trampoline_addr(SB)/8, $libc_write_trampoline<>(SB) + +TEXT libc_mmap_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mmap(SB) +GLOBL ·libc_mmap_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mmap_trampoline_addr(SB)/8, $libc_mmap_trampoline<>(SB) + +TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_munmap(SB) +GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 +DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) + +TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_utimensat(SB) +GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go index 69f8030..8e87fdf 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go @@ -1,4 +1,4 @@ -// go run mksyscall.go -l32 -openbsd -arm -tags openbsd,arm syscall_bsd.go syscall_openbsd.go syscall_openbsd_arm.go +// go run mksyscall.go -l32 -openbsd -arm -libc -tags openbsd,arm syscall_bsd.go syscall_openbsd.go syscall_openbsd_arm.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build openbsd && arm @@ -16,7 +16,7 @@ var _ syscall.Errno // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func getgroups(ngid int, gid *_Gid_t) (n int, err error) { - r0, _, e1 := RawSyscall(SYS_GETGROUPS, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0) + r0, _, e1 := syscall_rawSyscall(libc_getgroups_trampoline_addr, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -24,20 +24,28 @@ func getgroups(ngid int, gid *_Gid_t) (n int, err error) { return } +var libc_getgroups_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getgroups getgroups "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func setgroups(ngid int, gid *_Gid_t) (err error) { - _, _, e1 := RawSyscall(SYS_SETGROUPS, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0) + _, _, e1 := syscall_rawSyscall(libc_setgroups_trampoline_addr, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setgroups_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setgroups setgroups "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func wait4(pid int, wstatus *_C_int, options int, rusage *Rusage) (wpid int, err error) { - r0, _, e1 := Syscall6(SYS_WAIT4, uintptr(pid), uintptr(unsafe.Pointer(wstatus)), uintptr(options), uintptr(unsafe.Pointer(rusage)), 0, 0) + r0, _, e1 := syscall_syscall6(libc_wait4_trampoline_addr, uintptr(pid), uintptr(unsafe.Pointer(wstatus)), uintptr(options), uintptr(unsafe.Pointer(rusage)), 0, 0) wpid = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -45,10 +53,14 @@ func wait4(pid int, wstatus *_C_int, options int, rusage *Rusage) (wpid int, err return } +var libc_wait4_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_wait4 wait4 "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { - r0, _, e1 := Syscall(SYS_ACCEPT, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + r0, _, e1 := syscall_syscall(libc_accept_trampoline_addr, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) fd = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -56,30 +68,42 @@ func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { return } +var libc_accept_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_accept accept "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { - _, _, e1 := Syscall(SYS_BIND, uintptr(s), uintptr(addr), uintptr(addrlen)) + _, _, e1 := syscall_syscall(libc_bind_trampoline_addr, uintptr(s), uintptr(addr), uintptr(addrlen)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_bind_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_bind bind "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func connect(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { - _, _, e1 := Syscall(SYS_CONNECT, uintptr(s), uintptr(addr), uintptr(addrlen)) + _, _, e1 := syscall_syscall(libc_connect_trampoline_addr, uintptr(s), uintptr(addr), uintptr(addrlen)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_connect_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_connect connect "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func socket(domain int, typ int, proto int) (fd int, err error) { - r0, _, e1 := RawSyscall(SYS_SOCKET, uintptr(domain), uintptr(typ), uintptr(proto)) + r0, _, e1 := syscall_rawSyscall(libc_socket_trampoline_addr, uintptr(domain), uintptr(typ), uintptr(proto)) fd = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -87,66 +111,94 @@ func socket(domain int, typ int, proto int) (fd int, err error) { return } +var libc_socket_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_socket socket "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func getsockopt(s int, level int, name int, val unsafe.Pointer, vallen *_Socklen) (err error) { - _, _, e1 := Syscall6(SYS_GETSOCKOPT, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(unsafe.Pointer(vallen)), 0) + _, _, e1 := syscall_syscall6(libc_getsockopt_trampoline_addr, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(unsafe.Pointer(vallen)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_getsockopt_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getsockopt getsockopt "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func setsockopt(s int, level int, name int, val unsafe.Pointer, vallen uintptr) (err error) { - _, _, e1 := Syscall6(SYS_SETSOCKOPT, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(vallen), 0) + _, _, e1 := syscall_syscall6(libc_setsockopt_trampoline_addr, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(vallen), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setsockopt_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setsockopt setsockopt "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func getpeername(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { - _, _, e1 := RawSyscall(SYS_GETPEERNAME, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + _, _, e1 := syscall_rawSyscall(libc_getpeername_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) if e1 != 0 { err = errnoErr(e1) } return } +var libc_getpeername_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpeername getpeername "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func getsockname(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { - _, _, e1 := RawSyscall(SYS_GETSOCKNAME, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + _, _, e1 := syscall_rawSyscall(libc_getsockname_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) if e1 != 0 { err = errnoErr(e1) } return } +var libc_getsockname_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getsockname getsockname "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Shutdown(s int, how int) (err error) { - _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(s), uintptr(how), 0) + _, _, e1 := syscall_syscall(libc_shutdown_trampoline_addr, uintptr(s), uintptr(how), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_shutdown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_shutdown shutdown "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func socketpair(domain int, typ int, proto int, fd *[2]int32) (err error) { - _, _, e1 := RawSyscall6(SYS_SOCKETPAIR, uintptr(domain), uintptr(typ), uintptr(proto), uintptr(unsafe.Pointer(fd)), 0, 0) + _, _, e1 := syscall_rawSyscall6(libc_socketpair_trampoline_addr, uintptr(domain), uintptr(typ), uintptr(proto), uintptr(unsafe.Pointer(fd)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_socketpair_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_socketpair socketpair "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Socklen) (n int, err error) { @@ -156,7 +208,7 @@ func recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Sockl } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall6(SYS_RECVFROM, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(flags), uintptr(unsafe.Pointer(from)), uintptr(unsafe.Pointer(fromlen))) + r0, _, e1 := syscall_syscall6(libc_recvfrom_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(flags), uintptr(unsafe.Pointer(from)), uintptr(unsafe.Pointer(fromlen))) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -164,6 +216,10 @@ func recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Sockl return } +var libc_recvfrom_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_recvfrom recvfrom "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) (err error) { @@ -173,17 +229,21 @@ func sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) ( } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall6(SYS_SENDTO, uintptr(s), uintptr(_p0), uintptr(len(buf)), uintptr(flags), uintptr(to), uintptr(addrlen)) + _, _, e1 := syscall_syscall6(libc_sendto_trampoline_addr, uintptr(s), uintptr(_p0), uintptr(len(buf)), uintptr(flags), uintptr(to), uintptr(addrlen)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_sendto_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sendto sendto "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func recvmsg(s int, msg *Msghdr, flags int) (n int, err error) { - r0, _, e1 := Syscall(SYS_RECVMSG, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) + r0, _, e1 := syscall_syscall(libc_recvmsg_trampoline_addr, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -191,10 +251,14 @@ func recvmsg(s int, msg *Msghdr, flags int) (n int, err error) { return } +var libc_recvmsg_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_recvmsg recvmsg "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) { - r0, _, e1 := Syscall(SYS_SENDMSG, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) + r0, _, e1 := syscall_syscall(libc_sendmsg_trampoline_addr, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -202,10 +266,14 @@ func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) { return } +var libc_sendmsg_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sendmsg sendmsg "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func kevent(kq int, change unsafe.Pointer, nchange int, event unsafe.Pointer, nevent int, timeout *Timespec) (n int, err error) { - r0, _, e1 := Syscall6(SYS_KEVENT, uintptr(kq), uintptr(change), uintptr(nchange), uintptr(event), uintptr(nevent), uintptr(unsafe.Pointer(timeout))) + r0, _, e1 := syscall_syscall6(libc_kevent_trampoline_addr, uintptr(kq), uintptr(change), uintptr(nchange), uintptr(event), uintptr(nevent), uintptr(unsafe.Pointer(timeout))) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -213,6 +281,10 @@ func kevent(kq int, change unsafe.Pointer, nchange int, event unsafe.Pointer, ne return } +var libc_kevent_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_kevent kevent "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func utimes(path string, timeval *[2]Timeval) (err error) { @@ -221,27 +293,35 @@ func utimes(path string, timeval *[2]Timeval) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_UTIMES, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(timeval)), 0) + _, _, e1 := syscall_syscall(libc_utimes_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(timeval)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_utimes_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_utimes utimes "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func futimes(fd int, timeval *[2]Timeval) (err error) { - _, _, e1 := Syscall(SYS_FUTIMES, uintptr(fd), uintptr(unsafe.Pointer(timeval)), 0) + _, _, e1 := syscall_syscall(libc_futimes_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(timeval)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_futimes_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_futimes futimes "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func poll(fds *PollFd, nfds int, timeout int) (n int, err error) { - r0, _, e1 := Syscall(SYS_POLL, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(timeout)) + r0, _, e1 := syscall_syscall(libc_poll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(timeout)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -249,6 +329,10 @@ func poll(fds *PollFd, nfds int, timeout int) (n int, err error) { return } +var libc_poll_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_poll poll "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Madvise(b []byte, behav int) (err error) { @@ -258,13 +342,17 @@ func Madvise(b []byte, behav int) (err error) { } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall(SYS_MADVISE, uintptr(_p0), uintptr(len(b)), uintptr(behav)) + _, _, e1 := syscall_syscall(libc_madvise_trampoline_addr, uintptr(_p0), uintptr(len(b)), uintptr(behav)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_madvise_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_madvise madvise "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mlock(b []byte) (err error) { @@ -274,23 +362,31 @@ func Mlock(b []byte) (err error) { } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall(SYS_MLOCK, uintptr(_p0), uintptr(len(b)), 0) + _, _, e1 := syscall_syscall(libc_mlock_trampoline_addr, uintptr(_p0), uintptr(len(b)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mlock_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mlock mlock "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mlockall(flags int) (err error) { - _, _, e1 := Syscall(SYS_MLOCKALL, uintptr(flags), 0, 0) + _, _, e1 := syscall_syscall(libc_mlockall_trampoline_addr, uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mlockall_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mlockall mlockall "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mprotect(b []byte, prot int) (err error) { @@ -300,13 +396,17 @@ func Mprotect(b []byte, prot int) (err error) { } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall(SYS_MPROTECT, uintptr(_p0), uintptr(len(b)), uintptr(prot)) + _, _, e1 := syscall_syscall(libc_mprotect_trampoline_addr, uintptr(_p0), uintptr(len(b)), uintptr(prot)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mprotect_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mprotect mprotect "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Msync(b []byte, flags int) (err error) { @@ -316,13 +416,17 @@ func Msync(b []byte, flags int) (err error) { } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall(SYS_MSYNC, uintptr(_p0), uintptr(len(b)), uintptr(flags)) + _, _, e1 := syscall_syscall(libc_msync_trampoline_addr, uintptr(_p0), uintptr(len(b)), uintptr(flags)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_msync_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_msync msync "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Munlock(b []byte) (err error) { @@ -332,33 +436,45 @@ func Munlock(b []byte) (err error) { } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall(SYS_MUNLOCK, uintptr(_p0), uintptr(len(b)), 0) + _, _, e1 := syscall_syscall(libc_munlock_trampoline_addr, uintptr(_p0), uintptr(len(b)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_munlock_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_munlock munlock "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Munlockall() (err error) { - _, _, e1 := Syscall(SYS_MUNLOCKALL, 0, 0, 0) + _, _, e1 := syscall_syscall(libc_munlockall_trampoline_addr, 0, 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_munlockall_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_munlockall munlockall "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func pipe2(p *[2]_C_int, flags int) (err error) { - _, _, e1 := RawSyscall(SYS_PIPE2, uintptr(unsafe.Pointer(p)), uintptr(flags), 0) + _, _, e1 := syscall_rawSyscall(libc_pipe2_trampoline_addr, uintptr(unsafe.Pointer(p)), uintptr(flags), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_pipe2_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pipe2 pipe2 "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getdents(fd int, buf []byte) (n int, err error) { @@ -368,7 +484,7 @@ func Getdents(fd int, buf []byte) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall(SYS_GETDENTS, uintptr(fd), uintptr(_p0), uintptr(len(buf))) + r0, _, e1 := syscall_syscall(libc_getdents_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(buf))) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -376,6 +492,10 @@ func Getdents(fd int, buf []byte) (n int, err error) { return } +var libc_getdents_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getdents getdents "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getcwd(buf []byte) (n int, err error) { @@ -385,7 +505,7 @@ func Getcwd(buf []byte) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall(SYS___GETCWD, uintptr(_p0), uintptr(len(buf)), 0) + r0, _, e1 := syscall_syscall(libc_getcwd_trampoline_addr, uintptr(_p0), uintptr(len(buf)), 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -393,16 +513,54 @@ func Getcwd(buf []byte) (n int, err error) { return } +var libc_getcwd_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getcwd getcwd "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func ioctl(fd int, req uint, arg uintptr) (err error) { - _, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg)) + _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { + _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -412,17 +570,21 @@ func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall6(SYS___SYSCTL, uintptr(_p0), uintptr(len(mib)), uintptr(unsafe.Pointer(old)), uintptr(unsafe.Pointer(oldlen)), uintptr(unsafe.Pointer(new)), uintptr(newlen)) + _, _, e1 := syscall_syscall6(libc_sysctl_trampoline_addr, uintptr(_p0), uintptr(len(mib)), uintptr(unsafe.Pointer(old)), uintptr(unsafe.Pointer(oldlen)), uintptr(unsafe.Pointer(new)), uintptr(newlen)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_sysctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sysctl sysctl "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { - r0, _, e1 := Syscall6(SYS_PPOLL, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) + r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -430,6 +592,10 @@ func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, return } +var libc_ppoll_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ppoll ppoll "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Access(path string, mode uint32) (err error) { @@ -438,23 +604,31 @@ func Access(path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_ACCESS, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + _, _, e1 := syscall_syscall(libc_access_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_access_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_access access "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Adjtime(delta *Timeval, olddelta *Timeval) (err error) { - _, _, e1 := Syscall(SYS_ADJTIME, uintptr(unsafe.Pointer(delta)), uintptr(unsafe.Pointer(olddelta)), 0) + _, _, e1 := syscall_syscall(libc_adjtime_trampoline_addr, uintptr(unsafe.Pointer(delta)), uintptr(unsafe.Pointer(olddelta)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_adjtime_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_adjtime adjtime "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Chdir(path string) (err error) { @@ -463,13 +637,17 @@ func Chdir(path string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_CHDIR, uintptr(unsafe.Pointer(_p0)), 0, 0) + _, _, e1 := syscall_syscall(libc_chdir_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_chdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chdir chdir "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Chflags(path string, flags int) (err error) { @@ -478,13 +656,17 @@ func Chflags(path string, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_CHFLAGS, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) + _, _, e1 := syscall_syscall(libc_chflags_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_chflags_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chflags chflags "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Chmod(path string, mode uint32) (err error) { @@ -493,13 +675,17 @@ func Chmod(path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_CHMOD, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + _, _, e1 := syscall_syscall(libc_chmod_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_chmod_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chmod chmod "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Chown(path string, uid int, gid int) (err error) { @@ -508,13 +694,17 @@ func Chown(path string, uid int, gid int) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_CHOWN, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) + _, _, e1 := syscall_syscall(libc_chown_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_chown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chown chown "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Chroot(path string) (err error) { @@ -523,27 +713,49 @@ func Chroot(path string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_CHROOT, uintptr(unsafe.Pointer(_p0)), 0, 0) + _, _, e1 := syscall_syscall(libc_chroot_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_chroot_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chroot chroot "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ClockGettime(clockid int32, time *Timespec) (err error) { + _, _, e1 := syscall_syscall(libc_clock_gettime_trampoline_addr, uintptr(clockid), uintptr(unsafe.Pointer(time)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_clock_gettime_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_clock_gettime clock_gettime "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Close(fd int) (err error) { - _, _, e1 := Syscall(SYS_CLOSE, uintptr(fd), 0, 0) + _, _, e1 := syscall_syscall(libc_close_trampoline_addr, uintptr(fd), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_close_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_close close "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Dup(fd int) (nfd int, err error) { - r0, _, e1 := Syscall(SYS_DUP, uintptr(fd), 0, 0) + r0, _, e1 := syscall_syscall(libc_dup_trampoline_addr, uintptr(fd), 0, 0) nfd = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -551,33 +763,49 @@ func Dup(fd int) (nfd int, err error) { return } +var libc_dup_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_dup dup "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Dup2(from int, to int) (err error) { - _, _, e1 := Syscall(SYS_DUP2, uintptr(from), uintptr(to), 0) + _, _, e1 := syscall_syscall(libc_dup2_trampoline_addr, uintptr(from), uintptr(to), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_dup2_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_dup2 dup2 "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Dup3(from int, to int, flags int) (err error) { - _, _, e1 := Syscall(SYS_DUP3, uintptr(from), uintptr(to), uintptr(flags)) + _, _, e1 := syscall_syscall(libc_dup3_trampoline_addr, uintptr(from), uintptr(to), uintptr(flags)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_dup3_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_dup3 dup3 "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Exit(code int) { - Syscall(SYS_EXIT, uintptr(code), 0, 0) + syscall_syscall(libc_exit_trampoline_addr, uintptr(code), 0, 0) return } +var libc_exit_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_exit exit "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) { @@ -586,43 +814,59 @@ func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_FACCESSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) + _, _, e1 := syscall_syscall6(libc_faccessat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_faccessat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_faccessat faccessat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fchdir(fd int) (err error) { - _, _, e1 := Syscall(SYS_FCHDIR, uintptr(fd), 0, 0) + _, _, e1 := syscall_syscall(libc_fchdir_trampoline_addr, uintptr(fd), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fchdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchdir fchdir "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fchflags(fd int, flags int) (err error) { - _, _, e1 := Syscall(SYS_FCHFLAGS, uintptr(fd), uintptr(flags), 0) + _, _, e1 := syscall_syscall(libc_fchflags_trampoline_addr, uintptr(fd), uintptr(flags), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fchflags_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchflags fchflags "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fchmod(fd int, mode uint32) (err error) { - _, _, e1 := Syscall(SYS_FCHMOD, uintptr(fd), uintptr(mode), 0) + _, _, e1 := syscall_syscall(libc_fchmod_trampoline_addr, uintptr(fd), uintptr(mode), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fchmod_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchmod fchmod "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) { @@ -631,23 +875,31 @@ func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_FCHMODAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) + _, _, e1 := syscall_syscall6(libc_fchmodat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fchmodat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchmodat fchmodat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fchown(fd int, uid int, gid int) (err error) { - _, _, e1 := Syscall(SYS_FCHOWN, uintptr(fd), uintptr(uid), uintptr(gid)) + _, _, e1 := syscall_syscall(libc_fchown_trampoline_addr, uintptr(fd), uintptr(uid), uintptr(gid)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fchown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchown fchown "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fchownat(dirfd int, path string, uid int, gid int, flags int) (err error) { @@ -656,27 +908,35 @@ func Fchownat(dirfd int, path string, uid int, gid int, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_FCHOWNAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), uintptr(flags), 0) + _, _, e1 := syscall_syscall6(libc_fchownat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), uintptr(flags), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fchownat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchownat fchownat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Flock(fd int, how int) (err error) { - _, _, e1 := Syscall(SYS_FLOCK, uintptr(fd), uintptr(how), 0) + _, _, e1 := syscall_syscall(libc_flock_trampoline_addr, uintptr(fd), uintptr(how), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_flock_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_flock flock "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fpathconf(fd int, name int) (val int, err error) { - r0, _, e1 := Syscall(SYS_FPATHCONF, uintptr(fd), uintptr(name), 0) + r0, _, e1 := syscall_syscall(libc_fpathconf_trampoline_addr, uintptr(fd), uintptr(name), 0) val = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -684,16 +944,24 @@ func Fpathconf(fd int, name int) (val int, err error) { return } +var libc_fpathconf_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fpathconf fpathconf "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fstat(fd int, stat *Stat_t) (err error) { - _, _, e1 := Syscall(SYS_FSTAT, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) + _, _, e1 := syscall_syscall(libc_fstat_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fstat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fstat fstat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) { @@ -702,71 +970,99 @@ func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_FSTATAT, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), uintptr(flags), 0, 0) + _, _, e1 := syscall_syscall6(libc_fstatat_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fstatat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fstatat fstatat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fstatfs(fd int, stat *Statfs_t) (err error) { - _, _, e1 := Syscall(SYS_FSTATFS, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) + _, _, e1 := syscall_syscall(libc_fstatfs_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fstatfs_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fstatfs fstatfs "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fsync(fd int) (err error) { - _, _, e1 := Syscall(SYS_FSYNC, uintptr(fd), 0, 0) + _, _, e1 := syscall_syscall(libc_fsync_trampoline_addr, uintptr(fd), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fsync_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fsync fsync "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Ftruncate(fd int, length int64) (err error) { - _, _, e1 := Syscall6(SYS_FTRUNCATE, uintptr(fd), 0, uintptr(length), uintptr(length>>32), 0, 0) + _, _, e1 := syscall_syscall6(libc_ftruncate_trampoline_addr, uintptr(fd), 0, uintptr(length), uintptr(length>>32), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_ftruncate_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ftruncate ftruncate "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getegid() (egid int) { - r0, _, _ := RawSyscall(SYS_GETEGID, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_getegid_trampoline_addr, 0, 0, 0) egid = int(r0) return } +var libc_getegid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getegid getegid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Geteuid() (uid int) { - r0, _, _ := RawSyscall(SYS_GETEUID, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_geteuid_trampoline_addr, 0, 0, 0) uid = int(r0) return } +var libc_geteuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_geteuid geteuid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getgid() (gid int) { - r0, _, _ := RawSyscall(SYS_GETGID, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_getgid_trampoline_addr, 0, 0, 0) gid = int(r0) return } +var libc_getgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getgid getgid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getpgid(pid int) (pgid int, err error) { - r0, _, e1 := RawSyscall(SYS_GETPGID, uintptr(pid), 0, 0) + r0, _, e1 := syscall_rawSyscall(libc_getpgid_trampoline_addr, uintptr(pid), 0, 0) pgid = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -774,34 +1070,50 @@ func Getpgid(pid int) (pgid int, err error) { return } +var libc_getpgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpgid getpgid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getpgrp() (pgrp int) { - r0, _, _ := RawSyscall(SYS_GETPGRP, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_getpgrp_trampoline_addr, 0, 0, 0) pgrp = int(r0) return } +var libc_getpgrp_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpgrp getpgrp "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getpid() (pid int) { - r0, _, _ := RawSyscall(SYS_GETPID, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_getpid_trampoline_addr, 0, 0, 0) pid = int(r0) return } +var libc_getpid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpid getpid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getppid() (ppid int) { - r0, _, _ := RawSyscall(SYS_GETPPID, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_getppid_trampoline_addr, 0, 0, 0) ppid = int(r0) return } +var libc_getppid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getppid getppid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getpriority(which int, who int) (prio int, err error) { - r0, _, e1 := Syscall(SYS_GETPRIORITY, uintptr(which), uintptr(who), 0) + r0, _, e1 := syscall_syscall(libc_getpriority_trampoline_addr, uintptr(which), uintptr(who), 0) prio = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -809,20 +1121,28 @@ func Getpriority(which int, who int) (prio int, err error) { return } +var libc_getpriority_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpriority getpriority "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_GETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) + _, _, e1 := syscall_rawSyscall(libc_getrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_getrlimit_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getrlimit getrlimit "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getrtable() (rtable int, err error) { - r0, _, e1 := RawSyscall(SYS_GETRTABLE, 0, 0, 0) + r0, _, e1 := syscall_rawSyscall(libc_getrtable_trampoline_addr, 0, 0, 0) rtable = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -830,20 +1150,28 @@ func Getrtable() (rtable int, err error) { return } +var libc_getrtable_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getrtable getrtable "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getrusage(who int, rusage *Rusage) (err error) { - _, _, e1 := RawSyscall(SYS_GETRUSAGE, uintptr(who), uintptr(unsafe.Pointer(rusage)), 0) + _, _, e1 := syscall_rawSyscall(libc_getrusage_trampoline_addr, uintptr(who), uintptr(unsafe.Pointer(rusage)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_getrusage_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getrusage getrusage "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getsid(pid int) (sid int, err error) { - r0, _, e1 := RawSyscall(SYS_GETSID, uintptr(pid), 0, 0) + r0, _, e1 := syscall_rawSyscall(libc_getsid_trampoline_addr, uintptr(pid), 0, 0) sid = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -851,46 +1179,66 @@ func Getsid(pid int) (sid int, err error) { return } +var libc_getsid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getsid getsid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Gettimeofday(tv *Timeval) (err error) { - _, _, e1 := RawSyscall(SYS_GETTIMEOFDAY, uintptr(unsafe.Pointer(tv)), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_gettimeofday_trampoline_addr, uintptr(unsafe.Pointer(tv)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_gettimeofday_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_gettimeofday gettimeofday "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getuid() (uid int) { - r0, _, _ := RawSyscall(SYS_GETUID, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_getuid_trampoline_addr, 0, 0, 0) uid = int(r0) return } +var libc_getuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getuid getuid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Issetugid() (tainted bool) { - r0, _, _ := Syscall(SYS_ISSETUGID, 0, 0, 0) + r0, _, _ := syscall_syscall(libc_issetugid_trampoline_addr, 0, 0, 0) tainted = bool(r0 != 0) return } +var libc_issetugid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_issetugid issetugid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Kill(pid int, signum syscall.Signal) (err error) { - _, _, e1 := Syscall(SYS_KILL, uintptr(pid), uintptr(signum), 0) + _, _, e1 := syscall_syscall(libc_kill_trampoline_addr, uintptr(pid), uintptr(signum), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_kill_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_kill kill "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Kqueue() (fd int, err error) { - r0, _, e1 := Syscall(SYS_KQUEUE, 0, 0, 0) + r0, _, e1 := syscall_syscall(libc_kqueue_trampoline_addr, 0, 0, 0) fd = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -898,6 +1246,10 @@ func Kqueue() (fd int, err error) { return } +var libc_kqueue_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_kqueue kqueue "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Lchown(path string, uid int, gid int) (err error) { @@ -906,13 +1258,17 @@ func Lchown(path string, uid int, gid int) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_LCHOWN, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) + _, _, e1 := syscall_syscall(libc_lchown_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_lchown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_lchown lchown "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Link(path string, link string) (err error) { @@ -926,13 +1282,17 @@ func Link(path string, link string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_LINK, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) + _, _, e1 := syscall_syscall(libc_link_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_link_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_link link "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Linkat(pathfd int, path string, linkfd int, link string, flags int) (err error) { @@ -946,23 +1306,31 @@ func Linkat(pathfd int, path string, linkfd int, link string, flags int) (err er if err != nil { return } - _, _, e1 := Syscall6(SYS_LINKAT, uintptr(pathfd), uintptr(unsafe.Pointer(_p0)), uintptr(linkfd), uintptr(unsafe.Pointer(_p1)), uintptr(flags), 0) + _, _, e1 := syscall_syscall6(libc_linkat_trampoline_addr, uintptr(pathfd), uintptr(unsafe.Pointer(_p0)), uintptr(linkfd), uintptr(unsafe.Pointer(_p1)), uintptr(flags), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_linkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_linkat linkat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Listen(s int, backlog int) (err error) { - _, _, e1 := Syscall(SYS_LISTEN, uintptr(s), uintptr(backlog), 0) + _, _, e1 := syscall_syscall(libc_listen_trampoline_addr, uintptr(s), uintptr(backlog), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_listen_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_listen listen "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Lstat(path string, stat *Stat_t) (err error) { @@ -971,13 +1339,17 @@ func Lstat(path string, stat *Stat_t) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_LSTAT, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) + _, _, e1 := syscall_syscall(libc_lstat_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_lstat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_lstat lstat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mkdir(path string, mode uint32) (err error) { @@ -986,13 +1358,17 @@ func Mkdir(path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_MKDIR, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + _, _, e1 := syscall_syscall(libc_mkdir_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mkdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkdir mkdir "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mkdirat(dirfd int, path string, mode uint32) (err error) { @@ -1001,13 +1377,17 @@ func Mkdirat(dirfd int, path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_MKDIRAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) + _, _, e1 := syscall_syscall(libc_mkdirat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mkdirat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkdirat mkdirat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mkfifo(path string, mode uint32) (err error) { @@ -1016,13 +1396,17 @@ func Mkfifo(path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_MKFIFO, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + _, _, e1 := syscall_syscall(libc_mkfifo_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mkfifo_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkfifo mkfifo "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mkfifoat(dirfd int, path string, mode uint32) (err error) { @@ -1031,13 +1415,17 @@ func Mkfifoat(dirfd int, path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_MKFIFOAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) + _, _, e1 := syscall_syscall(libc_mkfifoat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mkfifoat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkfifoat mkfifoat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mknod(path string, mode uint32, dev int) (err error) { @@ -1046,13 +1434,17 @@ func Mknod(path string, mode uint32, dev int) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_MKNOD, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev)) + _, _, e1 := syscall_syscall(libc_mknod_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mknod_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mknod mknod "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mknodat(dirfd int, path string, mode uint32, dev int) (err error) { @@ -1061,23 +1453,31 @@ func Mknodat(dirfd int, path string, mode uint32, dev int) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_MKNODAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0) + _, _, e1 := syscall_syscall6(libc_mknodat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mknodat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mknodat mknodat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Nanosleep(time *Timespec, leftover *Timespec) (err error) { - _, _, e1 := Syscall(SYS_NANOSLEEP, uintptr(unsafe.Pointer(time)), uintptr(unsafe.Pointer(leftover)), 0) + _, _, e1 := syscall_syscall(libc_nanosleep_trampoline_addr, uintptr(unsafe.Pointer(time)), uintptr(unsafe.Pointer(leftover)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_nanosleep_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_nanosleep nanosleep "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Open(path string, mode int, perm uint32) (fd int, err error) { @@ -1086,7 +1486,7 @@ func Open(path string, mode int, perm uint32) (fd int, err error) { if err != nil { return } - r0, _, e1 := Syscall(SYS_OPEN, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm)) + r0, _, e1 := syscall_syscall(libc_open_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm)) fd = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1094,6 +1494,10 @@ func Open(path string, mode int, perm uint32) (fd int, err error) { return } +var libc_open_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_open open "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Openat(dirfd int, path string, mode int, perm uint32) (fd int, err error) { @@ -1102,7 +1506,7 @@ func Openat(dirfd int, path string, mode int, perm uint32) (fd int, err error) { if err != nil { return } - r0, _, e1 := Syscall6(SYS_OPENAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm), 0, 0) + r0, _, e1 := syscall_syscall6(libc_openat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm), 0, 0) fd = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1110,6 +1514,10 @@ func Openat(dirfd int, path string, mode int, perm uint32) (fd int, err error) { return } +var libc_openat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_openat openat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Pathconf(path string, name int) (val int, err error) { @@ -1118,7 +1526,7 @@ func Pathconf(path string, name int) (val int, err error) { if err != nil { return } - r0, _, e1 := Syscall(SYS_PATHCONF, uintptr(unsafe.Pointer(_p0)), uintptr(name), 0) + r0, _, e1 := syscall_syscall(libc_pathconf_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(name), 0) val = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1126,6 +1534,10 @@ func Pathconf(path string, name int) (val int, err error) { return } +var libc_pathconf_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pathconf pathconf "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func pread(fd int, p []byte, offset int64) (n int, err error) { @@ -1135,7 +1547,7 @@ func pread(fd int, p []byte, offset int64) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall6(SYS_PREAD, uintptr(fd), uintptr(_p0), uintptr(len(p)), 0, uintptr(offset), uintptr(offset>>32)) + r0, _, e1 := syscall_syscall6(libc_pread_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p)), 0, uintptr(offset), uintptr(offset>>32)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1143,6 +1555,10 @@ func pread(fd int, p []byte, offset int64) (n int, err error) { return } +var libc_pread_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pread pread "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func pwrite(fd int, p []byte, offset int64) (n int, err error) { @@ -1152,7 +1568,7 @@ func pwrite(fd int, p []byte, offset int64) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall6(SYS_PWRITE, uintptr(fd), uintptr(_p0), uintptr(len(p)), 0, uintptr(offset), uintptr(offset>>32)) + r0, _, e1 := syscall_syscall6(libc_pwrite_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p)), 0, uintptr(offset), uintptr(offset>>32)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1160,6 +1576,10 @@ func pwrite(fd int, p []byte, offset int64) (n int, err error) { return } +var libc_pwrite_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pwrite pwrite "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func read(fd int, p []byte) (n int, err error) { @@ -1169,7 +1589,7 @@ func read(fd int, p []byte) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(_p0), uintptr(len(p))) + r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p))) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1177,6 +1597,10 @@ func read(fd int, p []byte) (n int, err error) { return } +var libc_read_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_read read "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Readlink(path string, buf []byte) (n int, err error) { @@ -1191,7 +1615,7 @@ func Readlink(path string, buf []byte) (n int, err error) { } else { _p1 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall(SYS_READLINK, uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf))) + r0, _, e1 := syscall_syscall(libc_readlink_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf))) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1199,6 +1623,10 @@ func Readlink(path string, buf []byte) (n int, err error) { return } +var libc_readlink_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_readlink readlink "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Readlinkat(dirfd int, path string, buf []byte) (n int, err error) { @@ -1213,7 +1641,7 @@ func Readlinkat(dirfd int, path string, buf []byte) (n int, err error) { } else { _p1 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall6(SYS_READLINKAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf)), 0, 0) + r0, _, e1 := syscall_syscall6(libc_readlinkat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf)), 0, 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1221,6 +1649,10 @@ func Readlinkat(dirfd int, path string, buf []byte) (n int, err error) { return } +var libc_readlinkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_readlinkat readlinkat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Rename(from string, to string) (err error) { @@ -1234,13 +1666,17 @@ func Rename(from string, to string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_RENAME, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) + _, _, e1 := syscall_syscall(libc_rename_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_rename_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_rename rename "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Renameat(fromfd int, from string, tofd int, to string) (err error) { @@ -1254,13 +1690,17 @@ func Renameat(fromfd int, from string, tofd int, to string) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_RENAMEAT, uintptr(fromfd), uintptr(unsafe.Pointer(_p0)), uintptr(tofd), uintptr(unsafe.Pointer(_p1)), 0, 0) + _, _, e1 := syscall_syscall6(libc_renameat_trampoline_addr, uintptr(fromfd), uintptr(unsafe.Pointer(_p0)), uintptr(tofd), uintptr(unsafe.Pointer(_p1)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_renameat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_renameat renameat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Revoke(path string) (err error) { @@ -1269,13 +1709,17 @@ func Revoke(path string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_REVOKE, uintptr(unsafe.Pointer(_p0)), 0, 0) + _, _, e1 := syscall_syscall(libc_revoke_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_revoke_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_revoke revoke "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Rmdir(path string) (err error) { @@ -1284,17 +1728,21 @@ func Rmdir(path string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_RMDIR, uintptr(unsafe.Pointer(_p0)), 0, 0) + _, _, e1 := syscall_syscall(libc_rmdir_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_rmdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_rmdir rmdir "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Seek(fd int, offset int64, whence int) (newoffset int64, err error) { - r0, r1, e1 := Syscall6(SYS_LSEEK, uintptr(fd), 0, uintptr(offset), uintptr(offset>>32), uintptr(whence), 0) + r0, r1, e1 := syscall_syscall6(libc_lseek_trampoline_addr, uintptr(fd), 0, uintptr(offset), uintptr(offset>>32), uintptr(whence), 0) newoffset = int64(int64(r1)<<32 | int64(r0)) if e1 != 0 { err = errnoErr(e1) @@ -1302,10 +1750,14 @@ func Seek(fd int, offset int64, whence int) (newoffset int64, err error) { return } +var libc_lseek_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_lseek lseek "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err error) { - r0, _, e1 := Syscall6(SYS_SELECT, uintptr(nfd), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), 0) + r0, _, e1 := syscall_syscall6(libc_select_trampoline_addr, uintptr(nfd), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1313,36 +1765,52 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err return } +var libc_select_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_select select "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setegid(egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETEGID, uintptr(egid), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_setegid_trampoline_addr, uintptr(egid), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setegid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setegid setegid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Seteuid(euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETEUID, uintptr(euid), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_seteuid_trampoline_addr, uintptr(euid), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_seteuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_seteuid seteuid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setgid(gid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETGID, uintptr(gid), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_setgid_trampoline_addr, uintptr(gid), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setgid setgid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setlogin(name string) (err error) { @@ -1351,97 +1819,119 @@ func Setlogin(name string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_SETLOGIN, uintptr(unsafe.Pointer(_p0)), 0, 0) + _, _, e1 := syscall_syscall(libc_setlogin_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setlogin_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setlogin setlogin "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setpgid(pid int, pgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETPGID, uintptr(pid), uintptr(pgid), 0) + _, _, e1 := syscall_rawSyscall(libc_setpgid_trampoline_addr, uintptr(pid), uintptr(pgid), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setpgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setpgid setpgid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setpriority(which int, who int, prio int) (err error) { - _, _, e1 := Syscall(SYS_SETPRIORITY, uintptr(which), uintptr(who), uintptr(prio)) + _, _, e1 := syscall_syscall(libc_setpriority_trampoline_addr, uintptr(which), uintptr(who), uintptr(prio)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setpriority_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setpriority setpriority "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) + _, _, e1 := syscall_rawSyscall(libc_setregid_trampoline_addr, uintptr(rgid), uintptr(egid), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setregid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setregid setregid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) + _, _, e1 := syscall_rawSyscall(libc_setreuid_trampoline_addr, uintptr(ruid), uintptr(euid), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setreuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setreuid setreuid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) + _, _, e1 := syscall_rawSyscall(libc_setresgid_trampoline_addr, uintptr(rgid), uintptr(egid), uintptr(sgid)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setresgid setresgid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) + _, _, e1 := syscall_rawSyscall(libc_setresuid_trampoline_addr, uintptr(ruid), uintptr(euid), uintptr(suid)) if e1 != 0 { err = errnoErr(e1) } return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +var libc_setresuid_trampoline_addr uintptr -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} +//go:cgo_import_dynamic libc_setresuid setresuid "libc.so" // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setrtable(rtable int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRTABLE, uintptr(rtable), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setrtable_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setrtable setrtable "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setsid() (pid int, err error) { - r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) + r0, _, e1 := syscall_rawSyscall(libc_setsid_trampoline_addr, 0, 0, 0) pid = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1449,26 +1939,38 @@ func Setsid() (pid int, err error) { return } +var libc_setsid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setsid setsid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Settimeofday(tp *Timeval) (err error) { - _, _, e1 := RawSyscall(SYS_SETTIMEOFDAY, uintptr(unsafe.Pointer(tp)), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_settimeofday_trampoline_addr, uintptr(unsafe.Pointer(tp)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_settimeofday_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_settimeofday settimeofday "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setuid(uid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETUID, uintptr(uid), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_setuid_trampoline_addr, uintptr(uid), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setuid setuid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Stat(path string, stat *Stat_t) (err error) { @@ -1477,13 +1979,17 @@ func Stat(path string, stat *Stat_t) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_STAT, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) + _, _, e1 := syscall_syscall(libc_stat_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_stat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_stat stat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Statfs(path string, stat *Statfs_t) (err error) { @@ -1492,13 +1998,17 @@ func Statfs(path string, stat *Statfs_t) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_STATFS, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) + _, _, e1 := syscall_syscall(libc_statfs_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_statfs_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_statfs statfs "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Symlink(path string, link string) (err error) { @@ -1512,13 +2022,17 @@ func Symlink(path string, link string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_SYMLINK, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) + _, _, e1 := syscall_syscall(libc_symlink_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_symlink_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_symlink symlink "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Symlinkat(oldpath string, newdirfd int, newpath string) (err error) { @@ -1532,23 +2046,31 @@ func Symlinkat(oldpath string, newdirfd int, newpath string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_SYMLINKAT, uintptr(unsafe.Pointer(_p0)), uintptr(newdirfd), uintptr(unsafe.Pointer(_p1))) + _, _, e1 := syscall_syscall(libc_symlinkat_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(newdirfd), uintptr(unsafe.Pointer(_p1))) if e1 != 0 { err = errnoErr(e1) } return } +var libc_symlinkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_symlinkat symlinkat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Sync() (err error) { - _, _, e1 := Syscall(SYS_SYNC, 0, 0, 0) + _, _, e1 := syscall_syscall(libc_sync_trampoline_addr, 0, 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_sync_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sync sync "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Truncate(path string, length int64) (err error) { @@ -1557,21 +2079,29 @@ func Truncate(path string, length int64) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_TRUNCATE, uintptr(unsafe.Pointer(_p0)), 0, uintptr(length), uintptr(length>>32), 0, 0) + _, _, e1 := syscall_syscall6(libc_truncate_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, uintptr(length), uintptr(length>>32), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_truncate_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_truncate truncate "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Umask(newmask int) (oldmask int) { - r0, _, _ := Syscall(SYS_UMASK, uintptr(newmask), 0, 0) + r0, _, _ := syscall_syscall(libc_umask_trampoline_addr, uintptr(newmask), 0, 0) oldmask = int(r0) return } +var libc_umask_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_umask umask "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Unlink(path string) (err error) { @@ -1580,13 +2110,17 @@ func Unlink(path string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_UNLINK, uintptr(unsafe.Pointer(_p0)), 0, 0) + _, _, e1 := syscall_syscall(libc_unlink_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_unlink_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unlink unlink "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Unlinkat(dirfd int, path string, flags int) (err error) { @@ -1595,13 +2129,17 @@ func Unlinkat(dirfd int, path string, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_UNLINKAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(flags)) + _, _, e1 := syscall_syscall(libc_unlinkat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(flags)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_unlinkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unlinkat unlinkat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Unmount(path string, flags int) (err error) { @@ -1610,13 +2148,17 @@ func Unmount(path string, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_UNMOUNT, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) + _, _, e1 := syscall_syscall(libc_unmount_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_unmount_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unmount unmount "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func write(fd int, p []byte) (n int, err error) { @@ -1626,7 +2168,7 @@ func write(fd int, p []byte) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(_p0), uintptr(len(p))) + r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p))) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1634,10 +2176,14 @@ func write(fd int, p []byte) (n int, err error) { return } +var libc_write_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_write write "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) { - r0, _, e1 := Syscall9(SYS_MMAP, uintptr(addr), uintptr(length), uintptr(prot), uintptr(flag), uintptr(fd), 0, uintptr(pos), uintptr(pos>>32), 0) + r0, _, e1 := syscall_syscall9(libc_mmap_trampoline_addr, uintptr(addr), uintptr(length), uintptr(prot), uintptr(flag), uintptr(fd), 0, uintptr(pos), uintptr(pos>>32), 0) ret = uintptr(r0) if e1 != 0 { err = errnoErr(e1) @@ -1645,20 +2191,28 @@ func mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) ( return } +var libc_mmap_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mmap mmap "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func munmap(addr uintptr, length uintptr) (err error) { - _, _, e1 := Syscall(SYS_MUNMAP, uintptr(addr), uintptr(length), 0) + _, _, e1 := syscall_syscall(libc_munmap_trampoline_addr, uintptr(addr), uintptr(length), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_munmap_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_munmap munmap "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) + r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1669,7 +2223,7 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) + r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1685,9 +2239,13 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error if err != nil { return } - _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) + _, _, e1 := syscall_syscall6(libc_utimensat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } + +var libc_utimensat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_utimensat utimensat "libc.so" diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s new file mode 100644 index 0000000..c922314 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s @@ -0,0 +1,674 @@ +// go run mkasm.go openbsd arm +// Code generated by the command above; DO NOT EDIT. + +#include "textflag.h" + +TEXT libc_getgroups_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getgroups(SB) +GLOBL ·libc_getgroups_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getgroups_trampoline_addr(SB)/4, $libc_getgroups_trampoline<>(SB) + +TEXT libc_setgroups_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setgroups(SB) +GLOBL ·libc_setgroups_trampoline_addr(SB), RODATA, $4 +DATA ·libc_setgroups_trampoline_addr(SB)/4, $libc_setgroups_trampoline<>(SB) + +TEXT libc_wait4_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_wait4(SB) +GLOBL ·libc_wait4_trampoline_addr(SB), RODATA, $4 +DATA ·libc_wait4_trampoline_addr(SB)/4, $libc_wait4_trampoline<>(SB) + +TEXT libc_accept_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_accept(SB) +GLOBL ·libc_accept_trampoline_addr(SB), RODATA, $4 +DATA ·libc_accept_trampoline_addr(SB)/4, $libc_accept_trampoline<>(SB) + +TEXT libc_bind_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_bind(SB) +GLOBL ·libc_bind_trampoline_addr(SB), RODATA, $4 +DATA ·libc_bind_trampoline_addr(SB)/4, $libc_bind_trampoline<>(SB) + +TEXT libc_connect_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_connect(SB) +GLOBL ·libc_connect_trampoline_addr(SB), RODATA, $4 +DATA ·libc_connect_trampoline_addr(SB)/4, $libc_connect_trampoline<>(SB) + +TEXT libc_socket_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_socket(SB) +GLOBL ·libc_socket_trampoline_addr(SB), RODATA, $4 +DATA ·libc_socket_trampoline_addr(SB)/4, $libc_socket_trampoline<>(SB) + +TEXT libc_getsockopt_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getsockopt(SB) +GLOBL ·libc_getsockopt_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getsockopt_trampoline_addr(SB)/4, $libc_getsockopt_trampoline<>(SB) + +TEXT libc_setsockopt_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setsockopt(SB) +GLOBL ·libc_setsockopt_trampoline_addr(SB), RODATA, $4 +DATA ·libc_setsockopt_trampoline_addr(SB)/4, $libc_setsockopt_trampoline<>(SB) + +TEXT libc_getpeername_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpeername(SB) +GLOBL ·libc_getpeername_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getpeername_trampoline_addr(SB)/4, $libc_getpeername_trampoline<>(SB) + +TEXT libc_getsockname_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getsockname(SB) +GLOBL ·libc_getsockname_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getsockname_trampoline_addr(SB)/4, $libc_getsockname_trampoline<>(SB) + +TEXT libc_shutdown_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_shutdown(SB) +GLOBL ·libc_shutdown_trampoline_addr(SB), RODATA, $4 +DATA ·libc_shutdown_trampoline_addr(SB)/4, $libc_shutdown_trampoline<>(SB) + +TEXT libc_socketpair_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_socketpair(SB) +GLOBL ·libc_socketpair_trampoline_addr(SB), RODATA, $4 +DATA ·libc_socketpair_trampoline_addr(SB)/4, $libc_socketpair_trampoline<>(SB) + +TEXT libc_recvfrom_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_recvfrom(SB) +GLOBL ·libc_recvfrom_trampoline_addr(SB), RODATA, $4 +DATA ·libc_recvfrom_trampoline_addr(SB)/4, $libc_recvfrom_trampoline<>(SB) + +TEXT libc_sendto_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sendto(SB) +GLOBL ·libc_sendto_trampoline_addr(SB), RODATA, $4 +DATA ·libc_sendto_trampoline_addr(SB)/4, $libc_sendto_trampoline<>(SB) + +TEXT libc_recvmsg_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_recvmsg(SB) +GLOBL ·libc_recvmsg_trampoline_addr(SB), RODATA, $4 +DATA ·libc_recvmsg_trampoline_addr(SB)/4, $libc_recvmsg_trampoline<>(SB) + +TEXT libc_sendmsg_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sendmsg(SB) +GLOBL ·libc_sendmsg_trampoline_addr(SB), RODATA, $4 +DATA ·libc_sendmsg_trampoline_addr(SB)/4, $libc_sendmsg_trampoline<>(SB) + +TEXT libc_kevent_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_kevent(SB) +GLOBL ·libc_kevent_trampoline_addr(SB), RODATA, $4 +DATA ·libc_kevent_trampoline_addr(SB)/4, $libc_kevent_trampoline<>(SB) + +TEXT libc_utimes_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_utimes(SB) +GLOBL ·libc_utimes_trampoline_addr(SB), RODATA, $4 +DATA ·libc_utimes_trampoline_addr(SB)/4, $libc_utimes_trampoline<>(SB) + +TEXT libc_futimes_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_futimes(SB) +GLOBL ·libc_futimes_trampoline_addr(SB), RODATA, $4 +DATA ·libc_futimes_trampoline_addr(SB)/4, $libc_futimes_trampoline<>(SB) + +TEXT libc_poll_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_poll(SB) +GLOBL ·libc_poll_trampoline_addr(SB), RODATA, $4 +DATA ·libc_poll_trampoline_addr(SB)/4, $libc_poll_trampoline<>(SB) + +TEXT libc_madvise_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_madvise(SB) +GLOBL ·libc_madvise_trampoline_addr(SB), RODATA, $4 +DATA ·libc_madvise_trampoline_addr(SB)/4, $libc_madvise_trampoline<>(SB) + +TEXT libc_mlock_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mlock(SB) +GLOBL ·libc_mlock_trampoline_addr(SB), RODATA, $4 +DATA ·libc_mlock_trampoline_addr(SB)/4, $libc_mlock_trampoline<>(SB) + +TEXT libc_mlockall_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mlockall(SB) +GLOBL ·libc_mlockall_trampoline_addr(SB), RODATA, $4 +DATA ·libc_mlockall_trampoline_addr(SB)/4, $libc_mlockall_trampoline<>(SB) + +TEXT libc_mprotect_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mprotect(SB) +GLOBL ·libc_mprotect_trampoline_addr(SB), RODATA, $4 +DATA ·libc_mprotect_trampoline_addr(SB)/4, $libc_mprotect_trampoline<>(SB) + +TEXT libc_msync_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_msync(SB) +GLOBL ·libc_msync_trampoline_addr(SB), RODATA, $4 +DATA ·libc_msync_trampoline_addr(SB)/4, $libc_msync_trampoline<>(SB) + +TEXT libc_munlock_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_munlock(SB) +GLOBL ·libc_munlock_trampoline_addr(SB), RODATA, $4 +DATA ·libc_munlock_trampoline_addr(SB)/4, $libc_munlock_trampoline<>(SB) + +TEXT libc_munlockall_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_munlockall(SB) +GLOBL ·libc_munlockall_trampoline_addr(SB), RODATA, $4 +DATA ·libc_munlockall_trampoline_addr(SB)/4, $libc_munlockall_trampoline<>(SB) + +TEXT libc_pipe2_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pipe2(SB) +GLOBL ·libc_pipe2_trampoline_addr(SB), RODATA, $4 +DATA ·libc_pipe2_trampoline_addr(SB)/4, $libc_pipe2_trampoline<>(SB) + +TEXT libc_getdents_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getdents(SB) +GLOBL ·libc_getdents_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getdents_trampoline_addr(SB)/4, $libc_getdents_trampoline<>(SB) + +TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getcwd(SB) +GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getcwd_trampoline_addr(SB)/4, $libc_getcwd_trampoline<>(SB) + +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresuid_trampoline_addr(SB)/4, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresgid_trampoline_addr(SB)/4, $libc_getresgid_trampoline<>(SB) + +TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_ioctl(SB) +GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $4 +DATA ·libc_ioctl_trampoline_addr(SB)/4, $libc_ioctl_trampoline<>(SB) + +TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sysctl(SB) +GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $4 +DATA ·libc_sysctl_trampoline_addr(SB)/4, $libc_sysctl_trampoline<>(SB) + +TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_ppoll(SB) +GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $4 +DATA ·libc_ppoll_trampoline_addr(SB)/4, $libc_ppoll_trampoline<>(SB) + +TEXT libc_access_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_access(SB) +GLOBL ·libc_access_trampoline_addr(SB), RODATA, $4 +DATA ·libc_access_trampoline_addr(SB)/4, $libc_access_trampoline<>(SB) + +TEXT libc_adjtime_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_adjtime(SB) +GLOBL ·libc_adjtime_trampoline_addr(SB), RODATA, $4 +DATA ·libc_adjtime_trampoline_addr(SB)/4, $libc_adjtime_trampoline<>(SB) + +TEXT libc_chdir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chdir(SB) +GLOBL ·libc_chdir_trampoline_addr(SB), RODATA, $4 +DATA ·libc_chdir_trampoline_addr(SB)/4, $libc_chdir_trampoline<>(SB) + +TEXT libc_chflags_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chflags(SB) +GLOBL ·libc_chflags_trampoline_addr(SB), RODATA, $4 +DATA ·libc_chflags_trampoline_addr(SB)/4, $libc_chflags_trampoline<>(SB) + +TEXT libc_chmod_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chmod(SB) +GLOBL ·libc_chmod_trampoline_addr(SB), RODATA, $4 +DATA ·libc_chmod_trampoline_addr(SB)/4, $libc_chmod_trampoline<>(SB) + +TEXT libc_chown_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chown(SB) +GLOBL ·libc_chown_trampoline_addr(SB), RODATA, $4 +DATA ·libc_chown_trampoline_addr(SB)/4, $libc_chown_trampoline<>(SB) + +TEXT libc_chroot_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chroot(SB) +GLOBL ·libc_chroot_trampoline_addr(SB), RODATA, $4 +DATA ·libc_chroot_trampoline_addr(SB)/4, $libc_chroot_trampoline<>(SB) + +TEXT libc_clock_gettime_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_clock_gettime(SB) +GLOBL ·libc_clock_gettime_trampoline_addr(SB), RODATA, $4 +DATA ·libc_clock_gettime_trampoline_addr(SB)/4, $libc_clock_gettime_trampoline<>(SB) + +TEXT libc_close_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_close(SB) +GLOBL ·libc_close_trampoline_addr(SB), RODATA, $4 +DATA ·libc_close_trampoline_addr(SB)/4, $libc_close_trampoline<>(SB) + +TEXT libc_dup_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_dup(SB) +GLOBL ·libc_dup_trampoline_addr(SB), RODATA, $4 +DATA ·libc_dup_trampoline_addr(SB)/4, $libc_dup_trampoline<>(SB) + +TEXT libc_dup2_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_dup2(SB) +GLOBL ·libc_dup2_trampoline_addr(SB), RODATA, $4 +DATA ·libc_dup2_trampoline_addr(SB)/4, $libc_dup2_trampoline<>(SB) + +TEXT libc_dup3_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_dup3(SB) +GLOBL ·libc_dup3_trampoline_addr(SB), RODATA, $4 +DATA ·libc_dup3_trampoline_addr(SB)/4, $libc_dup3_trampoline<>(SB) + +TEXT libc_exit_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_exit(SB) +GLOBL ·libc_exit_trampoline_addr(SB), RODATA, $4 +DATA ·libc_exit_trampoline_addr(SB)/4, $libc_exit_trampoline<>(SB) + +TEXT libc_faccessat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_faccessat(SB) +GLOBL ·libc_faccessat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_faccessat_trampoline_addr(SB)/4, $libc_faccessat_trampoline<>(SB) + +TEXT libc_fchdir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchdir(SB) +GLOBL ·libc_fchdir_trampoline_addr(SB), RODATA, $4 +DATA ·libc_fchdir_trampoline_addr(SB)/4, $libc_fchdir_trampoline<>(SB) + +TEXT libc_fchflags_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchflags(SB) +GLOBL ·libc_fchflags_trampoline_addr(SB), RODATA, $4 +DATA ·libc_fchflags_trampoline_addr(SB)/4, $libc_fchflags_trampoline<>(SB) + +TEXT libc_fchmod_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchmod(SB) +GLOBL ·libc_fchmod_trampoline_addr(SB), RODATA, $4 +DATA ·libc_fchmod_trampoline_addr(SB)/4, $libc_fchmod_trampoline<>(SB) + +TEXT libc_fchmodat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchmodat(SB) +GLOBL ·libc_fchmodat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_fchmodat_trampoline_addr(SB)/4, $libc_fchmodat_trampoline<>(SB) + +TEXT libc_fchown_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchown(SB) +GLOBL ·libc_fchown_trampoline_addr(SB), RODATA, $4 +DATA ·libc_fchown_trampoline_addr(SB)/4, $libc_fchown_trampoline<>(SB) + +TEXT libc_fchownat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchownat(SB) +GLOBL ·libc_fchownat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_fchownat_trampoline_addr(SB)/4, $libc_fchownat_trampoline<>(SB) + +TEXT libc_flock_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_flock(SB) +GLOBL ·libc_flock_trampoline_addr(SB), RODATA, $4 +DATA ·libc_flock_trampoline_addr(SB)/4, $libc_flock_trampoline<>(SB) + +TEXT libc_fpathconf_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fpathconf(SB) +GLOBL ·libc_fpathconf_trampoline_addr(SB), RODATA, $4 +DATA ·libc_fpathconf_trampoline_addr(SB)/4, $libc_fpathconf_trampoline<>(SB) + +TEXT libc_fstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fstat(SB) +GLOBL ·libc_fstat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_fstat_trampoline_addr(SB)/4, $libc_fstat_trampoline<>(SB) + +TEXT libc_fstatat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fstatat(SB) +GLOBL ·libc_fstatat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_fstatat_trampoline_addr(SB)/4, $libc_fstatat_trampoline<>(SB) + +TEXT libc_fstatfs_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fstatfs(SB) +GLOBL ·libc_fstatfs_trampoline_addr(SB), RODATA, $4 +DATA ·libc_fstatfs_trampoline_addr(SB)/4, $libc_fstatfs_trampoline<>(SB) + +TEXT libc_fsync_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fsync(SB) +GLOBL ·libc_fsync_trampoline_addr(SB), RODATA, $4 +DATA ·libc_fsync_trampoline_addr(SB)/4, $libc_fsync_trampoline<>(SB) + +TEXT libc_ftruncate_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_ftruncate(SB) +GLOBL ·libc_ftruncate_trampoline_addr(SB), RODATA, $4 +DATA ·libc_ftruncate_trampoline_addr(SB)/4, $libc_ftruncate_trampoline<>(SB) + +TEXT libc_getegid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getegid(SB) +GLOBL ·libc_getegid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getegid_trampoline_addr(SB)/4, $libc_getegid_trampoline<>(SB) + +TEXT libc_geteuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_geteuid(SB) +GLOBL ·libc_geteuid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_geteuid_trampoline_addr(SB)/4, $libc_geteuid_trampoline<>(SB) + +TEXT libc_getgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getgid(SB) +GLOBL ·libc_getgid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getgid_trampoline_addr(SB)/4, $libc_getgid_trampoline<>(SB) + +TEXT libc_getpgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpgid(SB) +GLOBL ·libc_getpgid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getpgid_trampoline_addr(SB)/4, $libc_getpgid_trampoline<>(SB) + +TEXT libc_getpgrp_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpgrp(SB) +GLOBL ·libc_getpgrp_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getpgrp_trampoline_addr(SB)/4, $libc_getpgrp_trampoline<>(SB) + +TEXT libc_getpid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpid(SB) +GLOBL ·libc_getpid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getpid_trampoline_addr(SB)/4, $libc_getpid_trampoline<>(SB) + +TEXT libc_getppid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getppid(SB) +GLOBL ·libc_getppid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getppid_trampoline_addr(SB)/4, $libc_getppid_trampoline<>(SB) + +TEXT libc_getpriority_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpriority(SB) +GLOBL ·libc_getpriority_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getpriority_trampoline_addr(SB)/4, $libc_getpriority_trampoline<>(SB) + +TEXT libc_getrlimit_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getrlimit(SB) +GLOBL ·libc_getrlimit_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getrlimit_trampoline_addr(SB)/4, $libc_getrlimit_trampoline<>(SB) + +TEXT libc_getrtable_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getrtable(SB) +GLOBL ·libc_getrtable_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getrtable_trampoline_addr(SB)/4, $libc_getrtable_trampoline<>(SB) + +TEXT libc_getrusage_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getrusage(SB) +GLOBL ·libc_getrusage_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getrusage_trampoline_addr(SB)/4, $libc_getrusage_trampoline<>(SB) + +TEXT libc_getsid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getsid(SB) +GLOBL ·libc_getsid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getsid_trampoline_addr(SB)/4, $libc_getsid_trampoline<>(SB) + +TEXT libc_gettimeofday_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_gettimeofday(SB) +GLOBL ·libc_gettimeofday_trampoline_addr(SB), RODATA, $4 +DATA ·libc_gettimeofday_trampoline_addr(SB)/4, $libc_gettimeofday_trampoline<>(SB) + +TEXT libc_getuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getuid(SB) +GLOBL ·libc_getuid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getuid_trampoline_addr(SB)/4, $libc_getuid_trampoline<>(SB) + +TEXT libc_issetugid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_issetugid(SB) +GLOBL ·libc_issetugid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_issetugid_trampoline_addr(SB)/4, $libc_issetugid_trampoline<>(SB) + +TEXT libc_kill_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_kill(SB) +GLOBL ·libc_kill_trampoline_addr(SB), RODATA, $4 +DATA ·libc_kill_trampoline_addr(SB)/4, $libc_kill_trampoline<>(SB) + +TEXT libc_kqueue_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_kqueue(SB) +GLOBL ·libc_kqueue_trampoline_addr(SB), RODATA, $4 +DATA ·libc_kqueue_trampoline_addr(SB)/4, $libc_kqueue_trampoline<>(SB) + +TEXT libc_lchown_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_lchown(SB) +GLOBL ·libc_lchown_trampoline_addr(SB), RODATA, $4 +DATA ·libc_lchown_trampoline_addr(SB)/4, $libc_lchown_trampoline<>(SB) + +TEXT libc_link_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_link(SB) +GLOBL ·libc_link_trampoline_addr(SB), RODATA, $4 +DATA ·libc_link_trampoline_addr(SB)/4, $libc_link_trampoline<>(SB) + +TEXT libc_linkat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_linkat(SB) +GLOBL ·libc_linkat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_linkat_trampoline_addr(SB)/4, $libc_linkat_trampoline<>(SB) + +TEXT libc_listen_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_listen(SB) +GLOBL ·libc_listen_trampoline_addr(SB), RODATA, $4 +DATA ·libc_listen_trampoline_addr(SB)/4, $libc_listen_trampoline<>(SB) + +TEXT libc_lstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_lstat(SB) +GLOBL ·libc_lstat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_lstat_trampoline_addr(SB)/4, $libc_lstat_trampoline<>(SB) + +TEXT libc_mkdir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mkdir(SB) +GLOBL ·libc_mkdir_trampoline_addr(SB), RODATA, $4 +DATA ·libc_mkdir_trampoline_addr(SB)/4, $libc_mkdir_trampoline<>(SB) + +TEXT libc_mkdirat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mkdirat(SB) +GLOBL ·libc_mkdirat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_mkdirat_trampoline_addr(SB)/4, $libc_mkdirat_trampoline<>(SB) + +TEXT libc_mkfifo_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mkfifo(SB) +GLOBL ·libc_mkfifo_trampoline_addr(SB), RODATA, $4 +DATA ·libc_mkfifo_trampoline_addr(SB)/4, $libc_mkfifo_trampoline<>(SB) + +TEXT libc_mkfifoat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mkfifoat(SB) +GLOBL ·libc_mkfifoat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_mkfifoat_trampoline_addr(SB)/4, $libc_mkfifoat_trampoline<>(SB) + +TEXT libc_mknod_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mknod(SB) +GLOBL ·libc_mknod_trampoline_addr(SB), RODATA, $4 +DATA ·libc_mknod_trampoline_addr(SB)/4, $libc_mknod_trampoline<>(SB) + +TEXT libc_mknodat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mknodat(SB) +GLOBL ·libc_mknodat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_mknodat_trampoline_addr(SB)/4, $libc_mknodat_trampoline<>(SB) + +TEXT libc_nanosleep_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_nanosleep(SB) +GLOBL ·libc_nanosleep_trampoline_addr(SB), RODATA, $4 +DATA ·libc_nanosleep_trampoline_addr(SB)/4, $libc_nanosleep_trampoline<>(SB) + +TEXT libc_open_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_open(SB) +GLOBL ·libc_open_trampoline_addr(SB), RODATA, $4 +DATA ·libc_open_trampoline_addr(SB)/4, $libc_open_trampoline<>(SB) + +TEXT libc_openat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_openat(SB) +GLOBL ·libc_openat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_openat_trampoline_addr(SB)/4, $libc_openat_trampoline<>(SB) + +TEXT libc_pathconf_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pathconf(SB) +GLOBL ·libc_pathconf_trampoline_addr(SB), RODATA, $4 +DATA ·libc_pathconf_trampoline_addr(SB)/4, $libc_pathconf_trampoline<>(SB) + +TEXT libc_pread_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pread(SB) +GLOBL ·libc_pread_trampoline_addr(SB), RODATA, $4 +DATA ·libc_pread_trampoline_addr(SB)/4, $libc_pread_trampoline<>(SB) + +TEXT libc_pwrite_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pwrite(SB) +GLOBL ·libc_pwrite_trampoline_addr(SB), RODATA, $4 +DATA ·libc_pwrite_trampoline_addr(SB)/4, $libc_pwrite_trampoline<>(SB) + +TEXT libc_read_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_read(SB) +GLOBL ·libc_read_trampoline_addr(SB), RODATA, $4 +DATA ·libc_read_trampoline_addr(SB)/4, $libc_read_trampoline<>(SB) + +TEXT libc_readlink_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_readlink(SB) +GLOBL ·libc_readlink_trampoline_addr(SB), RODATA, $4 +DATA ·libc_readlink_trampoline_addr(SB)/4, $libc_readlink_trampoline<>(SB) + +TEXT libc_readlinkat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_readlinkat(SB) +GLOBL ·libc_readlinkat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_readlinkat_trampoline_addr(SB)/4, $libc_readlinkat_trampoline<>(SB) + +TEXT libc_rename_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_rename(SB) +GLOBL ·libc_rename_trampoline_addr(SB), RODATA, $4 +DATA ·libc_rename_trampoline_addr(SB)/4, $libc_rename_trampoline<>(SB) + +TEXT libc_renameat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_renameat(SB) +GLOBL ·libc_renameat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_renameat_trampoline_addr(SB)/4, $libc_renameat_trampoline<>(SB) + +TEXT libc_revoke_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_revoke(SB) +GLOBL ·libc_revoke_trampoline_addr(SB), RODATA, $4 +DATA ·libc_revoke_trampoline_addr(SB)/4, $libc_revoke_trampoline<>(SB) + +TEXT libc_rmdir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_rmdir(SB) +GLOBL ·libc_rmdir_trampoline_addr(SB), RODATA, $4 +DATA ·libc_rmdir_trampoline_addr(SB)/4, $libc_rmdir_trampoline<>(SB) + +TEXT libc_lseek_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_lseek(SB) +GLOBL ·libc_lseek_trampoline_addr(SB), RODATA, $4 +DATA ·libc_lseek_trampoline_addr(SB)/4, $libc_lseek_trampoline<>(SB) + +TEXT libc_select_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_select(SB) +GLOBL ·libc_select_trampoline_addr(SB), RODATA, $4 +DATA ·libc_select_trampoline_addr(SB)/4, $libc_select_trampoline<>(SB) + +TEXT libc_setegid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setegid(SB) +GLOBL ·libc_setegid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_setegid_trampoline_addr(SB)/4, $libc_setegid_trampoline<>(SB) + +TEXT libc_seteuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_seteuid(SB) +GLOBL ·libc_seteuid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_seteuid_trampoline_addr(SB)/4, $libc_seteuid_trampoline<>(SB) + +TEXT libc_setgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setgid(SB) +GLOBL ·libc_setgid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_setgid_trampoline_addr(SB)/4, $libc_setgid_trampoline<>(SB) + +TEXT libc_setlogin_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setlogin(SB) +GLOBL ·libc_setlogin_trampoline_addr(SB), RODATA, $4 +DATA ·libc_setlogin_trampoline_addr(SB)/4, $libc_setlogin_trampoline<>(SB) + +TEXT libc_setpgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setpgid(SB) +GLOBL ·libc_setpgid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_setpgid_trampoline_addr(SB)/4, $libc_setpgid_trampoline<>(SB) + +TEXT libc_setpriority_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setpriority(SB) +GLOBL ·libc_setpriority_trampoline_addr(SB), RODATA, $4 +DATA ·libc_setpriority_trampoline_addr(SB)/4, $libc_setpriority_trampoline<>(SB) + +TEXT libc_setregid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setregid(SB) +GLOBL ·libc_setregid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_setregid_trampoline_addr(SB)/4, $libc_setregid_trampoline<>(SB) + +TEXT libc_setreuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setreuid(SB) +GLOBL ·libc_setreuid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_setreuid_trampoline_addr(SB)/4, $libc_setreuid_trampoline<>(SB) + +TEXT libc_setresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setresgid(SB) +GLOBL ·libc_setresgid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_setresgid_trampoline_addr(SB)/4, $libc_setresgid_trampoline<>(SB) + +TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setresuid(SB) +GLOBL ·libc_setresuid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_setresuid_trampoline_addr(SB)/4, $libc_setresuid_trampoline<>(SB) + +TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setrtable(SB) +GLOBL ·libc_setrtable_trampoline_addr(SB), RODATA, $4 +DATA ·libc_setrtable_trampoline_addr(SB)/4, $libc_setrtable_trampoline<>(SB) + +TEXT libc_setsid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setsid(SB) +GLOBL ·libc_setsid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_setsid_trampoline_addr(SB)/4, $libc_setsid_trampoline<>(SB) + +TEXT libc_settimeofday_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_settimeofday(SB) +GLOBL ·libc_settimeofday_trampoline_addr(SB), RODATA, $4 +DATA ·libc_settimeofday_trampoline_addr(SB)/4, $libc_settimeofday_trampoline<>(SB) + +TEXT libc_setuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setuid(SB) +GLOBL ·libc_setuid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_setuid_trampoline_addr(SB)/4, $libc_setuid_trampoline<>(SB) + +TEXT libc_stat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_stat(SB) +GLOBL ·libc_stat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_stat_trampoline_addr(SB)/4, $libc_stat_trampoline<>(SB) + +TEXT libc_statfs_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_statfs(SB) +GLOBL ·libc_statfs_trampoline_addr(SB), RODATA, $4 +DATA ·libc_statfs_trampoline_addr(SB)/4, $libc_statfs_trampoline<>(SB) + +TEXT libc_symlink_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_symlink(SB) +GLOBL ·libc_symlink_trampoline_addr(SB), RODATA, $4 +DATA ·libc_symlink_trampoline_addr(SB)/4, $libc_symlink_trampoline<>(SB) + +TEXT libc_symlinkat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_symlinkat(SB) +GLOBL ·libc_symlinkat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_symlinkat_trampoline_addr(SB)/4, $libc_symlinkat_trampoline<>(SB) + +TEXT libc_sync_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sync(SB) +GLOBL ·libc_sync_trampoline_addr(SB), RODATA, $4 +DATA ·libc_sync_trampoline_addr(SB)/4, $libc_sync_trampoline<>(SB) + +TEXT libc_truncate_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_truncate(SB) +GLOBL ·libc_truncate_trampoline_addr(SB), RODATA, $4 +DATA ·libc_truncate_trampoline_addr(SB)/4, $libc_truncate_trampoline<>(SB) + +TEXT libc_umask_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_umask(SB) +GLOBL ·libc_umask_trampoline_addr(SB), RODATA, $4 +DATA ·libc_umask_trampoline_addr(SB)/4, $libc_umask_trampoline<>(SB) + +TEXT libc_unlink_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unlink(SB) +GLOBL ·libc_unlink_trampoline_addr(SB), RODATA, $4 +DATA ·libc_unlink_trampoline_addr(SB)/4, $libc_unlink_trampoline<>(SB) + +TEXT libc_unlinkat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unlinkat(SB) +GLOBL ·libc_unlinkat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_unlinkat_trampoline_addr(SB)/4, $libc_unlinkat_trampoline<>(SB) + +TEXT libc_unmount_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unmount(SB) +GLOBL ·libc_unmount_trampoline_addr(SB), RODATA, $4 +DATA ·libc_unmount_trampoline_addr(SB)/4, $libc_unmount_trampoline<>(SB) + +TEXT libc_write_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_write(SB) +GLOBL ·libc_write_trampoline_addr(SB), RODATA, $4 +DATA ·libc_write_trampoline_addr(SB)/4, $libc_write_trampoline<>(SB) + +TEXT libc_mmap_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mmap(SB) +GLOBL ·libc_mmap_trampoline_addr(SB), RODATA, $4 +DATA ·libc_mmap_trampoline_addr(SB)/4, $libc_mmap_trampoline<>(SB) + +TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_munmap(SB) +GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $4 +DATA ·libc_munmap_trampoline_addr(SB)/4, $libc_munmap_trampoline<>(SB) + +TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_utimensat(SB) +GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_utimensat_trampoline_addr(SB)/4, $libc_utimensat_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go index c96a505..12a7a21 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go @@ -1,4 +1,4 @@ -// go run mksyscall.go -openbsd -tags openbsd,arm64 syscall_bsd.go syscall_openbsd.go syscall_openbsd_arm64.go +// go run mksyscall.go -openbsd -libc -tags openbsd,arm64 syscall_bsd.go syscall_openbsd.go syscall_openbsd_arm64.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build openbsd && arm64 @@ -16,7 +16,7 @@ var _ syscall.Errno // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func getgroups(ngid int, gid *_Gid_t) (n int, err error) { - r0, _, e1 := RawSyscall(SYS_GETGROUPS, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0) + r0, _, e1 := syscall_rawSyscall(libc_getgroups_trampoline_addr, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -24,20 +24,28 @@ func getgroups(ngid int, gid *_Gid_t) (n int, err error) { return } +var libc_getgroups_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getgroups getgroups "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func setgroups(ngid int, gid *_Gid_t) (err error) { - _, _, e1 := RawSyscall(SYS_SETGROUPS, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0) + _, _, e1 := syscall_rawSyscall(libc_setgroups_trampoline_addr, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setgroups_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setgroups setgroups "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func wait4(pid int, wstatus *_C_int, options int, rusage *Rusage) (wpid int, err error) { - r0, _, e1 := Syscall6(SYS_WAIT4, uintptr(pid), uintptr(unsafe.Pointer(wstatus)), uintptr(options), uintptr(unsafe.Pointer(rusage)), 0, 0) + r0, _, e1 := syscall_syscall6(libc_wait4_trampoline_addr, uintptr(pid), uintptr(unsafe.Pointer(wstatus)), uintptr(options), uintptr(unsafe.Pointer(rusage)), 0, 0) wpid = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -45,10 +53,14 @@ func wait4(pid int, wstatus *_C_int, options int, rusage *Rusage) (wpid int, err return } +var libc_wait4_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_wait4 wait4 "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { - r0, _, e1 := Syscall(SYS_ACCEPT, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + r0, _, e1 := syscall_syscall(libc_accept_trampoline_addr, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) fd = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -56,30 +68,42 @@ func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { return } +var libc_accept_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_accept accept "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { - _, _, e1 := Syscall(SYS_BIND, uintptr(s), uintptr(addr), uintptr(addrlen)) + _, _, e1 := syscall_syscall(libc_bind_trampoline_addr, uintptr(s), uintptr(addr), uintptr(addrlen)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_bind_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_bind bind "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func connect(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { - _, _, e1 := Syscall(SYS_CONNECT, uintptr(s), uintptr(addr), uintptr(addrlen)) + _, _, e1 := syscall_syscall(libc_connect_trampoline_addr, uintptr(s), uintptr(addr), uintptr(addrlen)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_connect_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_connect connect "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func socket(domain int, typ int, proto int) (fd int, err error) { - r0, _, e1 := RawSyscall(SYS_SOCKET, uintptr(domain), uintptr(typ), uintptr(proto)) + r0, _, e1 := syscall_rawSyscall(libc_socket_trampoline_addr, uintptr(domain), uintptr(typ), uintptr(proto)) fd = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -87,66 +111,94 @@ func socket(domain int, typ int, proto int) (fd int, err error) { return } +var libc_socket_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_socket socket "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func getsockopt(s int, level int, name int, val unsafe.Pointer, vallen *_Socklen) (err error) { - _, _, e1 := Syscall6(SYS_GETSOCKOPT, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(unsafe.Pointer(vallen)), 0) + _, _, e1 := syscall_syscall6(libc_getsockopt_trampoline_addr, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(unsafe.Pointer(vallen)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_getsockopt_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getsockopt getsockopt "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func setsockopt(s int, level int, name int, val unsafe.Pointer, vallen uintptr) (err error) { - _, _, e1 := Syscall6(SYS_SETSOCKOPT, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(vallen), 0) + _, _, e1 := syscall_syscall6(libc_setsockopt_trampoline_addr, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(vallen), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setsockopt_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setsockopt setsockopt "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func getpeername(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { - _, _, e1 := RawSyscall(SYS_GETPEERNAME, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + _, _, e1 := syscall_rawSyscall(libc_getpeername_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) if e1 != 0 { err = errnoErr(e1) } return } +var libc_getpeername_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpeername getpeername "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func getsockname(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { - _, _, e1 := RawSyscall(SYS_GETSOCKNAME, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + _, _, e1 := syscall_rawSyscall(libc_getsockname_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) if e1 != 0 { err = errnoErr(e1) } return } +var libc_getsockname_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getsockname getsockname "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Shutdown(s int, how int) (err error) { - _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(s), uintptr(how), 0) + _, _, e1 := syscall_syscall(libc_shutdown_trampoline_addr, uintptr(s), uintptr(how), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_shutdown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_shutdown shutdown "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func socketpair(domain int, typ int, proto int, fd *[2]int32) (err error) { - _, _, e1 := RawSyscall6(SYS_SOCKETPAIR, uintptr(domain), uintptr(typ), uintptr(proto), uintptr(unsafe.Pointer(fd)), 0, 0) + _, _, e1 := syscall_rawSyscall6(libc_socketpair_trampoline_addr, uintptr(domain), uintptr(typ), uintptr(proto), uintptr(unsafe.Pointer(fd)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_socketpair_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_socketpair socketpair "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Socklen) (n int, err error) { @@ -156,7 +208,7 @@ func recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Sockl } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall6(SYS_RECVFROM, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(flags), uintptr(unsafe.Pointer(from)), uintptr(unsafe.Pointer(fromlen))) + r0, _, e1 := syscall_syscall6(libc_recvfrom_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(flags), uintptr(unsafe.Pointer(from)), uintptr(unsafe.Pointer(fromlen))) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -164,6 +216,10 @@ func recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Sockl return } +var libc_recvfrom_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_recvfrom recvfrom "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) (err error) { @@ -173,17 +229,21 @@ func sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) ( } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall6(SYS_SENDTO, uintptr(s), uintptr(_p0), uintptr(len(buf)), uintptr(flags), uintptr(to), uintptr(addrlen)) + _, _, e1 := syscall_syscall6(libc_sendto_trampoline_addr, uintptr(s), uintptr(_p0), uintptr(len(buf)), uintptr(flags), uintptr(to), uintptr(addrlen)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_sendto_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sendto sendto "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func recvmsg(s int, msg *Msghdr, flags int) (n int, err error) { - r0, _, e1 := Syscall(SYS_RECVMSG, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) + r0, _, e1 := syscall_syscall(libc_recvmsg_trampoline_addr, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -191,10 +251,14 @@ func recvmsg(s int, msg *Msghdr, flags int) (n int, err error) { return } +var libc_recvmsg_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_recvmsg recvmsg "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) { - r0, _, e1 := Syscall(SYS_SENDMSG, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) + r0, _, e1 := syscall_syscall(libc_sendmsg_trampoline_addr, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -202,10 +266,14 @@ func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) { return } +var libc_sendmsg_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sendmsg sendmsg "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func kevent(kq int, change unsafe.Pointer, nchange int, event unsafe.Pointer, nevent int, timeout *Timespec) (n int, err error) { - r0, _, e1 := Syscall6(SYS_KEVENT, uintptr(kq), uintptr(change), uintptr(nchange), uintptr(event), uintptr(nevent), uintptr(unsafe.Pointer(timeout))) + r0, _, e1 := syscall_syscall6(libc_kevent_trampoline_addr, uintptr(kq), uintptr(change), uintptr(nchange), uintptr(event), uintptr(nevent), uintptr(unsafe.Pointer(timeout))) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -213,6 +281,10 @@ func kevent(kq int, change unsafe.Pointer, nchange int, event unsafe.Pointer, ne return } +var libc_kevent_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_kevent kevent "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func utimes(path string, timeval *[2]Timeval) (err error) { @@ -221,27 +293,35 @@ func utimes(path string, timeval *[2]Timeval) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_UTIMES, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(timeval)), 0) + _, _, e1 := syscall_syscall(libc_utimes_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(timeval)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_utimes_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_utimes utimes "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func futimes(fd int, timeval *[2]Timeval) (err error) { - _, _, e1 := Syscall(SYS_FUTIMES, uintptr(fd), uintptr(unsafe.Pointer(timeval)), 0) + _, _, e1 := syscall_syscall(libc_futimes_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(timeval)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_futimes_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_futimes futimes "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func poll(fds *PollFd, nfds int, timeout int) (n int, err error) { - r0, _, e1 := Syscall(SYS_POLL, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(timeout)) + r0, _, e1 := syscall_syscall(libc_poll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(timeout)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -249,6 +329,10 @@ func poll(fds *PollFd, nfds int, timeout int) (n int, err error) { return } +var libc_poll_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_poll poll "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Madvise(b []byte, behav int) (err error) { @@ -258,13 +342,17 @@ func Madvise(b []byte, behav int) (err error) { } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall(SYS_MADVISE, uintptr(_p0), uintptr(len(b)), uintptr(behav)) + _, _, e1 := syscall_syscall(libc_madvise_trampoline_addr, uintptr(_p0), uintptr(len(b)), uintptr(behav)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_madvise_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_madvise madvise "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mlock(b []byte) (err error) { @@ -274,23 +362,31 @@ func Mlock(b []byte) (err error) { } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall(SYS_MLOCK, uintptr(_p0), uintptr(len(b)), 0) + _, _, e1 := syscall_syscall(libc_mlock_trampoline_addr, uintptr(_p0), uintptr(len(b)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mlock_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mlock mlock "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mlockall(flags int) (err error) { - _, _, e1 := Syscall(SYS_MLOCKALL, uintptr(flags), 0, 0) + _, _, e1 := syscall_syscall(libc_mlockall_trampoline_addr, uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mlockall_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mlockall mlockall "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mprotect(b []byte, prot int) (err error) { @@ -300,13 +396,17 @@ func Mprotect(b []byte, prot int) (err error) { } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall(SYS_MPROTECT, uintptr(_p0), uintptr(len(b)), uintptr(prot)) + _, _, e1 := syscall_syscall(libc_mprotect_trampoline_addr, uintptr(_p0), uintptr(len(b)), uintptr(prot)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mprotect_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mprotect mprotect "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Msync(b []byte, flags int) (err error) { @@ -316,13 +416,17 @@ func Msync(b []byte, flags int) (err error) { } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall(SYS_MSYNC, uintptr(_p0), uintptr(len(b)), uintptr(flags)) + _, _, e1 := syscall_syscall(libc_msync_trampoline_addr, uintptr(_p0), uintptr(len(b)), uintptr(flags)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_msync_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_msync msync "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Munlock(b []byte) (err error) { @@ -332,33 +436,45 @@ func Munlock(b []byte) (err error) { } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall(SYS_MUNLOCK, uintptr(_p0), uintptr(len(b)), 0) + _, _, e1 := syscall_syscall(libc_munlock_trampoline_addr, uintptr(_p0), uintptr(len(b)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_munlock_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_munlock munlock "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Munlockall() (err error) { - _, _, e1 := Syscall(SYS_MUNLOCKALL, 0, 0, 0) + _, _, e1 := syscall_syscall(libc_munlockall_trampoline_addr, 0, 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_munlockall_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_munlockall munlockall "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func pipe2(p *[2]_C_int, flags int) (err error) { - _, _, e1 := RawSyscall(SYS_PIPE2, uintptr(unsafe.Pointer(p)), uintptr(flags), 0) + _, _, e1 := syscall_rawSyscall(libc_pipe2_trampoline_addr, uintptr(unsafe.Pointer(p)), uintptr(flags), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_pipe2_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pipe2 pipe2 "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getdents(fd int, buf []byte) (n int, err error) { @@ -368,7 +484,7 @@ func Getdents(fd int, buf []byte) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall(SYS_GETDENTS, uintptr(fd), uintptr(_p0), uintptr(len(buf))) + r0, _, e1 := syscall_syscall(libc_getdents_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(buf))) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -376,6 +492,10 @@ func Getdents(fd int, buf []byte) (n int, err error) { return } +var libc_getdents_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getdents getdents "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getcwd(buf []byte) (n int, err error) { @@ -385,7 +505,7 @@ func Getcwd(buf []byte) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall(SYS___GETCWD, uintptr(_p0), uintptr(len(buf)), 0) + r0, _, e1 := syscall_syscall(libc_getcwd_trampoline_addr, uintptr(_p0), uintptr(len(buf)), 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -393,16 +513,54 @@ func Getcwd(buf []byte) (n int, err error) { return } +var libc_getcwd_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getcwd getcwd "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func ioctl(fd int, req uint, arg uintptr) (err error) { - _, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg)) + _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { + _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -412,17 +570,21 @@ func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall6(SYS___SYSCTL, uintptr(_p0), uintptr(len(mib)), uintptr(unsafe.Pointer(old)), uintptr(unsafe.Pointer(oldlen)), uintptr(unsafe.Pointer(new)), uintptr(newlen)) + _, _, e1 := syscall_syscall6(libc_sysctl_trampoline_addr, uintptr(_p0), uintptr(len(mib)), uintptr(unsafe.Pointer(old)), uintptr(unsafe.Pointer(oldlen)), uintptr(unsafe.Pointer(new)), uintptr(newlen)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_sysctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sysctl sysctl "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { - r0, _, e1 := Syscall6(SYS_PPOLL, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) + r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -430,6 +592,10 @@ func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, return } +var libc_ppoll_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ppoll ppoll "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Access(path string, mode uint32) (err error) { @@ -438,23 +604,31 @@ func Access(path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_ACCESS, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + _, _, e1 := syscall_syscall(libc_access_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_access_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_access access "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Adjtime(delta *Timeval, olddelta *Timeval) (err error) { - _, _, e1 := Syscall(SYS_ADJTIME, uintptr(unsafe.Pointer(delta)), uintptr(unsafe.Pointer(olddelta)), 0) + _, _, e1 := syscall_syscall(libc_adjtime_trampoline_addr, uintptr(unsafe.Pointer(delta)), uintptr(unsafe.Pointer(olddelta)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_adjtime_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_adjtime adjtime "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Chdir(path string) (err error) { @@ -463,13 +637,17 @@ func Chdir(path string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_CHDIR, uintptr(unsafe.Pointer(_p0)), 0, 0) + _, _, e1 := syscall_syscall(libc_chdir_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_chdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chdir chdir "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Chflags(path string, flags int) (err error) { @@ -478,13 +656,17 @@ func Chflags(path string, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_CHFLAGS, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) + _, _, e1 := syscall_syscall(libc_chflags_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_chflags_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chflags chflags "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Chmod(path string, mode uint32) (err error) { @@ -493,13 +675,17 @@ func Chmod(path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_CHMOD, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + _, _, e1 := syscall_syscall(libc_chmod_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_chmod_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chmod chmod "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Chown(path string, uid int, gid int) (err error) { @@ -508,13 +694,17 @@ func Chown(path string, uid int, gid int) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_CHOWN, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) + _, _, e1 := syscall_syscall(libc_chown_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_chown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chown chown "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Chroot(path string) (err error) { @@ -523,27 +713,49 @@ func Chroot(path string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_CHROOT, uintptr(unsafe.Pointer(_p0)), 0, 0) + _, _, e1 := syscall_syscall(libc_chroot_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_chroot_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chroot chroot "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ClockGettime(clockid int32, time *Timespec) (err error) { + _, _, e1 := syscall_syscall(libc_clock_gettime_trampoline_addr, uintptr(clockid), uintptr(unsafe.Pointer(time)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_clock_gettime_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_clock_gettime clock_gettime "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Close(fd int) (err error) { - _, _, e1 := Syscall(SYS_CLOSE, uintptr(fd), 0, 0) + _, _, e1 := syscall_syscall(libc_close_trampoline_addr, uintptr(fd), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_close_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_close close "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Dup(fd int) (nfd int, err error) { - r0, _, e1 := Syscall(SYS_DUP, uintptr(fd), 0, 0) + r0, _, e1 := syscall_syscall(libc_dup_trampoline_addr, uintptr(fd), 0, 0) nfd = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -551,33 +763,49 @@ func Dup(fd int) (nfd int, err error) { return } +var libc_dup_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_dup dup "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Dup2(from int, to int) (err error) { - _, _, e1 := Syscall(SYS_DUP2, uintptr(from), uintptr(to), 0) + _, _, e1 := syscall_syscall(libc_dup2_trampoline_addr, uintptr(from), uintptr(to), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_dup2_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_dup2 dup2 "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Dup3(from int, to int, flags int) (err error) { - _, _, e1 := Syscall(SYS_DUP3, uintptr(from), uintptr(to), uintptr(flags)) + _, _, e1 := syscall_syscall(libc_dup3_trampoline_addr, uintptr(from), uintptr(to), uintptr(flags)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_dup3_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_dup3 dup3 "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Exit(code int) { - Syscall(SYS_EXIT, uintptr(code), 0, 0) + syscall_syscall(libc_exit_trampoline_addr, uintptr(code), 0, 0) return } +var libc_exit_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_exit exit "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) { @@ -586,43 +814,59 @@ func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_FACCESSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) + _, _, e1 := syscall_syscall6(libc_faccessat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_faccessat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_faccessat faccessat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fchdir(fd int) (err error) { - _, _, e1 := Syscall(SYS_FCHDIR, uintptr(fd), 0, 0) + _, _, e1 := syscall_syscall(libc_fchdir_trampoline_addr, uintptr(fd), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fchdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchdir fchdir "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fchflags(fd int, flags int) (err error) { - _, _, e1 := Syscall(SYS_FCHFLAGS, uintptr(fd), uintptr(flags), 0) + _, _, e1 := syscall_syscall(libc_fchflags_trampoline_addr, uintptr(fd), uintptr(flags), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fchflags_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchflags fchflags "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fchmod(fd int, mode uint32) (err error) { - _, _, e1 := Syscall(SYS_FCHMOD, uintptr(fd), uintptr(mode), 0) + _, _, e1 := syscall_syscall(libc_fchmod_trampoline_addr, uintptr(fd), uintptr(mode), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fchmod_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchmod fchmod "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) { @@ -631,23 +875,31 @@ func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_FCHMODAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) + _, _, e1 := syscall_syscall6(libc_fchmodat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fchmodat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchmodat fchmodat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fchown(fd int, uid int, gid int) (err error) { - _, _, e1 := Syscall(SYS_FCHOWN, uintptr(fd), uintptr(uid), uintptr(gid)) + _, _, e1 := syscall_syscall(libc_fchown_trampoline_addr, uintptr(fd), uintptr(uid), uintptr(gid)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fchown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchown fchown "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fchownat(dirfd int, path string, uid int, gid int, flags int) (err error) { @@ -656,27 +908,35 @@ func Fchownat(dirfd int, path string, uid int, gid int, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_FCHOWNAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), uintptr(flags), 0) + _, _, e1 := syscall_syscall6(libc_fchownat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), uintptr(flags), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fchownat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchownat fchownat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Flock(fd int, how int) (err error) { - _, _, e1 := Syscall(SYS_FLOCK, uintptr(fd), uintptr(how), 0) + _, _, e1 := syscall_syscall(libc_flock_trampoline_addr, uintptr(fd), uintptr(how), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_flock_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_flock flock "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fpathconf(fd int, name int) (val int, err error) { - r0, _, e1 := Syscall(SYS_FPATHCONF, uintptr(fd), uintptr(name), 0) + r0, _, e1 := syscall_syscall(libc_fpathconf_trampoline_addr, uintptr(fd), uintptr(name), 0) val = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -684,16 +944,24 @@ func Fpathconf(fd int, name int) (val int, err error) { return } +var libc_fpathconf_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fpathconf fpathconf "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fstat(fd int, stat *Stat_t) (err error) { - _, _, e1 := Syscall(SYS_FSTAT, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) + _, _, e1 := syscall_syscall(libc_fstat_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fstat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fstat fstat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) { @@ -702,71 +970,99 @@ func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_FSTATAT, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), uintptr(flags), 0, 0) + _, _, e1 := syscall_syscall6(libc_fstatat_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fstatat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fstatat fstatat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fstatfs(fd int, stat *Statfs_t) (err error) { - _, _, e1 := Syscall(SYS_FSTATFS, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) + _, _, e1 := syscall_syscall(libc_fstatfs_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fstatfs_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fstatfs fstatfs "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fsync(fd int) (err error) { - _, _, e1 := Syscall(SYS_FSYNC, uintptr(fd), 0, 0) + _, _, e1 := syscall_syscall(libc_fsync_trampoline_addr, uintptr(fd), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fsync_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fsync fsync "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Ftruncate(fd int, length int64) (err error) { - _, _, e1 := Syscall(SYS_FTRUNCATE, uintptr(fd), 0, uintptr(length)) + _, _, e1 := syscall_syscall(libc_ftruncate_trampoline_addr, uintptr(fd), uintptr(length), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_ftruncate_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ftruncate ftruncate "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getegid() (egid int) { - r0, _, _ := RawSyscall(SYS_GETEGID, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_getegid_trampoline_addr, 0, 0, 0) egid = int(r0) return } +var libc_getegid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getegid getegid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Geteuid() (uid int) { - r0, _, _ := RawSyscall(SYS_GETEUID, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_geteuid_trampoline_addr, 0, 0, 0) uid = int(r0) return } +var libc_geteuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_geteuid geteuid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getgid() (gid int) { - r0, _, _ := RawSyscall(SYS_GETGID, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_getgid_trampoline_addr, 0, 0, 0) gid = int(r0) return } +var libc_getgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getgid getgid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getpgid(pid int) (pgid int, err error) { - r0, _, e1 := RawSyscall(SYS_GETPGID, uintptr(pid), 0, 0) + r0, _, e1 := syscall_rawSyscall(libc_getpgid_trampoline_addr, uintptr(pid), 0, 0) pgid = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -774,34 +1070,50 @@ func Getpgid(pid int) (pgid int, err error) { return } +var libc_getpgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpgid getpgid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getpgrp() (pgrp int) { - r0, _, _ := RawSyscall(SYS_GETPGRP, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_getpgrp_trampoline_addr, 0, 0, 0) pgrp = int(r0) return } +var libc_getpgrp_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpgrp getpgrp "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getpid() (pid int) { - r0, _, _ := RawSyscall(SYS_GETPID, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_getpid_trampoline_addr, 0, 0, 0) pid = int(r0) return } +var libc_getpid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpid getpid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getppid() (ppid int) { - r0, _, _ := RawSyscall(SYS_GETPPID, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_getppid_trampoline_addr, 0, 0, 0) ppid = int(r0) return } +var libc_getppid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getppid getppid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getpriority(which int, who int) (prio int, err error) { - r0, _, e1 := Syscall(SYS_GETPRIORITY, uintptr(which), uintptr(who), 0) + r0, _, e1 := syscall_syscall(libc_getpriority_trampoline_addr, uintptr(which), uintptr(who), 0) prio = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -809,20 +1121,28 @@ func Getpriority(which int, who int) (prio int, err error) { return } +var libc_getpriority_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpriority getpriority "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_GETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) + _, _, e1 := syscall_rawSyscall(libc_getrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_getrlimit_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getrlimit getrlimit "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getrtable() (rtable int, err error) { - r0, _, e1 := RawSyscall(SYS_GETRTABLE, 0, 0, 0) + r0, _, e1 := syscall_rawSyscall(libc_getrtable_trampoline_addr, 0, 0, 0) rtable = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -830,20 +1150,28 @@ func Getrtable() (rtable int, err error) { return } +var libc_getrtable_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getrtable getrtable "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getrusage(who int, rusage *Rusage) (err error) { - _, _, e1 := RawSyscall(SYS_GETRUSAGE, uintptr(who), uintptr(unsafe.Pointer(rusage)), 0) + _, _, e1 := syscall_rawSyscall(libc_getrusage_trampoline_addr, uintptr(who), uintptr(unsafe.Pointer(rusage)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_getrusage_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getrusage getrusage "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getsid(pid int) (sid int, err error) { - r0, _, e1 := RawSyscall(SYS_GETSID, uintptr(pid), 0, 0) + r0, _, e1 := syscall_rawSyscall(libc_getsid_trampoline_addr, uintptr(pid), 0, 0) sid = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -851,46 +1179,66 @@ func Getsid(pid int) (sid int, err error) { return } +var libc_getsid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getsid getsid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Gettimeofday(tv *Timeval) (err error) { - _, _, e1 := RawSyscall(SYS_GETTIMEOFDAY, uintptr(unsafe.Pointer(tv)), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_gettimeofday_trampoline_addr, uintptr(unsafe.Pointer(tv)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_gettimeofday_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_gettimeofday gettimeofday "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getuid() (uid int) { - r0, _, _ := RawSyscall(SYS_GETUID, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_getuid_trampoline_addr, 0, 0, 0) uid = int(r0) return } +var libc_getuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getuid getuid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Issetugid() (tainted bool) { - r0, _, _ := Syscall(SYS_ISSETUGID, 0, 0, 0) + r0, _, _ := syscall_syscall(libc_issetugid_trampoline_addr, 0, 0, 0) tainted = bool(r0 != 0) return } +var libc_issetugid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_issetugid issetugid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Kill(pid int, signum syscall.Signal) (err error) { - _, _, e1 := Syscall(SYS_KILL, uintptr(pid), uintptr(signum), 0) + _, _, e1 := syscall_syscall(libc_kill_trampoline_addr, uintptr(pid), uintptr(signum), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_kill_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_kill kill "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Kqueue() (fd int, err error) { - r0, _, e1 := Syscall(SYS_KQUEUE, 0, 0, 0) + r0, _, e1 := syscall_syscall(libc_kqueue_trampoline_addr, 0, 0, 0) fd = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -898,6 +1246,10 @@ func Kqueue() (fd int, err error) { return } +var libc_kqueue_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_kqueue kqueue "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Lchown(path string, uid int, gid int) (err error) { @@ -906,13 +1258,17 @@ func Lchown(path string, uid int, gid int) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_LCHOWN, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) + _, _, e1 := syscall_syscall(libc_lchown_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_lchown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_lchown lchown "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Link(path string, link string) (err error) { @@ -926,13 +1282,17 @@ func Link(path string, link string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_LINK, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) + _, _, e1 := syscall_syscall(libc_link_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_link_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_link link "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Linkat(pathfd int, path string, linkfd int, link string, flags int) (err error) { @@ -946,23 +1306,31 @@ func Linkat(pathfd int, path string, linkfd int, link string, flags int) (err er if err != nil { return } - _, _, e1 := Syscall6(SYS_LINKAT, uintptr(pathfd), uintptr(unsafe.Pointer(_p0)), uintptr(linkfd), uintptr(unsafe.Pointer(_p1)), uintptr(flags), 0) + _, _, e1 := syscall_syscall6(libc_linkat_trampoline_addr, uintptr(pathfd), uintptr(unsafe.Pointer(_p0)), uintptr(linkfd), uintptr(unsafe.Pointer(_p1)), uintptr(flags), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_linkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_linkat linkat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Listen(s int, backlog int) (err error) { - _, _, e1 := Syscall(SYS_LISTEN, uintptr(s), uintptr(backlog), 0) + _, _, e1 := syscall_syscall(libc_listen_trampoline_addr, uintptr(s), uintptr(backlog), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_listen_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_listen listen "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Lstat(path string, stat *Stat_t) (err error) { @@ -971,13 +1339,17 @@ func Lstat(path string, stat *Stat_t) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_LSTAT, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) + _, _, e1 := syscall_syscall(libc_lstat_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_lstat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_lstat lstat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mkdir(path string, mode uint32) (err error) { @@ -986,13 +1358,17 @@ func Mkdir(path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_MKDIR, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + _, _, e1 := syscall_syscall(libc_mkdir_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mkdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkdir mkdir "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mkdirat(dirfd int, path string, mode uint32) (err error) { @@ -1001,13 +1377,17 @@ func Mkdirat(dirfd int, path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_MKDIRAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) + _, _, e1 := syscall_syscall(libc_mkdirat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mkdirat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkdirat mkdirat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mkfifo(path string, mode uint32) (err error) { @@ -1016,13 +1396,17 @@ func Mkfifo(path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_MKFIFO, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + _, _, e1 := syscall_syscall(libc_mkfifo_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mkfifo_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkfifo mkfifo "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mkfifoat(dirfd int, path string, mode uint32) (err error) { @@ -1031,13 +1415,17 @@ func Mkfifoat(dirfd int, path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_MKFIFOAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) + _, _, e1 := syscall_syscall(libc_mkfifoat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mkfifoat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkfifoat mkfifoat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mknod(path string, mode uint32, dev int) (err error) { @@ -1046,13 +1434,17 @@ func Mknod(path string, mode uint32, dev int) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_MKNOD, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev)) + _, _, e1 := syscall_syscall(libc_mknod_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mknod_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mknod mknod "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mknodat(dirfd int, path string, mode uint32, dev int) (err error) { @@ -1061,23 +1453,31 @@ func Mknodat(dirfd int, path string, mode uint32, dev int) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_MKNODAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0) + _, _, e1 := syscall_syscall6(libc_mknodat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mknodat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mknodat mknodat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Nanosleep(time *Timespec, leftover *Timespec) (err error) { - _, _, e1 := Syscall(SYS_NANOSLEEP, uintptr(unsafe.Pointer(time)), uintptr(unsafe.Pointer(leftover)), 0) + _, _, e1 := syscall_syscall(libc_nanosleep_trampoline_addr, uintptr(unsafe.Pointer(time)), uintptr(unsafe.Pointer(leftover)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_nanosleep_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_nanosleep nanosleep "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Open(path string, mode int, perm uint32) (fd int, err error) { @@ -1086,7 +1486,7 @@ func Open(path string, mode int, perm uint32) (fd int, err error) { if err != nil { return } - r0, _, e1 := Syscall(SYS_OPEN, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm)) + r0, _, e1 := syscall_syscall(libc_open_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm)) fd = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1094,6 +1494,10 @@ func Open(path string, mode int, perm uint32) (fd int, err error) { return } +var libc_open_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_open open "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Openat(dirfd int, path string, mode int, perm uint32) (fd int, err error) { @@ -1102,7 +1506,7 @@ func Openat(dirfd int, path string, mode int, perm uint32) (fd int, err error) { if err != nil { return } - r0, _, e1 := Syscall6(SYS_OPENAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm), 0, 0) + r0, _, e1 := syscall_syscall6(libc_openat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm), 0, 0) fd = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1110,6 +1514,10 @@ func Openat(dirfd int, path string, mode int, perm uint32) (fd int, err error) { return } +var libc_openat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_openat openat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Pathconf(path string, name int) (val int, err error) { @@ -1118,7 +1526,7 @@ func Pathconf(path string, name int) (val int, err error) { if err != nil { return } - r0, _, e1 := Syscall(SYS_PATHCONF, uintptr(unsafe.Pointer(_p0)), uintptr(name), 0) + r0, _, e1 := syscall_syscall(libc_pathconf_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(name), 0) val = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1126,6 +1534,10 @@ func Pathconf(path string, name int) (val int, err error) { return } +var libc_pathconf_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pathconf pathconf "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func pread(fd int, p []byte, offset int64) (n int, err error) { @@ -1135,7 +1547,7 @@ func pread(fd int, p []byte, offset int64) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall6(SYS_PREAD, uintptr(fd), uintptr(_p0), uintptr(len(p)), 0, uintptr(offset), 0) + r0, _, e1 := syscall_syscall6(libc_pread_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(offset), 0, 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1143,6 +1555,10 @@ func pread(fd int, p []byte, offset int64) (n int, err error) { return } +var libc_pread_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pread pread "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func pwrite(fd int, p []byte, offset int64) (n int, err error) { @@ -1152,7 +1568,7 @@ func pwrite(fd int, p []byte, offset int64) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall6(SYS_PWRITE, uintptr(fd), uintptr(_p0), uintptr(len(p)), 0, uintptr(offset), 0) + r0, _, e1 := syscall_syscall6(libc_pwrite_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(offset), 0, 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1160,6 +1576,10 @@ func pwrite(fd int, p []byte, offset int64) (n int, err error) { return } +var libc_pwrite_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pwrite pwrite "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func read(fd int, p []byte) (n int, err error) { @@ -1169,7 +1589,7 @@ func read(fd int, p []byte) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(_p0), uintptr(len(p))) + r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p))) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1177,6 +1597,10 @@ func read(fd int, p []byte) (n int, err error) { return } +var libc_read_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_read read "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Readlink(path string, buf []byte) (n int, err error) { @@ -1191,7 +1615,7 @@ func Readlink(path string, buf []byte) (n int, err error) { } else { _p1 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall(SYS_READLINK, uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf))) + r0, _, e1 := syscall_syscall(libc_readlink_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf))) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1199,6 +1623,10 @@ func Readlink(path string, buf []byte) (n int, err error) { return } +var libc_readlink_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_readlink readlink "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Readlinkat(dirfd int, path string, buf []byte) (n int, err error) { @@ -1213,7 +1641,7 @@ func Readlinkat(dirfd int, path string, buf []byte) (n int, err error) { } else { _p1 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall6(SYS_READLINKAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf)), 0, 0) + r0, _, e1 := syscall_syscall6(libc_readlinkat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf)), 0, 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1221,6 +1649,10 @@ func Readlinkat(dirfd int, path string, buf []byte) (n int, err error) { return } +var libc_readlinkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_readlinkat readlinkat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Rename(from string, to string) (err error) { @@ -1234,13 +1666,17 @@ func Rename(from string, to string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_RENAME, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) + _, _, e1 := syscall_syscall(libc_rename_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_rename_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_rename rename "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Renameat(fromfd int, from string, tofd int, to string) (err error) { @@ -1254,13 +1690,17 @@ func Renameat(fromfd int, from string, tofd int, to string) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_RENAMEAT, uintptr(fromfd), uintptr(unsafe.Pointer(_p0)), uintptr(tofd), uintptr(unsafe.Pointer(_p1)), 0, 0) + _, _, e1 := syscall_syscall6(libc_renameat_trampoline_addr, uintptr(fromfd), uintptr(unsafe.Pointer(_p0)), uintptr(tofd), uintptr(unsafe.Pointer(_p1)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_renameat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_renameat renameat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Revoke(path string) (err error) { @@ -1269,13 +1709,17 @@ func Revoke(path string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_REVOKE, uintptr(unsafe.Pointer(_p0)), 0, 0) + _, _, e1 := syscall_syscall(libc_revoke_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_revoke_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_revoke revoke "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Rmdir(path string) (err error) { @@ -1284,17 +1728,21 @@ func Rmdir(path string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_RMDIR, uintptr(unsafe.Pointer(_p0)), 0, 0) + _, _, e1 := syscall_syscall(libc_rmdir_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_rmdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_rmdir rmdir "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Seek(fd int, offset int64, whence int) (newoffset int64, err error) { - r0, _, e1 := Syscall6(SYS_LSEEK, uintptr(fd), 0, uintptr(offset), uintptr(whence), 0, 0) + r0, _, e1 := syscall_syscall(libc_lseek_trampoline_addr, uintptr(fd), uintptr(offset), uintptr(whence)) newoffset = int64(r0) if e1 != 0 { err = errnoErr(e1) @@ -1302,10 +1750,14 @@ func Seek(fd int, offset int64, whence int) (newoffset int64, err error) { return } +var libc_lseek_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_lseek lseek "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err error) { - r0, _, e1 := Syscall6(SYS_SELECT, uintptr(nfd), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), 0) + r0, _, e1 := syscall_syscall6(libc_select_trampoline_addr, uintptr(nfd), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1313,36 +1765,52 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err return } +var libc_select_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_select select "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setegid(egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETEGID, uintptr(egid), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_setegid_trampoline_addr, uintptr(egid), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setegid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setegid setegid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Seteuid(euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETEUID, uintptr(euid), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_seteuid_trampoline_addr, uintptr(euid), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_seteuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_seteuid seteuid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setgid(gid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETGID, uintptr(gid), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_setgid_trampoline_addr, uintptr(gid), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setgid setgid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setlogin(name string) (err error) { @@ -1351,97 +1819,119 @@ func Setlogin(name string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_SETLOGIN, uintptr(unsafe.Pointer(_p0)), 0, 0) + _, _, e1 := syscall_syscall(libc_setlogin_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setlogin_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setlogin setlogin "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setpgid(pid int, pgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETPGID, uintptr(pid), uintptr(pgid), 0) + _, _, e1 := syscall_rawSyscall(libc_setpgid_trampoline_addr, uintptr(pid), uintptr(pgid), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setpgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setpgid setpgid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setpriority(which int, who int, prio int) (err error) { - _, _, e1 := Syscall(SYS_SETPRIORITY, uintptr(which), uintptr(who), uintptr(prio)) + _, _, e1 := syscall_syscall(libc_setpriority_trampoline_addr, uintptr(which), uintptr(who), uintptr(prio)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setpriority_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setpriority setpriority "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) + _, _, e1 := syscall_rawSyscall(libc_setregid_trampoline_addr, uintptr(rgid), uintptr(egid), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setregid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setregid setregid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) + _, _, e1 := syscall_rawSyscall(libc_setreuid_trampoline_addr, uintptr(ruid), uintptr(euid), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setreuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setreuid setreuid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) + _, _, e1 := syscall_rawSyscall(libc_setresgid_trampoline_addr, uintptr(rgid), uintptr(egid), uintptr(sgid)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setresgid setresgid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) + _, _, e1 := syscall_rawSyscall(libc_setresuid_trampoline_addr, uintptr(ruid), uintptr(euid), uintptr(suid)) if e1 != 0 { err = errnoErr(e1) } return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +var libc_setresuid_trampoline_addr uintptr -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} +//go:cgo_import_dynamic libc_setresuid setresuid "libc.so" // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setrtable(rtable int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRTABLE, uintptr(rtable), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setrtable_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setrtable setrtable "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setsid() (pid int, err error) { - r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) + r0, _, e1 := syscall_rawSyscall(libc_setsid_trampoline_addr, 0, 0, 0) pid = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1449,26 +1939,38 @@ func Setsid() (pid int, err error) { return } +var libc_setsid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setsid setsid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Settimeofday(tp *Timeval) (err error) { - _, _, e1 := RawSyscall(SYS_SETTIMEOFDAY, uintptr(unsafe.Pointer(tp)), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_settimeofday_trampoline_addr, uintptr(unsafe.Pointer(tp)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_settimeofday_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_settimeofday settimeofday "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setuid(uid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETUID, uintptr(uid), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_setuid_trampoline_addr, uintptr(uid), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setuid setuid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Stat(path string, stat *Stat_t) (err error) { @@ -1477,13 +1979,17 @@ func Stat(path string, stat *Stat_t) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_STAT, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) + _, _, e1 := syscall_syscall(libc_stat_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_stat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_stat stat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Statfs(path string, stat *Statfs_t) (err error) { @@ -1492,13 +1998,17 @@ func Statfs(path string, stat *Statfs_t) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_STATFS, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) + _, _, e1 := syscall_syscall(libc_statfs_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_statfs_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_statfs statfs "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Symlink(path string, link string) (err error) { @@ -1512,13 +2022,17 @@ func Symlink(path string, link string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_SYMLINK, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) + _, _, e1 := syscall_syscall(libc_symlink_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_symlink_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_symlink symlink "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Symlinkat(oldpath string, newdirfd int, newpath string) (err error) { @@ -1532,23 +2046,31 @@ func Symlinkat(oldpath string, newdirfd int, newpath string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_SYMLINKAT, uintptr(unsafe.Pointer(_p0)), uintptr(newdirfd), uintptr(unsafe.Pointer(_p1))) + _, _, e1 := syscall_syscall(libc_symlinkat_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(newdirfd), uintptr(unsafe.Pointer(_p1))) if e1 != 0 { err = errnoErr(e1) } return } +var libc_symlinkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_symlinkat symlinkat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Sync() (err error) { - _, _, e1 := Syscall(SYS_SYNC, 0, 0, 0) + _, _, e1 := syscall_syscall(libc_sync_trampoline_addr, 0, 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_sync_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sync sync "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Truncate(path string, length int64) (err error) { @@ -1557,21 +2079,29 @@ func Truncate(path string, length int64) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_TRUNCATE, uintptr(unsafe.Pointer(_p0)), 0, uintptr(length)) + _, _, e1 := syscall_syscall(libc_truncate_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(length), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_truncate_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_truncate truncate "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Umask(newmask int) (oldmask int) { - r0, _, _ := Syscall(SYS_UMASK, uintptr(newmask), 0, 0) + r0, _, _ := syscall_syscall(libc_umask_trampoline_addr, uintptr(newmask), 0, 0) oldmask = int(r0) return } +var libc_umask_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_umask umask "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Unlink(path string) (err error) { @@ -1580,13 +2110,17 @@ func Unlink(path string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_UNLINK, uintptr(unsafe.Pointer(_p0)), 0, 0) + _, _, e1 := syscall_syscall(libc_unlink_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_unlink_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unlink unlink "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Unlinkat(dirfd int, path string, flags int) (err error) { @@ -1595,13 +2129,17 @@ func Unlinkat(dirfd int, path string, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_UNLINKAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(flags)) + _, _, e1 := syscall_syscall(libc_unlinkat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(flags)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_unlinkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unlinkat unlinkat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Unmount(path string, flags int) (err error) { @@ -1610,13 +2148,17 @@ func Unmount(path string, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_UNMOUNT, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) + _, _, e1 := syscall_syscall(libc_unmount_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_unmount_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unmount unmount "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func write(fd int, p []byte) (n int, err error) { @@ -1626,7 +2168,7 @@ func write(fd int, p []byte) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(_p0), uintptr(len(p))) + r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p))) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1634,10 +2176,14 @@ func write(fd int, p []byte) (n int, err error) { return } +var libc_write_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_write write "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) { - r0, _, e1 := Syscall9(SYS_MMAP, uintptr(addr), uintptr(length), uintptr(prot), uintptr(flag), uintptr(fd), 0, uintptr(pos), 0, 0) + r0, _, e1 := syscall_syscall6(libc_mmap_trampoline_addr, uintptr(addr), uintptr(length), uintptr(prot), uintptr(flag), uintptr(fd), uintptr(pos)) ret = uintptr(r0) if e1 != 0 { err = errnoErr(e1) @@ -1645,20 +2191,28 @@ func mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) ( return } +var libc_mmap_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mmap mmap "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func munmap(addr uintptr, length uintptr) (err error) { - _, _, e1 := Syscall(SYS_MUNMAP, uintptr(addr), uintptr(length), 0) + _, _, e1 := syscall_syscall(libc_munmap_trampoline_addr, uintptr(addr), uintptr(length), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_munmap_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_munmap munmap "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) + r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1669,7 +2223,7 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) + r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1685,9 +2239,13 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error if err != nil { return } - _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) + _, _, e1 := syscall_syscall6(libc_utimensat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } + +var libc_utimensat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_utimensat utimensat "libc.so" diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s new file mode 100644 index 0000000..a6bc32c --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s @@ -0,0 +1,674 @@ +// go run mkasm.go openbsd arm64 +// Code generated by the command above; DO NOT EDIT. + +#include "textflag.h" + +TEXT libc_getgroups_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getgroups(SB) +GLOBL ·libc_getgroups_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getgroups_trampoline_addr(SB)/8, $libc_getgroups_trampoline<>(SB) + +TEXT libc_setgroups_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setgroups(SB) +GLOBL ·libc_setgroups_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setgroups_trampoline_addr(SB)/8, $libc_setgroups_trampoline<>(SB) + +TEXT libc_wait4_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_wait4(SB) +GLOBL ·libc_wait4_trampoline_addr(SB), RODATA, $8 +DATA ·libc_wait4_trampoline_addr(SB)/8, $libc_wait4_trampoline<>(SB) + +TEXT libc_accept_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_accept(SB) +GLOBL ·libc_accept_trampoline_addr(SB), RODATA, $8 +DATA ·libc_accept_trampoline_addr(SB)/8, $libc_accept_trampoline<>(SB) + +TEXT libc_bind_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_bind(SB) +GLOBL ·libc_bind_trampoline_addr(SB), RODATA, $8 +DATA ·libc_bind_trampoline_addr(SB)/8, $libc_bind_trampoline<>(SB) + +TEXT libc_connect_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_connect(SB) +GLOBL ·libc_connect_trampoline_addr(SB), RODATA, $8 +DATA ·libc_connect_trampoline_addr(SB)/8, $libc_connect_trampoline<>(SB) + +TEXT libc_socket_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_socket(SB) +GLOBL ·libc_socket_trampoline_addr(SB), RODATA, $8 +DATA ·libc_socket_trampoline_addr(SB)/8, $libc_socket_trampoline<>(SB) + +TEXT libc_getsockopt_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getsockopt(SB) +GLOBL ·libc_getsockopt_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getsockopt_trampoline_addr(SB)/8, $libc_getsockopt_trampoline<>(SB) + +TEXT libc_setsockopt_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setsockopt(SB) +GLOBL ·libc_setsockopt_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setsockopt_trampoline_addr(SB)/8, $libc_setsockopt_trampoline<>(SB) + +TEXT libc_getpeername_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpeername(SB) +GLOBL ·libc_getpeername_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpeername_trampoline_addr(SB)/8, $libc_getpeername_trampoline<>(SB) + +TEXT libc_getsockname_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getsockname(SB) +GLOBL ·libc_getsockname_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getsockname_trampoline_addr(SB)/8, $libc_getsockname_trampoline<>(SB) + +TEXT libc_shutdown_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_shutdown(SB) +GLOBL ·libc_shutdown_trampoline_addr(SB), RODATA, $8 +DATA ·libc_shutdown_trampoline_addr(SB)/8, $libc_shutdown_trampoline<>(SB) + +TEXT libc_socketpair_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_socketpair(SB) +GLOBL ·libc_socketpair_trampoline_addr(SB), RODATA, $8 +DATA ·libc_socketpair_trampoline_addr(SB)/8, $libc_socketpair_trampoline<>(SB) + +TEXT libc_recvfrom_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_recvfrom(SB) +GLOBL ·libc_recvfrom_trampoline_addr(SB), RODATA, $8 +DATA ·libc_recvfrom_trampoline_addr(SB)/8, $libc_recvfrom_trampoline<>(SB) + +TEXT libc_sendto_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sendto(SB) +GLOBL ·libc_sendto_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sendto_trampoline_addr(SB)/8, $libc_sendto_trampoline<>(SB) + +TEXT libc_recvmsg_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_recvmsg(SB) +GLOBL ·libc_recvmsg_trampoline_addr(SB), RODATA, $8 +DATA ·libc_recvmsg_trampoline_addr(SB)/8, $libc_recvmsg_trampoline<>(SB) + +TEXT libc_sendmsg_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sendmsg(SB) +GLOBL ·libc_sendmsg_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sendmsg_trampoline_addr(SB)/8, $libc_sendmsg_trampoline<>(SB) + +TEXT libc_kevent_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_kevent(SB) +GLOBL ·libc_kevent_trampoline_addr(SB), RODATA, $8 +DATA ·libc_kevent_trampoline_addr(SB)/8, $libc_kevent_trampoline<>(SB) + +TEXT libc_utimes_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_utimes(SB) +GLOBL ·libc_utimes_trampoline_addr(SB), RODATA, $8 +DATA ·libc_utimes_trampoline_addr(SB)/8, $libc_utimes_trampoline<>(SB) + +TEXT libc_futimes_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_futimes(SB) +GLOBL ·libc_futimes_trampoline_addr(SB), RODATA, $8 +DATA ·libc_futimes_trampoline_addr(SB)/8, $libc_futimes_trampoline<>(SB) + +TEXT libc_poll_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_poll(SB) +GLOBL ·libc_poll_trampoline_addr(SB), RODATA, $8 +DATA ·libc_poll_trampoline_addr(SB)/8, $libc_poll_trampoline<>(SB) + +TEXT libc_madvise_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_madvise(SB) +GLOBL ·libc_madvise_trampoline_addr(SB), RODATA, $8 +DATA ·libc_madvise_trampoline_addr(SB)/8, $libc_madvise_trampoline<>(SB) + +TEXT libc_mlock_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mlock(SB) +GLOBL ·libc_mlock_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mlock_trampoline_addr(SB)/8, $libc_mlock_trampoline<>(SB) + +TEXT libc_mlockall_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mlockall(SB) +GLOBL ·libc_mlockall_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mlockall_trampoline_addr(SB)/8, $libc_mlockall_trampoline<>(SB) + +TEXT libc_mprotect_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mprotect(SB) +GLOBL ·libc_mprotect_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mprotect_trampoline_addr(SB)/8, $libc_mprotect_trampoline<>(SB) + +TEXT libc_msync_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_msync(SB) +GLOBL ·libc_msync_trampoline_addr(SB), RODATA, $8 +DATA ·libc_msync_trampoline_addr(SB)/8, $libc_msync_trampoline<>(SB) + +TEXT libc_munlock_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_munlock(SB) +GLOBL ·libc_munlock_trampoline_addr(SB), RODATA, $8 +DATA ·libc_munlock_trampoline_addr(SB)/8, $libc_munlock_trampoline<>(SB) + +TEXT libc_munlockall_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_munlockall(SB) +GLOBL ·libc_munlockall_trampoline_addr(SB), RODATA, $8 +DATA ·libc_munlockall_trampoline_addr(SB)/8, $libc_munlockall_trampoline<>(SB) + +TEXT libc_pipe2_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pipe2(SB) +GLOBL ·libc_pipe2_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pipe2_trampoline_addr(SB)/8, $libc_pipe2_trampoline<>(SB) + +TEXT libc_getdents_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getdents(SB) +GLOBL ·libc_getdents_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getdents_trampoline_addr(SB)/8, $libc_getdents_trampoline<>(SB) + +TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getcwd(SB) +GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) + +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + +TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_ioctl(SB) +GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_ioctl_trampoline_addr(SB)/8, $libc_ioctl_trampoline<>(SB) + +TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sysctl(SB) +GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) + +TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_ppoll(SB) +GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $8 +DATA ·libc_ppoll_trampoline_addr(SB)/8, $libc_ppoll_trampoline<>(SB) + +TEXT libc_access_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_access(SB) +GLOBL ·libc_access_trampoline_addr(SB), RODATA, $8 +DATA ·libc_access_trampoline_addr(SB)/8, $libc_access_trampoline<>(SB) + +TEXT libc_adjtime_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_adjtime(SB) +GLOBL ·libc_adjtime_trampoline_addr(SB), RODATA, $8 +DATA ·libc_adjtime_trampoline_addr(SB)/8, $libc_adjtime_trampoline<>(SB) + +TEXT libc_chdir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chdir(SB) +GLOBL ·libc_chdir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chdir_trampoline_addr(SB)/8, $libc_chdir_trampoline<>(SB) + +TEXT libc_chflags_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chflags(SB) +GLOBL ·libc_chflags_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chflags_trampoline_addr(SB)/8, $libc_chflags_trampoline<>(SB) + +TEXT libc_chmod_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chmod(SB) +GLOBL ·libc_chmod_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chmod_trampoline_addr(SB)/8, $libc_chmod_trampoline<>(SB) + +TEXT libc_chown_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chown(SB) +GLOBL ·libc_chown_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chown_trampoline_addr(SB)/8, $libc_chown_trampoline<>(SB) + +TEXT libc_chroot_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chroot(SB) +GLOBL ·libc_chroot_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chroot_trampoline_addr(SB)/8, $libc_chroot_trampoline<>(SB) + +TEXT libc_clock_gettime_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_clock_gettime(SB) +GLOBL ·libc_clock_gettime_trampoline_addr(SB), RODATA, $8 +DATA ·libc_clock_gettime_trampoline_addr(SB)/8, $libc_clock_gettime_trampoline<>(SB) + +TEXT libc_close_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_close(SB) +GLOBL ·libc_close_trampoline_addr(SB), RODATA, $8 +DATA ·libc_close_trampoline_addr(SB)/8, $libc_close_trampoline<>(SB) + +TEXT libc_dup_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_dup(SB) +GLOBL ·libc_dup_trampoline_addr(SB), RODATA, $8 +DATA ·libc_dup_trampoline_addr(SB)/8, $libc_dup_trampoline<>(SB) + +TEXT libc_dup2_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_dup2(SB) +GLOBL ·libc_dup2_trampoline_addr(SB), RODATA, $8 +DATA ·libc_dup2_trampoline_addr(SB)/8, $libc_dup2_trampoline<>(SB) + +TEXT libc_dup3_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_dup3(SB) +GLOBL ·libc_dup3_trampoline_addr(SB), RODATA, $8 +DATA ·libc_dup3_trampoline_addr(SB)/8, $libc_dup3_trampoline<>(SB) + +TEXT libc_exit_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_exit(SB) +GLOBL ·libc_exit_trampoline_addr(SB), RODATA, $8 +DATA ·libc_exit_trampoline_addr(SB)/8, $libc_exit_trampoline<>(SB) + +TEXT libc_faccessat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_faccessat(SB) +GLOBL ·libc_faccessat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_faccessat_trampoline_addr(SB)/8, $libc_faccessat_trampoline<>(SB) + +TEXT libc_fchdir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchdir(SB) +GLOBL ·libc_fchdir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchdir_trampoline_addr(SB)/8, $libc_fchdir_trampoline<>(SB) + +TEXT libc_fchflags_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchflags(SB) +GLOBL ·libc_fchflags_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchflags_trampoline_addr(SB)/8, $libc_fchflags_trampoline<>(SB) + +TEXT libc_fchmod_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchmod(SB) +GLOBL ·libc_fchmod_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchmod_trampoline_addr(SB)/8, $libc_fchmod_trampoline<>(SB) + +TEXT libc_fchmodat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchmodat(SB) +GLOBL ·libc_fchmodat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchmodat_trampoline_addr(SB)/8, $libc_fchmodat_trampoline<>(SB) + +TEXT libc_fchown_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchown(SB) +GLOBL ·libc_fchown_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchown_trampoline_addr(SB)/8, $libc_fchown_trampoline<>(SB) + +TEXT libc_fchownat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchownat(SB) +GLOBL ·libc_fchownat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchownat_trampoline_addr(SB)/8, $libc_fchownat_trampoline<>(SB) + +TEXT libc_flock_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_flock(SB) +GLOBL ·libc_flock_trampoline_addr(SB), RODATA, $8 +DATA ·libc_flock_trampoline_addr(SB)/8, $libc_flock_trampoline<>(SB) + +TEXT libc_fpathconf_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fpathconf(SB) +GLOBL ·libc_fpathconf_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fpathconf_trampoline_addr(SB)/8, $libc_fpathconf_trampoline<>(SB) + +TEXT libc_fstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fstat(SB) +GLOBL ·libc_fstat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fstat_trampoline_addr(SB)/8, $libc_fstat_trampoline<>(SB) + +TEXT libc_fstatat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fstatat(SB) +GLOBL ·libc_fstatat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fstatat_trampoline_addr(SB)/8, $libc_fstatat_trampoline<>(SB) + +TEXT libc_fstatfs_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fstatfs(SB) +GLOBL ·libc_fstatfs_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fstatfs_trampoline_addr(SB)/8, $libc_fstatfs_trampoline<>(SB) + +TEXT libc_fsync_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fsync(SB) +GLOBL ·libc_fsync_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fsync_trampoline_addr(SB)/8, $libc_fsync_trampoline<>(SB) + +TEXT libc_ftruncate_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_ftruncate(SB) +GLOBL ·libc_ftruncate_trampoline_addr(SB), RODATA, $8 +DATA ·libc_ftruncate_trampoline_addr(SB)/8, $libc_ftruncate_trampoline<>(SB) + +TEXT libc_getegid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getegid(SB) +GLOBL ·libc_getegid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getegid_trampoline_addr(SB)/8, $libc_getegid_trampoline<>(SB) + +TEXT libc_geteuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_geteuid(SB) +GLOBL ·libc_geteuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_geteuid_trampoline_addr(SB)/8, $libc_geteuid_trampoline<>(SB) + +TEXT libc_getgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getgid(SB) +GLOBL ·libc_getgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getgid_trampoline_addr(SB)/8, $libc_getgid_trampoline<>(SB) + +TEXT libc_getpgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpgid(SB) +GLOBL ·libc_getpgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpgid_trampoline_addr(SB)/8, $libc_getpgid_trampoline<>(SB) + +TEXT libc_getpgrp_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpgrp(SB) +GLOBL ·libc_getpgrp_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpgrp_trampoline_addr(SB)/8, $libc_getpgrp_trampoline<>(SB) + +TEXT libc_getpid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpid(SB) +GLOBL ·libc_getpid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpid_trampoline_addr(SB)/8, $libc_getpid_trampoline<>(SB) + +TEXT libc_getppid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getppid(SB) +GLOBL ·libc_getppid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getppid_trampoline_addr(SB)/8, $libc_getppid_trampoline<>(SB) + +TEXT libc_getpriority_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpriority(SB) +GLOBL ·libc_getpriority_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpriority_trampoline_addr(SB)/8, $libc_getpriority_trampoline<>(SB) + +TEXT libc_getrlimit_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getrlimit(SB) +GLOBL ·libc_getrlimit_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getrlimit_trampoline_addr(SB)/8, $libc_getrlimit_trampoline<>(SB) + +TEXT libc_getrtable_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getrtable(SB) +GLOBL ·libc_getrtable_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getrtable_trampoline_addr(SB)/8, $libc_getrtable_trampoline<>(SB) + +TEXT libc_getrusage_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getrusage(SB) +GLOBL ·libc_getrusage_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getrusage_trampoline_addr(SB)/8, $libc_getrusage_trampoline<>(SB) + +TEXT libc_getsid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getsid(SB) +GLOBL ·libc_getsid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getsid_trampoline_addr(SB)/8, $libc_getsid_trampoline<>(SB) + +TEXT libc_gettimeofday_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_gettimeofday(SB) +GLOBL ·libc_gettimeofday_trampoline_addr(SB), RODATA, $8 +DATA ·libc_gettimeofday_trampoline_addr(SB)/8, $libc_gettimeofday_trampoline<>(SB) + +TEXT libc_getuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getuid(SB) +GLOBL ·libc_getuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getuid_trampoline_addr(SB)/8, $libc_getuid_trampoline<>(SB) + +TEXT libc_issetugid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_issetugid(SB) +GLOBL ·libc_issetugid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_issetugid_trampoline_addr(SB)/8, $libc_issetugid_trampoline<>(SB) + +TEXT libc_kill_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_kill(SB) +GLOBL ·libc_kill_trampoline_addr(SB), RODATA, $8 +DATA ·libc_kill_trampoline_addr(SB)/8, $libc_kill_trampoline<>(SB) + +TEXT libc_kqueue_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_kqueue(SB) +GLOBL ·libc_kqueue_trampoline_addr(SB), RODATA, $8 +DATA ·libc_kqueue_trampoline_addr(SB)/8, $libc_kqueue_trampoline<>(SB) + +TEXT libc_lchown_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_lchown(SB) +GLOBL ·libc_lchown_trampoline_addr(SB), RODATA, $8 +DATA ·libc_lchown_trampoline_addr(SB)/8, $libc_lchown_trampoline<>(SB) + +TEXT libc_link_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_link(SB) +GLOBL ·libc_link_trampoline_addr(SB), RODATA, $8 +DATA ·libc_link_trampoline_addr(SB)/8, $libc_link_trampoline<>(SB) + +TEXT libc_linkat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_linkat(SB) +GLOBL ·libc_linkat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_linkat_trampoline_addr(SB)/8, $libc_linkat_trampoline<>(SB) + +TEXT libc_listen_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_listen(SB) +GLOBL ·libc_listen_trampoline_addr(SB), RODATA, $8 +DATA ·libc_listen_trampoline_addr(SB)/8, $libc_listen_trampoline<>(SB) + +TEXT libc_lstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_lstat(SB) +GLOBL ·libc_lstat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_lstat_trampoline_addr(SB)/8, $libc_lstat_trampoline<>(SB) + +TEXT libc_mkdir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mkdir(SB) +GLOBL ·libc_mkdir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mkdir_trampoline_addr(SB)/8, $libc_mkdir_trampoline<>(SB) + +TEXT libc_mkdirat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mkdirat(SB) +GLOBL ·libc_mkdirat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mkdirat_trampoline_addr(SB)/8, $libc_mkdirat_trampoline<>(SB) + +TEXT libc_mkfifo_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mkfifo(SB) +GLOBL ·libc_mkfifo_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mkfifo_trampoline_addr(SB)/8, $libc_mkfifo_trampoline<>(SB) + +TEXT libc_mkfifoat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mkfifoat(SB) +GLOBL ·libc_mkfifoat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mkfifoat_trampoline_addr(SB)/8, $libc_mkfifoat_trampoline<>(SB) + +TEXT libc_mknod_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mknod(SB) +GLOBL ·libc_mknod_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mknod_trampoline_addr(SB)/8, $libc_mknod_trampoline<>(SB) + +TEXT libc_mknodat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mknodat(SB) +GLOBL ·libc_mknodat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mknodat_trampoline_addr(SB)/8, $libc_mknodat_trampoline<>(SB) + +TEXT libc_nanosleep_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_nanosleep(SB) +GLOBL ·libc_nanosleep_trampoline_addr(SB), RODATA, $8 +DATA ·libc_nanosleep_trampoline_addr(SB)/8, $libc_nanosleep_trampoline<>(SB) + +TEXT libc_open_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_open(SB) +GLOBL ·libc_open_trampoline_addr(SB), RODATA, $8 +DATA ·libc_open_trampoline_addr(SB)/8, $libc_open_trampoline<>(SB) + +TEXT libc_openat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_openat(SB) +GLOBL ·libc_openat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_openat_trampoline_addr(SB)/8, $libc_openat_trampoline<>(SB) + +TEXT libc_pathconf_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pathconf(SB) +GLOBL ·libc_pathconf_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pathconf_trampoline_addr(SB)/8, $libc_pathconf_trampoline<>(SB) + +TEXT libc_pread_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pread(SB) +GLOBL ·libc_pread_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pread_trampoline_addr(SB)/8, $libc_pread_trampoline<>(SB) + +TEXT libc_pwrite_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pwrite(SB) +GLOBL ·libc_pwrite_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pwrite_trampoline_addr(SB)/8, $libc_pwrite_trampoline<>(SB) + +TEXT libc_read_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_read(SB) +GLOBL ·libc_read_trampoline_addr(SB), RODATA, $8 +DATA ·libc_read_trampoline_addr(SB)/8, $libc_read_trampoline<>(SB) + +TEXT libc_readlink_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_readlink(SB) +GLOBL ·libc_readlink_trampoline_addr(SB), RODATA, $8 +DATA ·libc_readlink_trampoline_addr(SB)/8, $libc_readlink_trampoline<>(SB) + +TEXT libc_readlinkat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_readlinkat(SB) +GLOBL ·libc_readlinkat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_readlinkat_trampoline_addr(SB)/8, $libc_readlinkat_trampoline<>(SB) + +TEXT libc_rename_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_rename(SB) +GLOBL ·libc_rename_trampoline_addr(SB), RODATA, $8 +DATA ·libc_rename_trampoline_addr(SB)/8, $libc_rename_trampoline<>(SB) + +TEXT libc_renameat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_renameat(SB) +GLOBL ·libc_renameat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_renameat_trampoline_addr(SB)/8, $libc_renameat_trampoline<>(SB) + +TEXT libc_revoke_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_revoke(SB) +GLOBL ·libc_revoke_trampoline_addr(SB), RODATA, $8 +DATA ·libc_revoke_trampoline_addr(SB)/8, $libc_revoke_trampoline<>(SB) + +TEXT libc_rmdir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_rmdir(SB) +GLOBL ·libc_rmdir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_rmdir_trampoline_addr(SB)/8, $libc_rmdir_trampoline<>(SB) + +TEXT libc_lseek_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_lseek(SB) +GLOBL ·libc_lseek_trampoline_addr(SB), RODATA, $8 +DATA ·libc_lseek_trampoline_addr(SB)/8, $libc_lseek_trampoline<>(SB) + +TEXT libc_select_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_select(SB) +GLOBL ·libc_select_trampoline_addr(SB), RODATA, $8 +DATA ·libc_select_trampoline_addr(SB)/8, $libc_select_trampoline<>(SB) + +TEXT libc_setegid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setegid(SB) +GLOBL ·libc_setegid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setegid_trampoline_addr(SB)/8, $libc_setegid_trampoline<>(SB) + +TEXT libc_seteuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_seteuid(SB) +GLOBL ·libc_seteuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_seteuid_trampoline_addr(SB)/8, $libc_seteuid_trampoline<>(SB) + +TEXT libc_setgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setgid(SB) +GLOBL ·libc_setgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setgid_trampoline_addr(SB)/8, $libc_setgid_trampoline<>(SB) + +TEXT libc_setlogin_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setlogin(SB) +GLOBL ·libc_setlogin_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setlogin_trampoline_addr(SB)/8, $libc_setlogin_trampoline<>(SB) + +TEXT libc_setpgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setpgid(SB) +GLOBL ·libc_setpgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setpgid_trampoline_addr(SB)/8, $libc_setpgid_trampoline<>(SB) + +TEXT libc_setpriority_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setpriority(SB) +GLOBL ·libc_setpriority_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setpriority_trampoline_addr(SB)/8, $libc_setpriority_trampoline<>(SB) + +TEXT libc_setregid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setregid(SB) +GLOBL ·libc_setregid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setregid_trampoline_addr(SB)/8, $libc_setregid_trampoline<>(SB) + +TEXT libc_setreuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setreuid(SB) +GLOBL ·libc_setreuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setreuid_trampoline_addr(SB)/8, $libc_setreuid_trampoline<>(SB) + +TEXT libc_setresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setresgid(SB) +GLOBL ·libc_setresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setresgid_trampoline_addr(SB)/8, $libc_setresgid_trampoline<>(SB) + +TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setresuid(SB) +GLOBL ·libc_setresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setresuid_trampoline_addr(SB)/8, $libc_setresuid_trampoline<>(SB) + +TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setrtable(SB) +GLOBL ·libc_setrtable_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setrtable_trampoline_addr(SB)/8, $libc_setrtable_trampoline<>(SB) + +TEXT libc_setsid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setsid(SB) +GLOBL ·libc_setsid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setsid_trampoline_addr(SB)/8, $libc_setsid_trampoline<>(SB) + +TEXT libc_settimeofday_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_settimeofday(SB) +GLOBL ·libc_settimeofday_trampoline_addr(SB), RODATA, $8 +DATA ·libc_settimeofday_trampoline_addr(SB)/8, $libc_settimeofday_trampoline<>(SB) + +TEXT libc_setuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setuid(SB) +GLOBL ·libc_setuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setuid_trampoline_addr(SB)/8, $libc_setuid_trampoline<>(SB) + +TEXT libc_stat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_stat(SB) +GLOBL ·libc_stat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_stat_trampoline_addr(SB)/8, $libc_stat_trampoline<>(SB) + +TEXT libc_statfs_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_statfs(SB) +GLOBL ·libc_statfs_trampoline_addr(SB), RODATA, $8 +DATA ·libc_statfs_trampoline_addr(SB)/8, $libc_statfs_trampoline<>(SB) + +TEXT libc_symlink_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_symlink(SB) +GLOBL ·libc_symlink_trampoline_addr(SB), RODATA, $8 +DATA ·libc_symlink_trampoline_addr(SB)/8, $libc_symlink_trampoline<>(SB) + +TEXT libc_symlinkat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_symlinkat(SB) +GLOBL ·libc_symlinkat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_symlinkat_trampoline_addr(SB)/8, $libc_symlinkat_trampoline<>(SB) + +TEXT libc_sync_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sync(SB) +GLOBL ·libc_sync_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sync_trampoline_addr(SB)/8, $libc_sync_trampoline<>(SB) + +TEXT libc_truncate_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_truncate(SB) +GLOBL ·libc_truncate_trampoline_addr(SB), RODATA, $8 +DATA ·libc_truncate_trampoline_addr(SB)/8, $libc_truncate_trampoline<>(SB) + +TEXT libc_umask_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_umask(SB) +GLOBL ·libc_umask_trampoline_addr(SB), RODATA, $8 +DATA ·libc_umask_trampoline_addr(SB)/8, $libc_umask_trampoline<>(SB) + +TEXT libc_unlink_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unlink(SB) +GLOBL ·libc_unlink_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unlink_trampoline_addr(SB)/8, $libc_unlink_trampoline<>(SB) + +TEXT libc_unlinkat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unlinkat(SB) +GLOBL ·libc_unlinkat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unlinkat_trampoline_addr(SB)/8, $libc_unlinkat_trampoline<>(SB) + +TEXT libc_unmount_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unmount(SB) +GLOBL ·libc_unmount_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unmount_trampoline_addr(SB)/8, $libc_unmount_trampoline<>(SB) + +TEXT libc_write_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_write(SB) +GLOBL ·libc_write_trampoline_addr(SB), RODATA, $8 +DATA ·libc_write_trampoline_addr(SB)/8, $libc_write_trampoline<>(SB) + +TEXT libc_mmap_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mmap(SB) +GLOBL ·libc_mmap_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mmap_trampoline_addr(SB)/8, $libc_mmap_trampoline<>(SB) + +TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_munmap(SB) +GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 +DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) + +TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_utimensat(SB) +GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go index 016d959..b19e8aa 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go @@ -1,4 +1,4 @@ -// go run mksyscall.go -openbsd -tags openbsd,mips64 syscall_bsd.go syscall_openbsd.go syscall_openbsd_mips64.go +// go run mksyscall.go -openbsd -libc -tags openbsd,mips64 syscall_bsd.go syscall_openbsd.go syscall_openbsd_mips64.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build openbsd && mips64 @@ -16,7 +16,7 @@ var _ syscall.Errno // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func getgroups(ngid int, gid *_Gid_t) (n int, err error) { - r0, _, e1 := RawSyscall(SYS_GETGROUPS, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0) + r0, _, e1 := syscall_rawSyscall(libc_getgroups_trampoline_addr, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -24,20 +24,28 @@ func getgroups(ngid int, gid *_Gid_t) (n int, err error) { return } +var libc_getgroups_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getgroups getgroups "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func setgroups(ngid int, gid *_Gid_t) (err error) { - _, _, e1 := RawSyscall(SYS_SETGROUPS, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0) + _, _, e1 := syscall_rawSyscall(libc_setgroups_trampoline_addr, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setgroups_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setgroups setgroups "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func wait4(pid int, wstatus *_C_int, options int, rusage *Rusage) (wpid int, err error) { - r0, _, e1 := Syscall6(SYS_WAIT4, uintptr(pid), uintptr(unsafe.Pointer(wstatus)), uintptr(options), uintptr(unsafe.Pointer(rusage)), 0, 0) + r0, _, e1 := syscall_syscall6(libc_wait4_trampoline_addr, uintptr(pid), uintptr(unsafe.Pointer(wstatus)), uintptr(options), uintptr(unsafe.Pointer(rusage)), 0, 0) wpid = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -45,10 +53,14 @@ func wait4(pid int, wstatus *_C_int, options int, rusage *Rusage) (wpid int, err return } +var libc_wait4_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_wait4 wait4 "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { - r0, _, e1 := Syscall(SYS_ACCEPT, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + r0, _, e1 := syscall_syscall(libc_accept_trampoline_addr, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) fd = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -56,30 +68,42 @@ func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { return } +var libc_accept_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_accept accept "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { - _, _, e1 := Syscall(SYS_BIND, uintptr(s), uintptr(addr), uintptr(addrlen)) + _, _, e1 := syscall_syscall(libc_bind_trampoline_addr, uintptr(s), uintptr(addr), uintptr(addrlen)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_bind_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_bind bind "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func connect(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { - _, _, e1 := Syscall(SYS_CONNECT, uintptr(s), uintptr(addr), uintptr(addrlen)) + _, _, e1 := syscall_syscall(libc_connect_trampoline_addr, uintptr(s), uintptr(addr), uintptr(addrlen)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_connect_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_connect connect "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func socket(domain int, typ int, proto int) (fd int, err error) { - r0, _, e1 := RawSyscall(SYS_SOCKET, uintptr(domain), uintptr(typ), uintptr(proto)) + r0, _, e1 := syscall_rawSyscall(libc_socket_trampoline_addr, uintptr(domain), uintptr(typ), uintptr(proto)) fd = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -87,66 +111,94 @@ func socket(domain int, typ int, proto int) (fd int, err error) { return } +var libc_socket_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_socket socket "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func getsockopt(s int, level int, name int, val unsafe.Pointer, vallen *_Socklen) (err error) { - _, _, e1 := Syscall6(SYS_GETSOCKOPT, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(unsafe.Pointer(vallen)), 0) + _, _, e1 := syscall_syscall6(libc_getsockopt_trampoline_addr, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(unsafe.Pointer(vallen)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_getsockopt_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getsockopt getsockopt "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func setsockopt(s int, level int, name int, val unsafe.Pointer, vallen uintptr) (err error) { - _, _, e1 := Syscall6(SYS_SETSOCKOPT, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(vallen), 0) + _, _, e1 := syscall_syscall6(libc_setsockopt_trampoline_addr, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(vallen), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setsockopt_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setsockopt setsockopt "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func getpeername(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { - _, _, e1 := RawSyscall(SYS_GETPEERNAME, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + _, _, e1 := syscall_rawSyscall(libc_getpeername_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) if e1 != 0 { err = errnoErr(e1) } return } +var libc_getpeername_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpeername getpeername "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func getsockname(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { - _, _, e1 := RawSyscall(SYS_GETSOCKNAME, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + _, _, e1 := syscall_rawSyscall(libc_getsockname_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) if e1 != 0 { err = errnoErr(e1) } return } +var libc_getsockname_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getsockname getsockname "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Shutdown(s int, how int) (err error) { - _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(s), uintptr(how), 0) + _, _, e1 := syscall_syscall(libc_shutdown_trampoline_addr, uintptr(s), uintptr(how), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_shutdown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_shutdown shutdown "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func socketpair(domain int, typ int, proto int, fd *[2]int32) (err error) { - _, _, e1 := RawSyscall6(SYS_SOCKETPAIR, uintptr(domain), uintptr(typ), uintptr(proto), uintptr(unsafe.Pointer(fd)), 0, 0) + _, _, e1 := syscall_rawSyscall6(libc_socketpair_trampoline_addr, uintptr(domain), uintptr(typ), uintptr(proto), uintptr(unsafe.Pointer(fd)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_socketpair_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_socketpair socketpair "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Socklen) (n int, err error) { @@ -156,7 +208,7 @@ func recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Sockl } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall6(SYS_RECVFROM, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(flags), uintptr(unsafe.Pointer(from)), uintptr(unsafe.Pointer(fromlen))) + r0, _, e1 := syscall_syscall6(libc_recvfrom_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(flags), uintptr(unsafe.Pointer(from)), uintptr(unsafe.Pointer(fromlen))) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -164,6 +216,10 @@ func recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Sockl return } +var libc_recvfrom_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_recvfrom recvfrom "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) (err error) { @@ -173,17 +229,21 @@ func sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) ( } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall6(SYS_SENDTO, uintptr(s), uintptr(_p0), uintptr(len(buf)), uintptr(flags), uintptr(to), uintptr(addrlen)) + _, _, e1 := syscall_syscall6(libc_sendto_trampoline_addr, uintptr(s), uintptr(_p0), uintptr(len(buf)), uintptr(flags), uintptr(to), uintptr(addrlen)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_sendto_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sendto sendto "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func recvmsg(s int, msg *Msghdr, flags int) (n int, err error) { - r0, _, e1 := Syscall(SYS_RECVMSG, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) + r0, _, e1 := syscall_syscall(libc_recvmsg_trampoline_addr, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -191,10 +251,14 @@ func recvmsg(s int, msg *Msghdr, flags int) (n int, err error) { return } +var libc_recvmsg_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_recvmsg recvmsg "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) { - r0, _, e1 := Syscall(SYS_SENDMSG, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) + r0, _, e1 := syscall_syscall(libc_sendmsg_trampoline_addr, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -202,10 +266,14 @@ func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) { return } +var libc_sendmsg_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sendmsg sendmsg "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func kevent(kq int, change unsafe.Pointer, nchange int, event unsafe.Pointer, nevent int, timeout *Timespec) (n int, err error) { - r0, _, e1 := Syscall6(SYS_KEVENT, uintptr(kq), uintptr(change), uintptr(nchange), uintptr(event), uintptr(nevent), uintptr(unsafe.Pointer(timeout))) + r0, _, e1 := syscall_syscall6(libc_kevent_trampoline_addr, uintptr(kq), uintptr(change), uintptr(nchange), uintptr(event), uintptr(nevent), uintptr(unsafe.Pointer(timeout))) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -213,6 +281,10 @@ func kevent(kq int, change unsafe.Pointer, nchange int, event unsafe.Pointer, ne return } +var libc_kevent_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_kevent kevent "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func utimes(path string, timeval *[2]Timeval) (err error) { @@ -221,27 +293,35 @@ func utimes(path string, timeval *[2]Timeval) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_UTIMES, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(timeval)), 0) + _, _, e1 := syscall_syscall(libc_utimes_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(timeval)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_utimes_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_utimes utimes "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func futimes(fd int, timeval *[2]Timeval) (err error) { - _, _, e1 := Syscall(SYS_FUTIMES, uintptr(fd), uintptr(unsafe.Pointer(timeval)), 0) + _, _, e1 := syscall_syscall(libc_futimes_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(timeval)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_futimes_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_futimes futimes "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func poll(fds *PollFd, nfds int, timeout int) (n int, err error) { - r0, _, e1 := Syscall(SYS_POLL, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(timeout)) + r0, _, e1 := syscall_syscall(libc_poll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(timeout)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -249,6 +329,10 @@ func poll(fds *PollFd, nfds int, timeout int) (n int, err error) { return } +var libc_poll_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_poll poll "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Madvise(b []byte, behav int) (err error) { @@ -258,13 +342,17 @@ func Madvise(b []byte, behav int) (err error) { } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall(SYS_MADVISE, uintptr(_p0), uintptr(len(b)), uintptr(behav)) + _, _, e1 := syscall_syscall(libc_madvise_trampoline_addr, uintptr(_p0), uintptr(len(b)), uintptr(behav)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_madvise_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_madvise madvise "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mlock(b []byte) (err error) { @@ -274,23 +362,31 @@ func Mlock(b []byte) (err error) { } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall(SYS_MLOCK, uintptr(_p0), uintptr(len(b)), 0) + _, _, e1 := syscall_syscall(libc_mlock_trampoline_addr, uintptr(_p0), uintptr(len(b)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mlock_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mlock mlock "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mlockall(flags int) (err error) { - _, _, e1 := Syscall(SYS_MLOCKALL, uintptr(flags), 0, 0) + _, _, e1 := syscall_syscall(libc_mlockall_trampoline_addr, uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mlockall_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mlockall mlockall "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mprotect(b []byte, prot int) (err error) { @@ -300,13 +396,17 @@ func Mprotect(b []byte, prot int) (err error) { } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall(SYS_MPROTECT, uintptr(_p0), uintptr(len(b)), uintptr(prot)) + _, _, e1 := syscall_syscall(libc_mprotect_trampoline_addr, uintptr(_p0), uintptr(len(b)), uintptr(prot)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mprotect_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mprotect mprotect "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Msync(b []byte, flags int) (err error) { @@ -316,13 +416,17 @@ func Msync(b []byte, flags int) (err error) { } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall(SYS_MSYNC, uintptr(_p0), uintptr(len(b)), uintptr(flags)) + _, _, e1 := syscall_syscall(libc_msync_trampoline_addr, uintptr(_p0), uintptr(len(b)), uintptr(flags)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_msync_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_msync msync "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Munlock(b []byte) (err error) { @@ -332,33 +436,45 @@ func Munlock(b []byte) (err error) { } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall(SYS_MUNLOCK, uintptr(_p0), uintptr(len(b)), 0) + _, _, e1 := syscall_syscall(libc_munlock_trampoline_addr, uintptr(_p0), uintptr(len(b)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_munlock_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_munlock munlock "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Munlockall() (err error) { - _, _, e1 := Syscall(SYS_MUNLOCKALL, 0, 0, 0) + _, _, e1 := syscall_syscall(libc_munlockall_trampoline_addr, 0, 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_munlockall_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_munlockall munlockall "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func pipe2(p *[2]_C_int, flags int) (err error) { - _, _, e1 := RawSyscall(SYS_PIPE2, uintptr(unsafe.Pointer(p)), uintptr(flags), 0) + _, _, e1 := syscall_rawSyscall(libc_pipe2_trampoline_addr, uintptr(unsafe.Pointer(p)), uintptr(flags), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_pipe2_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pipe2 pipe2 "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getdents(fd int, buf []byte) (n int, err error) { @@ -368,7 +484,7 @@ func Getdents(fd int, buf []byte) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall(SYS_GETDENTS, uintptr(fd), uintptr(_p0), uintptr(len(buf))) + r0, _, e1 := syscall_syscall(libc_getdents_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(buf))) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -376,6 +492,10 @@ func Getdents(fd int, buf []byte) (n int, err error) { return } +var libc_getdents_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getdents getdents "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getcwd(buf []byte) (n int, err error) { @@ -385,7 +505,7 @@ func Getcwd(buf []byte) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall(SYS___GETCWD, uintptr(_p0), uintptr(len(buf)), 0) + r0, _, e1 := syscall_syscall(libc_getcwd_trampoline_addr, uintptr(_p0), uintptr(len(buf)), 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -393,16 +513,54 @@ func Getcwd(buf []byte) (n int, err error) { return } +var libc_getcwd_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getcwd getcwd "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func ioctl(fd int, req uint, arg uintptr) (err error) { - _, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg)) + _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { + _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -412,17 +570,21 @@ func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) } else { _p0 = unsafe.Pointer(&_zero) } - _, _, e1 := Syscall6(SYS___SYSCTL, uintptr(_p0), uintptr(len(mib)), uintptr(unsafe.Pointer(old)), uintptr(unsafe.Pointer(oldlen)), uintptr(unsafe.Pointer(new)), uintptr(newlen)) + _, _, e1 := syscall_syscall6(libc_sysctl_trampoline_addr, uintptr(_p0), uintptr(len(mib)), uintptr(unsafe.Pointer(old)), uintptr(unsafe.Pointer(oldlen)), uintptr(unsafe.Pointer(new)), uintptr(newlen)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_sysctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sysctl sysctl "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { - r0, _, e1 := Syscall6(SYS_PPOLL, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) + r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -430,6 +592,10 @@ func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, return } +var libc_ppoll_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ppoll ppoll "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Access(path string, mode uint32) (err error) { @@ -438,23 +604,31 @@ func Access(path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_ACCESS, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + _, _, e1 := syscall_syscall(libc_access_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_access_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_access access "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Adjtime(delta *Timeval, olddelta *Timeval) (err error) { - _, _, e1 := Syscall(SYS_ADJTIME, uintptr(unsafe.Pointer(delta)), uintptr(unsafe.Pointer(olddelta)), 0) + _, _, e1 := syscall_syscall(libc_adjtime_trampoline_addr, uintptr(unsafe.Pointer(delta)), uintptr(unsafe.Pointer(olddelta)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_adjtime_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_adjtime adjtime "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Chdir(path string) (err error) { @@ -463,13 +637,17 @@ func Chdir(path string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_CHDIR, uintptr(unsafe.Pointer(_p0)), 0, 0) + _, _, e1 := syscall_syscall(libc_chdir_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_chdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chdir chdir "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Chflags(path string, flags int) (err error) { @@ -478,13 +656,17 @@ func Chflags(path string, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_CHFLAGS, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) + _, _, e1 := syscall_syscall(libc_chflags_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_chflags_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chflags chflags "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Chmod(path string, mode uint32) (err error) { @@ -493,13 +675,17 @@ func Chmod(path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_CHMOD, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + _, _, e1 := syscall_syscall(libc_chmod_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_chmod_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chmod chmod "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Chown(path string, uid int, gid int) (err error) { @@ -508,13 +694,17 @@ func Chown(path string, uid int, gid int) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_CHOWN, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) + _, _, e1 := syscall_syscall(libc_chown_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_chown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chown chown "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Chroot(path string) (err error) { @@ -523,27 +713,49 @@ func Chroot(path string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_CHROOT, uintptr(unsafe.Pointer(_p0)), 0, 0) + _, _, e1 := syscall_syscall(libc_chroot_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_chroot_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chroot chroot "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ClockGettime(clockid int32, time *Timespec) (err error) { + _, _, e1 := syscall_syscall(libc_clock_gettime_trampoline_addr, uintptr(clockid), uintptr(unsafe.Pointer(time)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_clock_gettime_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_clock_gettime clock_gettime "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Close(fd int) (err error) { - _, _, e1 := Syscall(SYS_CLOSE, uintptr(fd), 0, 0) + _, _, e1 := syscall_syscall(libc_close_trampoline_addr, uintptr(fd), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_close_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_close close "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Dup(fd int) (nfd int, err error) { - r0, _, e1 := Syscall(SYS_DUP, uintptr(fd), 0, 0) + r0, _, e1 := syscall_syscall(libc_dup_trampoline_addr, uintptr(fd), 0, 0) nfd = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -551,33 +763,49 @@ func Dup(fd int) (nfd int, err error) { return } +var libc_dup_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_dup dup "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Dup2(from int, to int) (err error) { - _, _, e1 := Syscall(SYS_DUP2, uintptr(from), uintptr(to), 0) + _, _, e1 := syscall_syscall(libc_dup2_trampoline_addr, uintptr(from), uintptr(to), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_dup2_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_dup2 dup2 "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Dup3(from int, to int, flags int) (err error) { - _, _, e1 := Syscall(SYS_DUP3, uintptr(from), uintptr(to), uintptr(flags)) + _, _, e1 := syscall_syscall(libc_dup3_trampoline_addr, uintptr(from), uintptr(to), uintptr(flags)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_dup3_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_dup3 dup3 "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Exit(code int) { - Syscall(SYS_EXIT, uintptr(code), 0, 0) + syscall_syscall(libc_exit_trampoline_addr, uintptr(code), 0, 0) return } +var libc_exit_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_exit exit "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) { @@ -586,43 +814,59 @@ func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_FACCESSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) + _, _, e1 := syscall_syscall6(libc_faccessat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_faccessat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_faccessat faccessat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fchdir(fd int) (err error) { - _, _, e1 := Syscall(SYS_FCHDIR, uintptr(fd), 0, 0) + _, _, e1 := syscall_syscall(libc_fchdir_trampoline_addr, uintptr(fd), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fchdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchdir fchdir "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fchflags(fd int, flags int) (err error) { - _, _, e1 := Syscall(SYS_FCHFLAGS, uintptr(fd), uintptr(flags), 0) + _, _, e1 := syscall_syscall(libc_fchflags_trampoline_addr, uintptr(fd), uintptr(flags), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fchflags_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchflags fchflags "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fchmod(fd int, mode uint32) (err error) { - _, _, e1 := Syscall(SYS_FCHMOD, uintptr(fd), uintptr(mode), 0) + _, _, e1 := syscall_syscall(libc_fchmod_trampoline_addr, uintptr(fd), uintptr(mode), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fchmod_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchmod fchmod "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) { @@ -631,23 +875,31 @@ func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_FCHMODAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) + _, _, e1 := syscall_syscall6(libc_fchmodat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fchmodat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchmodat fchmodat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fchown(fd int, uid int, gid int) (err error) { - _, _, e1 := Syscall(SYS_FCHOWN, uintptr(fd), uintptr(uid), uintptr(gid)) + _, _, e1 := syscall_syscall(libc_fchown_trampoline_addr, uintptr(fd), uintptr(uid), uintptr(gid)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fchown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchown fchown "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fchownat(dirfd int, path string, uid int, gid int, flags int) (err error) { @@ -656,27 +908,35 @@ func Fchownat(dirfd int, path string, uid int, gid int, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_FCHOWNAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), uintptr(flags), 0) + _, _, e1 := syscall_syscall6(libc_fchownat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), uintptr(flags), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fchownat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchownat fchownat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Flock(fd int, how int) (err error) { - _, _, e1 := Syscall(SYS_FLOCK, uintptr(fd), uintptr(how), 0) + _, _, e1 := syscall_syscall(libc_flock_trampoline_addr, uintptr(fd), uintptr(how), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_flock_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_flock flock "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fpathconf(fd int, name int) (val int, err error) { - r0, _, e1 := Syscall(SYS_FPATHCONF, uintptr(fd), uintptr(name), 0) + r0, _, e1 := syscall_syscall(libc_fpathconf_trampoline_addr, uintptr(fd), uintptr(name), 0) val = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -684,16 +944,24 @@ func Fpathconf(fd int, name int) (val int, err error) { return } +var libc_fpathconf_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fpathconf fpathconf "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fstat(fd int, stat *Stat_t) (err error) { - _, _, e1 := Syscall(SYS_FSTAT, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) + _, _, e1 := syscall_syscall(libc_fstat_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fstat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fstat fstat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) { @@ -702,71 +970,99 @@ func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_FSTATAT, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), uintptr(flags), 0, 0) + _, _, e1 := syscall_syscall6(libc_fstatat_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fstatat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fstatat fstatat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fstatfs(fd int, stat *Statfs_t) (err error) { - _, _, e1 := Syscall(SYS_FSTATFS, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) + _, _, e1 := syscall_syscall(libc_fstatfs_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fstatfs_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fstatfs fstatfs "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Fsync(fd int) (err error) { - _, _, e1 := Syscall(SYS_FSYNC, uintptr(fd), 0, 0) + _, _, e1 := syscall_syscall(libc_fsync_trampoline_addr, uintptr(fd), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_fsync_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fsync fsync "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Ftruncate(fd int, length int64) (err error) { - _, _, e1 := Syscall(SYS_FTRUNCATE, uintptr(fd), 0, uintptr(length)) + _, _, e1 := syscall_syscall(libc_ftruncate_trampoline_addr, uintptr(fd), uintptr(length), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_ftruncate_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ftruncate ftruncate "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getegid() (egid int) { - r0, _, _ := RawSyscall(SYS_GETEGID, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_getegid_trampoline_addr, 0, 0, 0) egid = int(r0) return } +var libc_getegid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getegid getegid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Geteuid() (uid int) { - r0, _, _ := RawSyscall(SYS_GETEUID, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_geteuid_trampoline_addr, 0, 0, 0) uid = int(r0) return } +var libc_geteuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_geteuid geteuid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getgid() (gid int) { - r0, _, _ := RawSyscall(SYS_GETGID, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_getgid_trampoline_addr, 0, 0, 0) gid = int(r0) return } +var libc_getgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getgid getgid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getpgid(pid int) (pgid int, err error) { - r0, _, e1 := RawSyscall(SYS_GETPGID, uintptr(pid), 0, 0) + r0, _, e1 := syscall_rawSyscall(libc_getpgid_trampoline_addr, uintptr(pid), 0, 0) pgid = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -774,34 +1070,50 @@ func Getpgid(pid int) (pgid int, err error) { return } +var libc_getpgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpgid getpgid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getpgrp() (pgrp int) { - r0, _, _ := RawSyscall(SYS_GETPGRP, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_getpgrp_trampoline_addr, 0, 0, 0) pgrp = int(r0) return } +var libc_getpgrp_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpgrp getpgrp "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getpid() (pid int) { - r0, _, _ := RawSyscall(SYS_GETPID, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_getpid_trampoline_addr, 0, 0, 0) pid = int(r0) return } +var libc_getpid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpid getpid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getppid() (ppid int) { - r0, _, _ := RawSyscall(SYS_GETPPID, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_getppid_trampoline_addr, 0, 0, 0) ppid = int(r0) return } +var libc_getppid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getppid getppid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getpriority(which int, who int) (prio int, err error) { - r0, _, e1 := Syscall(SYS_GETPRIORITY, uintptr(which), uintptr(who), 0) + r0, _, e1 := syscall_syscall(libc_getpriority_trampoline_addr, uintptr(which), uintptr(who), 0) prio = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -809,20 +1121,28 @@ func Getpriority(which int, who int) (prio int, err error) { return } +var libc_getpriority_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpriority getpriority "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_GETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) + _, _, e1 := syscall_rawSyscall(libc_getrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_getrlimit_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getrlimit getrlimit "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getrtable() (rtable int, err error) { - r0, _, e1 := RawSyscall(SYS_GETRTABLE, 0, 0, 0) + r0, _, e1 := syscall_rawSyscall(libc_getrtable_trampoline_addr, 0, 0, 0) rtable = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -830,20 +1150,28 @@ func Getrtable() (rtable int, err error) { return } +var libc_getrtable_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getrtable getrtable "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getrusage(who int, rusage *Rusage) (err error) { - _, _, e1 := RawSyscall(SYS_GETRUSAGE, uintptr(who), uintptr(unsafe.Pointer(rusage)), 0) + _, _, e1 := syscall_rawSyscall(libc_getrusage_trampoline_addr, uintptr(who), uintptr(unsafe.Pointer(rusage)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_getrusage_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getrusage getrusage "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getsid(pid int) (sid int, err error) { - r0, _, e1 := RawSyscall(SYS_GETSID, uintptr(pid), 0, 0) + r0, _, e1 := syscall_rawSyscall(libc_getsid_trampoline_addr, uintptr(pid), 0, 0) sid = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -851,46 +1179,66 @@ func Getsid(pid int) (sid int, err error) { return } +var libc_getsid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getsid getsid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Gettimeofday(tv *Timeval) (err error) { - _, _, e1 := RawSyscall(SYS_GETTIMEOFDAY, uintptr(unsafe.Pointer(tv)), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_gettimeofday_trampoline_addr, uintptr(unsafe.Pointer(tv)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_gettimeofday_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_gettimeofday gettimeofday "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Getuid() (uid int) { - r0, _, _ := RawSyscall(SYS_GETUID, 0, 0, 0) + r0, _, _ := syscall_rawSyscall(libc_getuid_trampoline_addr, 0, 0, 0) uid = int(r0) return } +var libc_getuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getuid getuid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Issetugid() (tainted bool) { - r0, _, _ := Syscall(SYS_ISSETUGID, 0, 0, 0) + r0, _, _ := syscall_syscall(libc_issetugid_trampoline_addr, 0, 0, 0) tainted = bool(r0 != 0) return } +var libc_issetugid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_issetugid issetugid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Kill(pid int, signum syscall.Signal) (err error) { - _, _, e1 := Syscall(SYS_KILL, uintptr(pid), uintptr(signum), 0) + _, _, e1 := syscall_syscall(libc_kill_trampoline_addr, uintptr(pid), uintptr(signum), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_kill_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_kill kill "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Kqueue() (fd int, err error) { - r0, _, e1 := Syscall(SYS_KQUEUE, 0, 0, 0) + r0, _, e1 := syscall_syscall(libc_kqueue_trampoline_addr, 0, 0, 0) fd = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -898,6 +1246,10 @@ func Kqueue() (fd int, err error) { return } +var libc_kqueue_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_kqueue kqueue "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Lchown(path string, uid int, gid int) (err error) { @@ -906,13 +1258,17 @@ func Lchown(path string, uid int, gid int) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_LCHOWN, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) + _, _, e1 := syscall_syscall(libc_lchown_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_lchown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_lchown lchown "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Link(path string, link string) (err error) { @@ -926,13 +1282,17 @@ func Link(path string, link string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_LINK, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) + _, _, e1 := syscall_syscall(libc_link_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_link_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_link link "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Linkat(pathfd int, path string, linkfd int, link string, flags int) (err error) { @@ -946,23 +1306,31 @@ func Linkat(pathfd int, path string, linkfd int, link string, flags int) (err er if err != nil { return } - _, _, e1 := Syscall6(SYS_LINKAT, uintptr(pathfd), uintptr(unsafe.Pointer(_p0)), uintptr(linkfd), uintptr(unsafe.Pointer(_p1)), uintptr(flags), 0) + _, _, e1 := syscall_syscall6(libc_linkat_trampoline_addr, uintptr(pathfd), uintptr(unsafe.Pointer(_p0)), uintptr(linkfd), uintptr(unsafe.Pointer(_p1)), uintptr(flags), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_linkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_linkat linkat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Listen(s int, backlog int) (err error) { - _, _, e1 := Syscall(SYS_LISTEN, uintptr(s), uintptr(backlog), 0) + _, _, e1 := syscall_syscall(libc_listen_trampoline_addr, uintptr(s), uintptr(backlog), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_listen_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_listen listen "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Lstat(path string, stat *Stat_t) (err error) { @@ -971,13 +1339,17 @@ func Lstat(path string, stat *Stat_t) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_LSTAT, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) + _, _, e1 := syscall_syscall(libc_lstat_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_lstat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_lstat lstat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mkdir(path string, mode uint32) (err error) { @@ -986,13 +1358,17 @@ func Mkdir(path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_MKDIR, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + _, _, e1 := syscall_syscall(libc_mkdir_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mkdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkdir mkdir "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mkdirat(dirfd int, path string, mode uint32) (err error) { @@ -1001,13 +1377,17 @@ func Mkdirat(dirfd int, path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_MKDIRAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) + _, _, e1 := syscall_syscall(libc_mkdirat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mkdirat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkdirat mkdirat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mkfifo(path string, mode uint32) (err error) { @@ -1016,13 +1396,17 @@ func Mkfifo(path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_MKFIFO, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + _, _, e1 := syscall_syscall(libc_mkfifo_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mkfifo_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkfifo mkfifo "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mkfifoat(dirfd int, path string, mode uint32) (err error) { @@ -1031,13 +1415,17 @@ func Mkfifoat(dirfd int, path string, mode uint32) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_MKFIFOAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) + _, _, e1 := syscall_syscall(libc_mkfifoat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mkfifoat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkfifoat mkfifoat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mknod(path string, mode uint32, dev int) (err error) { @@ -1046,13 +1434,17 @@ func Mknod(path string, mode uint32, dev int) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_MKNOD, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev)) + _, _, e1 := syscall_syscall(libc_mknod_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mknod_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mknod mknod "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Mknodat(dirfd int, path string, mode uint32, dev int) (err error) { @@ -1061,23 +1453,31 @@ func Mknodat(dirfd int, path string, mode uint32, dev int) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_MKNODAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0) + _, _, e1 := syscall_syscall6(libc_mknodat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_mknodat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mknodat mknodat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Nanosleep(time *Timespec, leftover *Timespec) (err error) { - _, _, e1 := Syscall(SYS_NANOSLEEP, uintptr(unsafe.Pointer(time)), uintptr(unsafe.Pointer(leftover)), 0) + _, _, e1 := syscall_syscall(libc_nanosleep_trampoline_addr, uintptr(unsafe.Pointer(time)), uintptr(unsafe.Pointer(leftover)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_nanosleep_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_nanosleep nanosleep "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Open(path string, mode int, perm uint32) (fd int, err error) { @@ -1086,7 +1486,7 @@ func Open(path string, mode int, perm uint32) (fd int, err error) { if err != nil { return } - r0, _, e1 := Syscall(SYS_OPEN, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm)) + r0, _, e1 := syscall_syscall(libc_open_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm)) fd = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1094,6 +1494,10 @@ func Open(path string, mode int, perm uint32) (fd int, err error) { return } +var libc_open_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_open open "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Openat(dirfd int, path string, mode int, perm uint32) (fd int, err error) { @@ -1102,7 +1506,7 @@ func Openat(dirfd int, path string, mode int, perm uint32) (fd int, err error) { if err != nil { return } - r0, _, e1 := Syscall6(SYS_OPENAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm), 0, 0) + r0, _, e1 := syscall_syscall6(libc_openat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm), 0, 0) fd = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1110,6 +1514,10 @@ func Openat(dirfd int, path string, mode int, perm uint32) (fd int, err error) { return } +var libc_openat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_openat openat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Pathconf(path string, name int) (val int, err error) { @@ -1118,7 +1526,7 @@ func Pathconf(path string, name int) (val int, err error) { if err != nil { return } - r0, _, e1 := Syscall(SYS_PATHCONF, uintptr(unsafe.Pointer(_p0)), uintptr(name), 0) + r0, _, e1 := syscall_syscall(libc_pathconf_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(name), 0) val = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1126,6 +1534,10 @@ func Pathconf(path string, name int) (val int, err error) { return } +var libc_pathconf_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pathconf pathconf "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func pread(fd int, p []byte, offset int64) (n int, err error) { @@ -1135,7 +1547,7 @@ func pread(fd int, p []byte, offset int64) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall6(SYS_PREAD, uintptr(fd), uintptr(_p0), uintptr(len(p)), 0, uintptr(offset), 0) + r0, _, e1 := syscall_syscall6(libc_pread_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(offset), 0, 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1143,6 +1555,10 @@ func pread(fd int, p []byte, offset int64) (n int, err error) { return } +var libc_pread_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pread pread "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func pwrite(fd int, p []byte, offset int64) (n int, err error) { @@ -1152,7 +1568,7 @@ func pwrite(fd int, p []byte, offset int64) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall6(SYS_PWRITE, uintptr(fd), uintptr(_p0), uintptr(len(p)), 0, uintptr(offset), 0) + r0, _, e1 := syscall_syscall6(libc_pwrite_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(offset), 0, 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1160,6 +1576,10 @@ func pwrite(fd int, p []byte, offset int64) (n int, err error) { return } +var libc_pwrite_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pwrite pwrite "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func read(fd int, p []byte) (n int, err error) { @@ -1169,7 +1589,7 @@ func read(fd int, p []byte) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(_p0), uintptr(len(p))) + r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p))) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1177,6 +1597,10 @@ func read(fd int, p []byte) (n int, err error) { return } +var libc_read_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_read read "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Readlink(path string, buf []byte) (n int, err error) { @@ -1191,7 +1615,7 @@ func Readlink(path string, buf []byte) (n int, err error) { } else { _p1 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall(SYS_READLINK, uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf))) + r0, _, e1 := syscall_syscall(libc_readlink_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf))) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1199,6 +1623,10 @@ func Readlink(path string, buf []byte) (n int, err error) { return } +var libc_readlink_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_readlink readlink "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Readlinkat(dirfd int, path string, buf []byte) (n int, err error) { @@ -1213,7 +1641,7 @@ func Readlinkat(dirfd int, path string, buf []byte) (n int, err error) { } else { _p1 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall6(SYS_READLINKAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf)), 0, 0) + r0, _, e1 := syscall_syscall6(libc_readlinkat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf)), 0, 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1221,6 +1649,10 @@ func Readlinkat(dirfd int, path string, buf []byte) (n int, err error) { return } +var libc_readlinkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_readlinkat readlinkat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Rename(from string, to string) (err error) { @@ -1234,13 +1666,17 @@ func Rename(from string, to string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_RENAME, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) + _, _, e1 := syscall_syscall(libc_rename_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_rename_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_rename rename "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Renameat(fromfd int, from string, tofd int, to string) (err error) { @@ -1254,13 +1690,17 @@ func Renameat(fromfd int, from string, tofd int, to string) (err error) { if err != nil { return } - _, _, e1 := Syscall6(SYS_RENAMEAT, uintptr(fromfd), uintptr(unsafe.Pointer(_p0)), uintptr(tofd), uintptr(unsafe.Pointer(_p1)), 0, 0) + _, _, e1 := syscall_syscall6(libc_renameat_trampoline_addr, uintptr(fromfd), uintptr(unsafe.Pointer(_p0)), uintptr(tofd), uintptr(unsafe.Pointer(_p1)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_renameat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_renameat renameat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Revoke(path string) (err error) { @@ -1269,13 +1709,17 @@ func Revoke(path string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_REVOKE, uintptr(unsafe.Pointer(_p0)), 0, 0) + _, _, e1 := syscall_syscall(libc_revoke_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_revoke_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_revoke revoke "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Rmdir(path string) (err error) { @@ -1284,17 +1728,21 @@ func Rmdir(path string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_RMDIR, uintptr(unsafe.Pointer(_p0)), 0, 0) + _, _, e1 := syscall_syscall(libc_rmdir_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_rmdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_rmdir rmdir "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Seek(fd int, offset int64, whence int) (newoffset int64, err error) { - r0, _, e1 := Syscall6(SYS_LSEEK, uintptr(fd), 0, uintptr(offset), uintptr(whence), 0, 0) + r0, _, e1 := syscall_syscall(libc_lseek_trampoline_addr, uintptr(fd), uintptr(offset), uintptr(whence)) newoffset = int64(r0) if e1 != 0 { err = errnoErr(e1) @@ -1302,10 +1750,14 @@ func Seek(fd int, offset int64, whence int) (newoffset int64, err error) { return } +var libc_lseek_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_lseek lseek "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err error) { - r0, _, e1 := Syscall6(SYS_SELECT, uintptr(nfd), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), 0) + r0, _, e1 := syscall_syscall6(libc_select_trampoline_addr, uintptr(nfd), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), 0) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1313,36 +1765,52 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err return } +var libc_select_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_select select "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setegid(egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETEGID, uintptr(egid), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_setegid_trampoline_addr, uintptr(egid), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setegid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setegid setegid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Seteuid(euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETEUID, uintptr(euid), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_seteuid_trampoline_addr, uintptr(euid), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_seteuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_seteuid seteuid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setgid(gid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETGID, uintptr(gid), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_setgid_trampoline_addr, uintptr(gid), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setgid setgid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setlogin(name string) (err error) { @@ -1351,97 +1819,119 @@ func Setlogin(name string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_SETLOGIN, uintptr(unsafe.Pointer(_p0)), 0, 0) + _, _, e1 := syscall_syscall(libc_setlogin_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setlogin_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setlogin setlogin "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setpgid(pid int, pgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETPGID, uintptr(pid), uintptr(pgid), 0) + _, _, e1 := syscall_rawSyscall(libc_setpgid_trampoline_addr, uintptr(pid), uintptr(pgid), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setpgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setpgid setpgid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setpriority(which int, who int, prio int) (err error) { - _, _, e1 := Syscall(SYS_SETPRIORITY, uintptr(which), uintptr(who), uintptr(prio)) + _, _, e1 := syscall_syscall(libc_setpriority_trampoline_addr, uintptr(which), uintptr(who), uintptr(prio)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setpriority_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setpriority setpriority "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) + _, _, e1 := syscall_rawSyscall(libc_setregid_trampoline_addr, uintptr(rgid), uintptr(egid), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setregid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setregid setregid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) + _, _, e1 := syscall_rawSyscall(libc_setreuid_trampoline_addr, uintptr(ruid), uintptr(euid), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setreuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setreuid setreuid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) + _, _, e1 := syscall_rawSyscall(libc_setresgid_trampoline_addr, uintptr(rgid), uintptr(egid), uintptr(sgid)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setresgid setresgid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) + _, _, e1 := syscall_rawSyscall(libc_setresuid_trampoline_addr, uintptr(ruid), uintptr(euid), uintptr(suid)) if e1 != 0 { err = errnoErr(e1) } return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +var libc_setresuid_trampoline_addr uintptr -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} +//go:cgo_import_dynamic libc_setresuid setresuid "libc.so" // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setrtable(rtable int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRTABLE, uintptr(rtable), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setrtable_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setrtable setrtable "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setsid() (pid int, err error) { - r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) + r0, _, e1 := syscall_rawSyscall(libc_setsid_trampoline_addr, 0, 0, 0) pid = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1449,26 +1939,38 @@ func Setsid() (pid int, err error) { return } +var libc_setsid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setsid setsid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Settimeofday(tp *Timeval) (err error) { - _, _, e1 := RawSyscall(SYS_SETTIMEOFDAY, uintptr(unsafe.Pointer(tp)), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_settimeofday_trampoline_addr, uintptr(unsafe.Pointer(tp)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_settimeofday_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_settimeofday settimeofday "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Setuid(uid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETUID, uintptr(uid), 0, 0) + _, _, e1 := syscall_rawSyscall(libc_setuid_trampoline_addr, uintptr(uid), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_setuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setuid setuid "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Stat(path string, stat *Stat_t) (err error) { @@ -1477,13 +1979,17 @@ func Stat(path string, stat *Stat_t) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_STAT, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) + _, _, e1 := syscall_syscall(libc_stat_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_stat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_stat stat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Statfs(path string, stat *Statfs_t) (err error) { @@ -1492,13 +1998,17 @@ func Statfs(path string, stat *Statfs_t) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_STATFS, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) + _, _, e1 := syscall_syscall(libc_statfs_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_statfs_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_statfs statfs "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Symlink(path string, link string) (err error) { @@ -1512,13 +2022,17 @@ func Symlink(path string, link string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_SYMLINK, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) + _, _, e1 := syscall_syscall(libc_symlink_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_symlink_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_symlink symlink "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Symlinkat(oldpath string, newdirfd int, newpath string) (err error) { @@ -1532,23 +2046,31 @@ func Symlinkat(oldpath string, newdirfd int, newpath string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_SYMLINKAT, uintptr(unsafe.Pointer(_p0)), uintptr(newdirfd), uintptr(unsafe.Pointer(_p1))) + _, _, e1 := syscall_syscall(libc_symlinkat_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(newdirfd), uintptr(unsafe.Pointer(_p1))) if e1 != 0 { err = errnoErr(e1) } return } +var libc_symlinkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_symlinkat symlinkat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Sync() (err error) { - _, _, e1 := Syscall(SYS_SYNC, 0, 0, 0) + _, _, e1 := syscall_syscall(libc_sync_trampoline_addr, 0, 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_sync_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sync sync "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Truncate(path string, length int64) (err error) { @@ -1557,21 +2079,29 @@ func Truncate(path string, length int64) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_TRUNCATE, uintptr(unsafe.Pointer(_p0)), 0, uintptr(length)) + _, _, e1 := syscall_syscall(libc_truncate_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(length), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_truncate_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_truncate truncate "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Umask(newmask int) (oldmask int) { - r0, _, _ := Syscall(SYS_UMASK, uintptr(newmask), 0, 0) + r0, _, _ := syscall_syscall(libc_umask_trampoline_addr, uintptr(newmask), 0, 0) oldmask = int(r0) return } +var libc_umask_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_umask umask "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Unlink(path string) (err error) { @@ -1580,13 +2110,17 @@ func Unlink(path string) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_UNLINK, uintptr(unsafe.Pointer(_p0)), 0, 0) + _, _, e1 := syscall_syscall(libc_unlink_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_unlink_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unlink unlink "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Unlinkat(dirfd int, path string, flags int) (err error) { @@ -1595,13 +2129,17 @@ func Unlinkat(dirfd int, path string, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_UNLINKAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(flags)) + _, _, e1 := syscall_syscall(libc_unlinkat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(flags)) if e1 != 0 { err = errnoErr(e1) } return } +var libc_unlinkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unlinkat unlinkat "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func Unmount(path string, flags int) (err error) { @@ -1610,13 +2148,17 @@ func Unmount(path string, flags int) (err error) { if err != nil { return } - _, _, e1 := Syscall(SYS_UNMOUNT, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) + _, _, e1 := syscall_syscall(libc_unmount_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_unmount_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unmount unmount "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func write(fd int, p []byte) (n int, err error) { @@ -1626,7 +2168,7 @@ func write(fd int, p []byte) (n int, err error) { } else { _p0 = unsafe.Pointer(&_zero) } - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(_p0), uintptr(len(p))) + r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p))) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1634,10 +2176,14 @@ func write(fd int, p []byte) (n int, err error) { return } +var libc_write_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_write write "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) { - r0, _, e1 := Syscall9(SYS_MMAP, uintptr(addr), uintptr(length), uintptr(prot), uintptr(flag), uintptr(fd), 0, uintptr(pos), 0, 0) + r0, _, e1 := syscall_syscall6(libc_mmap_trampoline_addr, uintptr(addr), uintptr(length), uintptr(prot), uintptr(flag), uintptr(fd), uintptr(pos)) ret = uintptr(r0) if e1 != 0 { err = errnoErr(e1) @@ -1645,20 +2191,28 @@ func mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) ( return } +var libc_mmap_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mmap mmap "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func munmap(addr uintptr, length uintptr) (err error) { - _, _, e1 := Syscall(SYS_MUNMAP, uintptr(addr), uintptr(length), 0) + _, _, e1 := syscall_syscall(libc_munmap_trampoline_addr, uintptr(addr), uintptr(length), 0) if e1 != 0 { err = errnoErr(e1) } return } +var libc_munmap_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_munmap munmap "libc.so" + // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) + r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1669,7 +2223,7 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) + r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -1685,9 +2239,13 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error if err != nil { return } - _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) + _, _, e1 := syscall_syscall6(libc_utimensat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } + +var libc_utimensat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_utimensat utimensat "libc.so" diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s new file mode 100644 index 0000000..b4e7bce --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s @@ -0,0 +1,674 @@ +// go run mkasm.go openbsd mips64 +// Code generated by the command above; DO NOT EDIT. + +#include "textflag.h" + +TEXT libc_getgroups_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getgroups(SB) +GLOBL ·libc_getgroups_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getgroups_trampoline_addr(SB)/8, $libc_getgroups_trampoline<>(SB) + +TEXT libc_setgroups_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setgroups(SB) +GLOBL ·libc_setgroups_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setgroups_trampoline_addr(SB)/8, $libc_setgroups_trampoline<>(SB) + +TEXT libc_wait4_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_wait4(SB) +GLOBL ·libc_wait4_trampoline_addr(SB), RODATA, $8 +DATA ·libc_wait4_trampoline_addr(SB)/8, $libc_wait4_trampoline<>(SB) + +TEXT libc_accept_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_accept(SB) +GLOBL ·libc_accept_trampoline_addr(SB), RODATA, $8 +DATA ·libc_accept_trampoline_addr(SB)/8, $libc_accept_trampoline<>(SB) + +TEXT libc_bind_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_bind(SB) +GLOBL ·libc_bind_trampoline_addr(SB), RODATA, $8 +DATA ·libc_bind_trampoline_addr(SB)/8, $libc_bind_trampoline<>(SB) + +TEXT libc_connect_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_connect(SB) +GLOBL ·libc_connect_trampoline_addr(SB), RODATA, $8 +DATA ·libc_connect_trampoline_addr(SB)/8, $libc_connect_trampoline<>(SB) + +TEXT libc_socket_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_socket(SB) +GLOBL ·libc_socket_trampoline_addr(SB), RODATA, $8 +DATA ·libc_socket_trampoline_addr(SB)/8, $libc_socket_trampoline<>(SB) + +TEXT libc_getsockopt_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getsockopt(SB) +GLOBL ·libc_getsockopt_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getsockopt_trampoline_addr(SB)/8, $libc_getsockopt_trampoline<>(SB) + +TEXT libc_setsockopt_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setsockopt(SB) +GLOBL ·libc_setsockopt_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setsockopt_trampoline_addr(SB)/8, $libc_setsockopt_trampoline<>(SB) + +TEXT libc_getpeername_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpeername(SB) +GLOBL ·libc_getpeername_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpeername_trampoline_addr(SB)/8, $libc_getpeername_trampoline<>(SB) + +TEXT libc_getsockname_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getsockname(SB) +GLOBL ·libc_getsockname_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getsockname_trampoline_addr(SB)/8, $libc_getsockname_trampoline<>(SB) + +TEXT libc_shutdown_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_shutdown(SB) +GLOBL ·libc_shutdown_trampoline_addr(SB), RODATA, $8 +DATA ·libc_shutdown_trampoline_addr(SB)/8, $libc_shutdown_trampoline<>(SB) + +TEXT libc_socketpair_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_socketpair(SB) +GLOBL ·libc_socketpair_trampoline_addr(SB), RODATA, $8 +DATA ·libc_socketpair_trampoline_addr(SB)/8, $libc_socketpair_trampoline<>(SB) + +TEXT libc_recvfrom_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_recvfrom(SB) +GLOBL ·libc_recvfrom_trampoline_addr(SB), RODATA, $8 +DATA ·libc_recvfrom_trampoline_addr(SB)/8, $libc_recvfrom_trampoline<>(SB) + +TEXT libc_sendto_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sendto(SB) +GLOBL ·libc_sendto_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sendto_trampoline_addr(SB)/8, $libc_sendto_trampoline<>(SB) + +TEXT libc_recvmsg_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_recvmsg(SB) +GLOBL ·libc_recvmsg_trampoline_addr(SB), RODATA, $8 +DATA ·libc_recvmsg_trampoline_addr(SB)/8, $libc_recvmsg_trampoline<>(SB) + +TEXT libc_sendmsg_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sendmsg(SB) +GLOBL ·libc_sendmsg_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sendmsg_trampoline_addr(SB)/8, $libc_sendmsg_trampoline<>(SB) + +TEXT libc_kevent_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_kevent(SB) +GLOBL ·libc_kevent_trampoline_addr(SB), RODATA, $8 +DATA ·libc_kevent_trampoline_addr(SB)/8, $libc_kevent_trampoline<>(SB) + +TEXT libc_utimes_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_utimes(SB) +GLOBL ·libc_utimes_trampoline_addr(SB), RODATA, $8 +DATA ·libc_utimes_trampoline_addr(SB)/8, $libc_utimes_trampoline<>(SB) + +TEXT libc_futimes_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_futimes(SB) +GLOBL ·libc_futimes_trampoline_addr(SB), RODATA, $8 +DATA ·libc_futimes_trampoline_addr(SB)/8, $libc_futimes_trampoline<>(SB) + +TEXT libc_poll_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_poll(SB) +GLOBL ·libc_poll_trampoline_addr(SB), RODATA, $8 +DATA ·libc_poll_trampoline_addr(SB)/8, $libc_poll_trampoline<>(SB) + +TEXT libc_madvise_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_madvise(SB) +GLOBL ·libc_madvise_trampoline_addr(SB), RODATA, $8 +DATA ·libc_madvise_trampoline_addr(SB)/8, $libc_madvise_trampoline<>(SB) + +TEXT libc_mlock_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mlock(SB) +GLOBL ·libc_mlock_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mlock_trampoline_addr(SB)/8, $libc_mlock_trampoline<>(SB) + +TEXT libc_mlockall_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mlockall(SB) +GLOBL ·libc_mlockall_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mlockall_trampoline_addr(SB)/8, $libc_mlockall_trampoline<>(SB) + +TEXT libc_mprotect_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mprotect(SB) +GLOBL ·libc_mprotect_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mprotect_trampoline_addr(SB)/8, $libc_mprotect_trampoline<>(SB) + +TEXT libc_msync_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_msync(SB) +GLOBL ·libc_msync_trampoline_addr(SB), RODATA, $8 +DATA ·libc_msync_trampoline_addr(SB)/8, $libc_msync_trampoline<>(SB) + +TEXT libc_munlock_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_munlock(SB) +GLOBL ·libc_munlock_trampoline_addr(SB), RODATA, $8 +DATA ·libc_munlock_trampoline_addr(SB)/8, $libc_munlock_trampoline<>(SB) + +TEXT libc_munlockall_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_munlockall(SB) +GLOBL ·libc_munlockall_trampoline_addr(SB), RODATA, $8 +DATA ·libc_munlockall_trampoline_addr(SB)/8, $libc_munlockall_trampoline<>(SB) + +TEXT libc_pipe2_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pipe2(SB) +GLOBL ·libc_pipe2_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pipe2_trampoline_addr(SB)/8, $libc_pipe2_trampoline<>(SB) + +TEXT libc_getdents_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getdents(SB) +GLOBL ·libc_getdents_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getdents_trampoline_addr(SB)/8, $libc_getdents_trampoline<>(SB) + +TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getcwd(SB) +GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) + +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + +TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_ioctl(SB) +GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_ioctl_trampoline_addr(SB)/8, $libc_ioctl_trampoline<>(SB) + +TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sysctl(SB) +GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) + +TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_ppoll(SB) +GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $8 +DATA ·libc_ppoll_trampoline_addr(SB)/8, $libc_ppoll_trampoline<>(SB) + +TEXT libc_access_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_access(SB) +GLOBL ·libc_access_trampoline_addr(SB), RODATA, $8 +DATA ·libc_access_trampoline_addr(SB)/8, $libc_access_trampoline<>(SB) + +TEXT libc_adjtime_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_adjtime(SB) +GLOBL ·libc_adjtime_trampoline_addr(SB), RODATA, $8 +DATA ·libc_adjtime_trampoline_addr(SB)/8, $libc_adjtime_trampoline<>(SB) + +TEXT libc_chdir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chdir(SB) +GLOBL ·libc_chdir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chdir_trampoline_addr(SB)/8, $libc_chdir_trampoline<>(SB) + +TEXT libc_chflags_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chflags(SB) +GLOBL ·libc_chflags_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chflags_trampoline_addr(SB)/8, $libc_chflags_trampoline<>(SB) + +TEXT libc_chmod_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chmod(SB) +GLOBL ·libc_chmod_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chmod_trampoline_addr(SB)/8, $libc_chmod_trampoline<>(SB) + +TEXT libc_chown_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chown(SB) +GLOBL ·libc_chown_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chown_trampoline_addr(SB)/8, $libc_chown_trampoline<>(SB) + +TEXT libc_chroot_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chroot(SB) +GLOBL ·libc_chroot_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chroot_trampoline_addr(SB)/8, $libc_chroot_trampoline<>(SB) + +TEXT libc_clock_gettime_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_clock_gettime(SB) +GLOBL ·libc_clock_gettime_trampoline_addr(SB), RODATA, $8 +DATA ·libc_clock_gettime_trampoline_addr(SB)/8, $libc_clock_gettime_trampoline<>(SB) + +TEXT libc_close_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_close(SB) +GLOBL ·libc_close_trampoline_addr(SB), RODATA, $8 +DATA ·libc_close_trampoline_addr(SB)/8, $libc_close_trampoline<>(SB) + +TEXT libc_dup_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_dup(SB) +GLOBL ·libc_dup_trampoline_addr(SB), RODATA, $8 +DATA ·libc_dup_trampoline_addr(SB)/8, $libc_dup_trampoline<>(SB) + +TEXT libc_dup2_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_dup2(SB) +GLOBL ·libc_dup2_trampoline_addr(SB), RODATA, $8 +DATA ·libc_dup2_trampoline_addr(SB)/8, $libc_dup2_trampoline<>(SB) + +TEXT libc_dup3_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_dup3(SB) +GLOBL ·libc_dup3_trampoline_addr(SB), RODATA, $8 +DATA ·libc_dup3_trampoline_addr(SB)/8, $libc_dup3_trampoline<>(SB) + +TEXT libc_exit_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_exit(SB) +GLOBL ·libc_exit_trampoline_addr(SB), RODATA, $8 +DATA ·libc_exit_trampoline_addr(SB)/8, $libc_exit_trampoline<>(SB) + +TEXT libc_faccessat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_faccessat(SB) +GLOBL ·libc_faccessat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_faccessat_trampoline_addr(SB)/8, $libc_faccessat_trampoline<>(SB) + +TEXT libc_fchdir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchdir(SB) +GLOBL ·libc_fchdir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchdir_trampoline_addr(SB)/8, $libc_fchdir_trampoline<>(SB) + +TEXT libc_fchflags_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchflags(SB) +GLOBL ·libc_fchflags_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchflags_trampoline_addr(SB)/8, $libc_fchflags_trampoline<>(SB) + +TEXT libc_fchmod_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchmod(SB) +GLOBL ·libc_fchmod_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchmod_trampoline_addr(SB)/8, $libc_fchmod_trampoline<>(SB) + +TEXT libc_fchmodat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchmodat(SB) +GLOBL ·libc_fchmodat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchmodat_trampoline_addr(SB)/8, $libc_fchmodat_trampoline<>(SB) + +TEXT libc_fchown_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchown(SB) +GLOBL ·libc_fchown_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchown_trampoline_addr(SB)/8, $libc_fchown_trampoline<>(SB) + +TEXT libc_fchownat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchownat(SB) +GLOBL ·libc_fchownat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchownat_trampoline_addr(SB)/8, $libc_fchownat_trampoline<>(SB) + +TEXT libc_flock_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_flock(SB) +GLOBL ·libc_flock_trampoline_addr(SB), RODATA, $8 +DATA ·libc_flock_trampoline_addr(SB)/8, $libc_flock_trampoline<>(SB) + +TEXT libc_fpathconf_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fpathconf(SB) +GLOBL ·libc_fpathconf_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fpathconf_trampoline_addr(SB)/8, $libc_fpathconf_trampoline<>(SB) + +TEXT libc_fstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fstat(SB) +GLOBL ·libc_fstat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fstat_trampoline_addr(SB)/8, $libc_fstat_trampoline<>(SB) + +TEXT libc_fstatat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fstatat(SB) +GLOBL ·libc_fstatat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fstatat_trampoline_addr(SB)/8, $libc_fstatat_trampoline<>(SB) + +TEXT libc_fstatfs_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fstatfs(SB) +GLOBL ·libc_fstatfs_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fstatfs_trampoline_addr(SB)/8, $libc_fstatfs_trampoline<>(SB) + +TEXT libc_fsync_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fsync(SB) +GLOBL ·libc_fsync_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fsync_trampoline_addr(SB)/8, $libc_fsync_trampoline<>(SB) + +TEXT libc_ftruncate_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_ftruncate(SB) +GLOBL ·libc_ftruncate_trampoline_addr(SB), RODATA, $8 +DATA ·libc_ftruncate_trampoline_addr(SB)/8, $libc_ftruncate_trampoline<>(SB) + +TEXT libc_getegid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getegid(SB) +GLOBL ·libc_getegid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getegid_trampoline_addr(SB)/8, $libc_getegid_trampoline<>(SB) + +TEXT libc_geteuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_geteuid(SB) +GLOBL ·libc_geteuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_geteuid_trampoline_addr(SB)/8, $libc_geteuid_trampoline<>(SB) + +TEXT libc_getgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getgid(SB) +GLOBL ·libc_getgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getgid_trampoline_addr(SB)/8, $libc_getgid_trampoline<>(SB) + +TEXT libc_getpgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpgid(SB) +GLOBL ·libc_getpgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpgid_trampoline_addr(SB)/8, $libc_getpgid_trampoline<>(SB) + +TEXT libc_getpgrp_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpgrp(SB) +GLOBL ·libc_getpgrp_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpgrp_trampoline_addr(SB)/8, $libc_getpgrp_trampoline<>(SB) + +TEXT libc_getpid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpid(SB) +GLOBL ·libc_getpid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpid_trampoline_addr(SB)/8, $libc_getpid_trampoline<>(SB) + +TEXT libc_getppid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getppid(SB) +GLOBL ·libc_getppid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getppid_trampoline_addr(SB)/8, $libc_getppid_trampoline<>(SB) + +TEXT libc_getpriority_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpriority(SB) +GLOBL ·libc_getpriority_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpriority_trampoline_addr(SB)/8, $libc_getpriority_trampoline<>(SB) + +TEXT libc_getrlimit_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getrlimit(SB) +GLOBL ·libc_getrlimit_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getrlimit_trampoline_addr(SB)/8, $libc_getrlimit_trampoline<>(SB) + +TEXT libc_getrtable_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getrtable(SB) +GLOBL ·libc_getrtable_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getrtable_trampoline_addr(SB)/8, $libc_getrtable_trampoline<>(SB) + +TEXT libc_getrusage_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getrusage(SB) +GLOBL ·libc_getrusage_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getrusage_trampoline_addr(SB)/8, $libc_getrusage_trampoline<>(SB) + +TEXT libc_getsid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getsid(SB) +GLOBL ·libc_getsid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getsid_trampoline_addr(SB)/8, $libc_getsid_trampoline<>(SB) + +TEXT libc_gettimeofday_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_gettimeofday(SB) +GLOBL ·libc_gettimeofday_trampoline_addr(SB), RODATA, $8 +DATA ·libc_gettimeofday_trampoline_addr(SB)/8, $libc_gettimeofday_trampoline<>(SB) + +TEXT libc_getuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getuid(SB) +GLOBL ·libc_getuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getuid_trampoline_addr(SB)/8, $libc_getuid_trampoline<>(SB) + +TEXT libc_issetugid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_issetugid(SB) +GLOBL ·libc_issetugid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_issetugid_trampoline_addr(SB)/8, $libc_issetugid_trampoline<>(SB) + +TEXT libc_kill_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_kill(SB) +GLOBL ·libc_kill_trampoline_addr(SB), RODATA, $8 +DATA ·libc_kill_trampoline_addr(SB)/8, $libc_kill_trampoline<>(SB) + +TEXT libc_kqueue_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_kqueue(SB) +GLOBL ·libc_kqueue_trampoline_addr(SB), RODATA, $8 +DATA ·libc_kqueue_trampoline_addr(SB)/8, $libc_kqueue_trampoline<>(SB) + +TEXT libc_lchown_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_lchown(SB) +GLOBL ·libc_lchown_trampoline_addr(SB), RODATA, $8 +DATA ·libc_lchown_trampoline_addr(SB)/8, $libc_lchown_trampoline<>(SB) + +TEXT libc_link_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_link(SB) +GLOBL ·libc_link_trampoline_addr(SB), RODATA, $8 +DATA ·libc_link_trampoline_addr(SB)/8, $libc_link_trampoline<>(SB) + +TEXT libc_linkat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_linkat(SB) +GLOBL ·libc_linkat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_linkat_trampoline_addr(SB)/8, $libc_linkat_trampoline<>(SB) + +TEXT libc_listen_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_listen(SB) +GLOBL ·libc_listen_trampoline_addr(SB), RODATA, $8 +DATA ·libc_listen_trampoline_addr(SB)/8, $libc_listen_trampoline<>(SB) + +TEXT libc_lstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_lstat(SB) +GLOBL ·libc_lstat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_lstat_trampoline_addr(SB)/8, $libc_lstat_trampoline<>(SB) + +TEXT libc_mkdir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mkdir(SB) +GLOBL ·libc_mkdir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mkdir_trampoline_addr(SB)/8, $libc_mkdir_trampoline<>(SB) + +TEXT libc_mkdirat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mkdirat(SB) +GLOBL ·libc_mkdirat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mkdirat_trampoline_addr(SB)/8, $libc_mkdirat_trampoline<>(SB) + +TEXT libc_mkfifo_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mkfifo(SB) +GLOBL ·libc_mkfifo_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mkfifo_trampoline_addr(SB)/8, $libc_mkfifo_trampoline<>(SB) + +TEXT libc_mkfifoat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mkfifoat(SB) +GLOBL ·libc_mkfifoat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mkfifoat_trampoline_addr(SB)/8, $libc_mkfifoat_trampoline<>(SB) + +TEXT libc_mknod_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mknod(SB) +GLOBL ·libc_mknod_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mknod_trampoline_addr(SB)/8, $libc_mknod_trampoline<>(SB) + +TEXT libc_mknodat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mknodat(SB) +GLOBL ·libc_mknodat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mknodat_trampoline_addr(SB)/8, $libc_mknodat_trampoline<>(SB) + +TEXT libc_nanosleep_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_nanosleep(SB) +GLOBL ·libc_nanosleep_trampoline_addr(SB), RODATA, $8 +DATA ·libc_nanosleep_trampoline_addr(SB)/8, $libc_nanosleep_trampoline<>(SB) + +TEXT libc_open_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_open(SB) +GLOBL ·libc_open_trampoline_addr(SB), RODATA, $8 +DATA ·libc_open_trampoline_addr(SB)/8, $libc_open_trampoline<>(SB) + +TEXT libc_openat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_openat(SB) +GLOBL ·libc_openat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_openat_trampoline_addr(SB)/8, $libc_openat_trampoline<>(SB) + +TEXT libc_pathconf_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pathconf(SB) +GLOBL ·libc_pathconf_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pathconf_trampoline_addr(SB)/8, $libc_pathconf_trampoline<>(SB) + +TEXT libc_pread_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pread(SB) +GLOBL ·libc_pread_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pread_trampoline_addr(SB)/8, $libc_pread_trampoline<>(SB) + +TEXT libc_pwrite_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pwrite(SB) +GLOBL ·libc_pwrite_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pwrite_trampoline_addr(SB)/8, $libc_pwrite_trampoline<>(SB) + +TEXT libc_read_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_read(SB) +GLOBL ·libc_read_trampoline_addr(SB), RODATA, $8 +DATA ·libc_read_trampoline_addr(SB)/8, $libc_read_trampoline<>(SB) + +TEXT libc_readlink_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_readlink(SB) +GLOBL ·libc_readlink_trampoline_addr(SB), RODATA, $8 +DATA ·libc_readlink_trampoline_addr(SB)/8, $libc_readlink_trampoline<>(SB) + +TEXT libc_readlinkat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_readlinkat(SB) +GLOBL ·libc_readlinkat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_readlinkat_trampoline_addr(SB)/8, $libc_readlinkat_trampoline<>(SB) + +TEXT libc_rename_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_rename(SB) +GLOBL ·libc_rename_trampoline_addr(SB), RODATA, $8 +DATA ·libc_rename_trampoline_addr(SB)/8, $libc_rename_trampoline<>(SB) + +TEXT libc_renameat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_renameat(SB) +GLOBL ·libc_renameat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_renameat_trampoline_addr(SB)/8, $libc_renameat_trampoline<>(SB) + +TEXT libc_revoke_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_revoke(SB) +GLOBL ·libc_revoke_trampoline_addr(SB), RODATA, $8 +DATA ·libc_revoke_trampoline_addr(SB)/8, $libc_revoke_trampoline<>(SB) + +TEXT libc_rmdir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_rmdir(SB) +GLOBL ·libc_rmdir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_rmdir_trampoline_addr(SB)/8, $libc_rmdir_trampoline<>(SB) + +TEXT libc_lseek_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_lseek(SB) +GLOBL ·libc_lseek_trampoline_addr(SB), RODATA, $8 +DATA ·libc_lseek_trampoline_addr(SB)/8, $libc_lseek_trampoline<>(SB) + +TEXT libc_select_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_select(SB) +GLOBL ·libc_select_trampoline_addr(SB), RODATA, $8 +DATA ·libc_select_trampoline_addr(SB)/8, $libc_select_trampoline<>(SB) + +TEXT libc_setegid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setegid(SB) +GLOBL ·libc_setegid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setegid_trampoline_addr(SB)/8, $libc_setegid_trampoline<>(SB) + +TEXT libc_seteuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_seteuid(SB) +GLOBL ·libc_seteuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_seteuid_trampoline_addr(SB)/8, $libc_seteuid_trampoline<>(SB) + +TEXT libc_setgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setgid(SB) +GLOBL ·libc_setgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setgid_trampoline_addr(SB)/8, $libc_setgid_trampoline<>(SB) + +TEXT libc_setlogin_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setlogin(SB) +GLOBL ·libc_setlogin_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setlogin_trampoline_addr(SB)/8, $libc_setlogin_trampoline<>(SB) + +TEXT libc_setpgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setpgid(SB) +GLOBL ·libc_setpgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setpgid_trampoline_addr(SB)/8, $libc_setpgid_trampoline<>(SB) + +TEXT libc_setpriority_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setpriority(SB) +GLOBL ·libc_setpriority_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setpriority_trampoline_addr(SB)/8, $libc_setpriority_trampoline<>(SB) + +TEXT libc_setregid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setregid(SB) +GLOBL ·libc_setregid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setregid_trampoline_addr(SB)/8, $libc_setregid_trampoline<>(SB) + +TEXT libc_setreuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setreuid(SB) +GLOBL ·libc_setreuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setreuid_trampoline_addr(SB)/8, $libc_setreuid_trampoline<>(SB) + +TEXT libc_setresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setresgid(SB) +GLOBL ·libc_setresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setresgid_trampoline_addr(SB)/8, $libc_setresgid_trampoline<>(SB) + +TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setresuid(SB) +GLOBL ·libc_setresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setresuid_trampoline_addr(SB)/8, $libc_setresuid_trampoline<>(SB) + +TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setrtable(SB) +GLOBL ·libc_setrtable_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setrtable_trampoline_addr(SB)/8, $libc_setrtable_trampoline<>(SB) + +TEXT libc_setsid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setsid(SB) +GLOBL ·libc_setsid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setsid_trampoline_addr(SB)/8, $libc_setsid_trampoline<>(SB) + +TEXT libc_settimeofday_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_settimeofday(SB) +GLOBL ·libc_settimeofday_trampoline_addr(SB), RODATA, $8 +DATA ·libc_settimeofday_trampoline_addr(SB)/8, $libc_settimeofday_trampoline<>(SB) + +TEXT libc_setuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setuid(SB) +GLOBL ·libc_setuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setuid_trampoline_addr(SB)/8, $libc_setuid_trampoline<>(SB) + +TEXT libc_stat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_stat(SB) +GLOBL ·libc_stat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_stat_trampoline_addr(SB)/8, $libc_stat_trampoline<>(SB) + +TEXT libc_statfs_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_statfs(SB) +GLOBL ·libc_statfs_trampoline_addr(SB), RODATA, $8 +DATA ·libc_statfs_trampoline_addr(SB)/8, $libc_statfs_trampoline<>(SB) + +TEXT libc_symlink_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_symlink(SB) +GLOBL ·libc_symlink_trampoline_addr(SB), RODATA, $8 +DATA ·libc_symlink_trampoline_addr(SB)/8, $libc_symlink_trampoline<>(SB) + +TEXT libc_symlinkat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_symlinkat(SB) +GLOBL ·libc_symlinkat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_symlinkat_trampoline_addr(SB)/8, $libc_symlinkat_trampoline<>(SB) + +TEXT libc_sync_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sync(SB) +GLOBL ·libc_sync_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sync_trampoline_addr(SB)/8, $libc_sync_trampoline<>(SB) + +TEXT libc_truncate_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_truncate(SB) +GLOBL ·libc_truncate_trampoline_addr(SB), RODATA, $8 +DATA ·libc_truncate_trampoline_addr(SB)/8, $libc_truncate_trampoline<>(SB) + +TEXT libc_umask_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_umask(SB) +GLOBL ·libc_umask_trampoline_addr(SB), RODATA, $8 +DATA ·libc_umask_trampoline_addr(SB)/8, $libc_umask_trampoline<>(SB) + +TEXT libc_unlink_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unlink(SB) +GLOBL ·libc_unlink_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unlink_trampoline_addr(SB)/8, $libc_unlink_trampoline<>(SB) + +TEXT libc_unlinkat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unlinkat(SB) +GLOBL ·libc_unlinkat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unlinkat_trampoline_addr(SB)/8, $libc_unlinkat_trampoline<>(SB) + +TEXT libc_unmount_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unmount(SB) +GLOBL ·libc_unmount_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unmount_trampoline_addr(SB)/8, $libc_unmount_trampoline<>(SB) + +TEXT libc_write_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_write(SB) +GLOBL ·libc_write_trampoline_addr(SB), RODATA, $8 +DATA ·libc_write_trampoline_addr(SB)/8, $libc_write_trampoline<>(SB) + +TEXT libc_mmap_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mmap(SB) +GLOBL ·libc_mmap_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mmap_trampoline_addr(SB)/8, $libc_mmap_trampoline<>(SB) + +TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_munmap(SB) +GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 +DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) + +TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_utimensat(SB) +GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go new file mode 100644 index 0000000..fb99594 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go @@ -0,0 +1,2251 @@ +// go run mksyscall.go -openbsd -libc -tags openbsd,ppc64 syscall_bsd.go syscall_openbsd.go syscall_openbsd_ppc64.go +// Code generated by the command above; see README.md. DO NOT EDIT. + +//go:build openbsd && ppc64 +// +build openbsd,ppc64 + +package unix + +import ( + "syscall" + "unsafe" +) + +var _ syscall.Errno + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getgroups(ngid int, gid *_Gid_t) (n int, err error) { + r0, _, e1 := syscall_rawSyscall(libc_getgroups_trampoline_addr, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getgroups_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getgroups getgroups "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func setgroups(ngid int, gid *_Gid_t) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setgroups_trampoline_addr, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setgroups_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setgroups setgroups "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func wait4(pid int, wstatus *_C_int, options int, rusage *Rusage) (wpid int, err error) { + r0, _, e1 := syscall_syscall6(libc_wait4_trampoline_addr, uintptr(pid), uintptr(unsafe.Pointer(wstatus)), uintptr(options), uintptr(unsafe.Pointer(rusage)), 0, 0) + wpid = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_wait4_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_wait4 wait4 "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { + r0, _, e1 := syscall_syscall(libc_accept_trampoline_addr, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_accept_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_accept accept "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { + _, _, e1 := syscall_syscall(libc_bind_trampoline_addr, uintptr(s), uintptr(addr), uintptr(addrlen)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_bind_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_bind bind "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func connect(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { + _, _, e1 := syscall_syscall(libc_connect_trampoline_addr, uintptr(s), uintptr(addr), uintptr(addrlen)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_connect_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_connect connect "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func socket(domain int, typ int, proto int) (fd int, err error) { + r0, _, e1 := syscall_rawSyscall(libc_socket_trampoline_addr, uintptr(domain), uintptr(typ), uintptr(proto)) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_socket_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_socket socket "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getsockopt(s int, level int, name int, val unsafe.Pointer, vallen *_Socklen) (err error) { + _, _, e1 := syscall_syscall6(libc_getsockopt_trampoline_addr, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(unsafe.Pointer(vallen)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getsockopt_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getsockopt getsockopt "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func setsockopt(s int, level int, name int, val unsafe.Pointer, vallen uintptr) (err error) { + _, _, e1 := syscall_syscall6(libc_setsockopt_trampoline_addr, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(vallen), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setsockopt_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setsockopt setsockopt "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getpeername(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { + _, _, e1 := syscall_rawSyscall(libc_getpeername_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getpeername_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpeername getpeername "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getsockname(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { + _, _, e1 := syscall_rawSyscall(libc_getsockname_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getsockname_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getsockname getsockname "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Shutdown(s int, how int) (err error) { + _, _, e1 := syscall_syscall(libc_shutdown_trampoline_addr, uintptr(s), uintptr(how), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_shutdown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_shutdown shutdown "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func socketpair(domain int, typ int, proto int, fd *[2]int32) (err error) { + _, _, e1 := syscall_rawSyscall6(libc_socketpair_trampoline_addr, uintptr(domain), uintptr(typ), uintptr(proto), uintptr(unsafe.Pointer(fd)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_socketpair_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_socketpair socketpair "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Socklen) (n int, err error) { + var _p0 unsafe.Pointer + if len(p) > 0 { + _p0 = unsafe.Pointer(&p[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall6(libc_recvfrom_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(flags), uintptr(unsafe.Pointer(from)), uintptr(unsafe.Pointer(fromlen))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_recvfrom_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_recvfrom recvfrom "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) (err error) { + var _p0 unsafe.Pointer + if len(buf) > 0 { + _p0 = unsafe.Pointer(&buf[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall6(libc_sendto_trampoline_addr, uintptr(s), uintptr(_p0), uintptr(len(buf)), uintptr(flags), uintptr(to), uintptr(addrlen)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_sendto_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sendto sendto "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func recvmsg(s int, msg *Msghdr, flags int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_recvmsg_trampoline_addr, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_recvmsg_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_recvmsg recvmsg "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_sendmsg_trampoline_addr, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_sendmsg_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sendmsg sendmsg "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func kevent(kq int, change unsafe.Pointer, nchange int, event unsafe.Pointer, nevent int, timeout *Timespec) (n int, err error) { + r0, _, e1 := syscall_syscall6(libc_kevent_trampoline_addr, uintptr(kq), uintptr(change), uintptr(nchange), uintptr(event), uintptr(nevent), uintptr(unsafe.Pointer(timeout))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_kevent_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_kevent kevent "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func utimes(path string, timeval *[2]Timeval) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_utimes_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(timeval)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_utimes_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_utimes utimes "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func futimes(fd int, timeval *[2]Timeval) (err error) { + _, _, e1 := syscall_syscall(libc_futimes_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(timeval)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_futimes_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_futimes futimes "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func poll(fds *PollFd, nfds int, timeout int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_poll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(timeout)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_poll_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_poll poll "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Madvise(b []byte, behav int) (err error) { + var _p0 unsafe.Pointer + if len(b) > 0 { + _p0 = unsafe.Pointer(&b[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall(libc_madvise_trampoline_addr, uintptr(_p0), uintptr(len(b)), uintptr(behav)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_madvise_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_madvise madvise "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mlock(b []byte) (err error) { + var _p0 unsafe.Pointer + if len(b) > 0 { + _p0 = unsafe.Pointer(&b[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall(libc_mlock_trampoline_addr, uintptr(_p0), uintptr(len(b)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mlock_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mlock mlock "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mlockall(flags int) (err error) { + _, _, e1 := syscall_syscall(libc_mlockall_trampoline_addr, uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mlockall_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mlockall mlockall "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mprotect(b []byte, prot int) (err error) { + var _p0 unsafe.Pointer + if len(b) > 0 { + _p0 = unsafe.Pointer(&b[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall(libc_mprotect_trampoline_addr, uintptr(_p0), uintptr(len(b)), uintptr(prot)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mprotect_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mprotect mprotect "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Msync(b []byte, flags int) (err error) { + var _p0 unsafe.Pointer + if len(b) > 0 { + _p0 = unsafe.Pointer(&b[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall(libc_msync_trampoline_addr, uintptr(_p0), uintptr(len(b)), uintptr(flags)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_msync_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_msync msync "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Munlock(b []byte) (err error) { + var _p0 unsafe.Pointer + if len(b) > 0 { + _p0 = unsafe.Pointer(&b[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall(libc_munlock_trampoline_addr, uintptr(_p0), uintptr(len(b)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_munlock_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_munlock munlock "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Munlockall() (err error) { + _, _, e1 := syscall_syscall(libc_munlockall_trampoline_addr, 0, 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_munlockall_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_munlockall munlockall "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pipe2(p *[2]_C_int, flags int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_pipe2_trampoline_addr, uintptr(unsafe.Pointer(p)), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pipe2_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pipe2 pipe2 "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getdents(fd int, buf []byte) (n int, err error) { + var _p0 unsafe.Pointer + if len(buf) > 0 { + _p0 = unsafe.Pointer(&buf[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall(libc_getdents_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(buf))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getdents_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getdents getdents "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getcwd(buf []byte) (n int, err error) { + var _p0 unsafe.Pointer + if len(buf) > 0 { + _p0 = unsafe.Pointer(&buf[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall(libc_getcwd_trampoline_addr, uintptr(_p0), uintptr(len(buf)), 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getcwd_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getcwd getcwd "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ioctl(fd int, req uint, arg uintptr) (err error) { + _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { + _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { + var _p0 unsafe.Pointer + if len(mib) > 0 { + _p0 = unsafe.Pointer(&mib[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall6(libc_sysctl_trampoline_addr, uintptr(_p0), uintptr(len(mib)), uintptr(unsafe.Pointer(old)), uintptr(unsafe.Pointer(oldlen)), uintptr(unsafe.Pointer(new)), uintptr(newlen)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_sysctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sysctl sysctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { + r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_ppoll_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ppoll ppoll "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Access(path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_access_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_access_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_access access "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Adjtime(delta *Timeval, olddelta *Timeval) (err error) { + _, _, e1 := syscall_syscall(libc_adjtime_trampoline_addr, uintptr(unsafe.Pointer(delta)), uintptr(unsafe.Pointer(olddelta)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_adjtime_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_adjtime adjtime "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Chdir(path string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_chdir_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_chdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chdir chdir "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Chflags(path string, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_chflags_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_chflags_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chflags chflags "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Chmod(path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_chmod_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_chmod_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chmod chmod "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Chown(path string, uid int, gid int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_chown_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_chown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chown chown "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Chroot(path string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_chroot_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_chroot_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chroot chroot "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ClockGettime(clockid int32, time *Timespec) (err error) { + _, _, e1 := syscall_syscall(libc_clock_gettime_trampoline_addr, uintptr(clockid), uintptr(unsafe.Pointer(time)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_clock_gettime_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_clock_gettime clock_gettime "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Close(fd int) (err error) { + _, _, e1 := syscall_syscall(libc_close_trampoline_addr, uintptr(fd), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_close_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_close close "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Dup(fd int) (nfd int, err error) { + r0, _, e1 := syscall_syscall(libc_dup_trampoline_addr, uintptr(fd), 0, 0) + nfd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_dup_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_dup dup "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Dup2(from int, to int) (err error) { + _, _, e1 := syscall_syscall(libc_dup2_trampoline_addr, uintptr(from), uintptr(to), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_dup2_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_dup2 dup2 "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Dup3(from int, to int, flags int) (err error) { + _, _, e1 := syscall_syscall(libc_dup3_trampoline_addr, uintptr(from), uintptr(to), uintptr(flags)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_dup3_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_dup3 dup3 "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Exit(code int) { + syscall_syscall(libc_exit_trampoline_addr, uintptr(code), 0, 0) + return +} + +var libc_exit_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_exit exit "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_faccessat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_faccessat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_faccessat faccessat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchdir(fd int) (err error) { + _, _, e1 := syscall_syscall(libc_fchdir_trampoline_addr, uintptr(fd), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fchdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchdir fchdir "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchflags(fd int, flags int) (err error) { + _, _, e1 := syscall_syscall(libc_fchflags_trampoline_addr, uintptr(fd), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fchflags_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchflags fchflags "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchmod(fd int, mode uint32) (err error) { + _, _, e1 := syscall_syscall(libc_fchmod_trampoline_addr, uintptr(fd), uintptr(mode), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fchmod_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchmod fchmod "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_fchmodat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fchmodat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchmodat fchmodat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchown(fd int, uid int, gid int) (err error) { + _, _, e1 := syscall_syscall(libc_fchown_trampoline_addr, uintptr(fd), uintptr(uid), uintptr(gid)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fchown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchown fchown "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchownat(dirfd int, path string, uid int, gid int, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_fchownat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fchownat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchownat fchownat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Flock(fd int, how int) (err error) { + _, _, e1 := syscall_syscall(libc_flock_trampoline_addr, uintptr(fd), uintptr(how), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_flock_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_flock flock "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fpathconf(fd int, name int) (val int, err error) { + r0, _, e1 := syscall_syscall(libc_fpathconf_trampoline_addr, uintptr(fd), uintptr(name), 0) + val = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fpathconf_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fpathconf fpathconf "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fstat(fd int, stat *Stat_t) (err error) { + _, _, e1 := syscall_syscall(libc_fstat_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fstat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fstat fstat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_fstatat_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fstatat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fstatat fstatat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fstatfs(fd int, stat *Statfs_t) (err error) { + _, _, e1 := syscall_syscall(libc_fstatfs_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fstatfs_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fstatfs fstatfs "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fsync(fd int) (err error) { + _, _, e1 := syscall_syscall(libc_fsync_trampoline_addr, uintptr(fd), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fsync_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fsync fsync "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Ftruncate(fd int, length int64) (err error) { + _, _, e1 := syscall_syscall(libc_ftruncate_trampoline_addr, uintptr(fd), uintptr(length), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_ftruncate_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ftruncate ftruncate "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getegid() (egid int) { + r0, _, _ := syscall_rawSyscall(libc_getegid_trampoline_addr, 0, 0, 0) + egid = int(r0) + return +} + +var libc_getegid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getegid getegid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Geteuid() (uid int) { + r0, _, _ := syscall_rawSyscall(libc_geteuid_trampoline_addr, 0, 0, 0) + uid = int(r0) + return +} + +var libc_geteuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_geteuid geteuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getgid() (gid int) { + r0, _, _ := syscall_rawSyscall(libc_getgid_trampoline_addr, 0, 0, 0) + gid = int(r0) + return +} + +var libc_getgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getgid getgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getpgid(pid int) (pgid int, err error) { + r0, _, e1 := syscall_rawSyscall(libc_getpgid_trampoline_addr, uintptr(pid), 0, 0) + pgid = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getpgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpgid getpgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getpgrp() (pgrp int) { + r0, _, _ := syscall_rawSyscall(libc_getpgrp_trampoline_addr, 0, 0, 0) + pgrp = int(r0) + return +} + +var libc_getpgrp_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpgrp getpgrp "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getpid() (pid int) { + r0, _, _ := syscall_rawSyscall(libc_getpid_trampoline_addr, 0, 0, 0) + pid = int(r0) + return +} + +var libc_getpid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpid getpid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getppid() (ppid int) { + r0, _, _ := syscall_rawSyscall(libc_getppid_trampoline_addr, 0, 0, 0) + ppid = int(r0) + return +} + +var libc_getppid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getppid getppid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getpriority(which int, who int) (prio int, err error) { + r0, _, e1 := syscall_syscall(libc_getpriority_trampoline_addr, uintptr(which), uintptr(who), 0) + prio = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getpriority_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpriority getpriority "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getrlimit(which int, lim *Rlimit) (err error) { + _, _, e1 := syscall_rawSyscall(libc_getrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getrlimit_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getrlimit getrlimit "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getrtable() (rtable int, err error) { + r0, _, e1 := syscall_rawSyscall(libc_getrtable_trampoline_addr, 0, 0, 0) + rtable = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getrtable_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getrtable getrtable "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getrusage(who int, rusage *Rusage) (err error) { + _, _, e1 := syscall_rawSyscall(libc_getrusage_trampoline_addr, uintptr(who), uintptr(unsafe.Pointer(rusage)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getrusage_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getrusage getrusage "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getsid(pid int) (sid int, err error) { + r0, _, e1 := syscall_rawSyscall(libc_getsid_trampoline_addr, uintptr(pid), 0, 0) + sid = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getsid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getsid getsid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Gettimeofday(tv *Timeval) (err error) { + _, _, e1 := syscall_rawSyscall(libc_gettimeofday_trampoline_addr, uintptr(unsafe.Pointer(tv)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_gettimeofday_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_gettimeofday gettimeofday "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getuid() (uid int) { + r0, _, _ := syscall_rawSyscall(libc_getuid_trampoline_addr, 0, 0, 0) + uid = int(r0) + return +} + +var libc_getuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getuid getuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Issetugid() (tainted bool) { + r0, _, _ := syscall_syscall(libc_issetugid_trampoline_addr, 0, 0, 0) + tainted = bool(r0 != 0) + return +} + +var libc_issetugid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_issetugid issetugid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Kill(pid int, signum syscall.Signal) (err error) { + _, _, e1 := syscall_syscall(libc_kill_trampoline_addr, uintptr(pid), uintptr(signum), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_kill_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_kill kill "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Kqueue() (fd int, err error) { + r0, _, e1 := syscall_syscall(libc_kqueue_trampoline_addr, 0, 0, 0) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_kqueue_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_kqueue kqueue "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Lchown(path string, uid int, gid int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_lchown_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_lchown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_lchown lchown "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Link(path string, link string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(link) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_link_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_link_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_link link "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Linkat(pathfd int, path string, linkfd int, link string, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(link) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_linkat_trampoline_addr, uintptr(pathfd), uintptr(unsafe.Pointer(_p0)), uintptr(linkfd), uintptr(unsafe.Pointer(_p1)), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_linkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_linkat linkat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Listen(s int, backlog int) (err error) { + _, _, e1 := syscall_syscall(libc_listen_trampoline_addr, uintptr(s), uintptr(backlog), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_listen_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_listen listen "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Lstat(path string, stat *Stat_t) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_lstat_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_lstat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_lstat lstat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mkdir(path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_mkdir_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mkdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkdir mkdir "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mkdirat(dirfd int, path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_mkdirat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mkdirat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkdirat mkdirat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mkfifo(path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_mkfifo_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mkfifo_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkfifo mkfifo "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mkfifoat(dirfd int, path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_mkfifoat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mkfifoat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkfifoat mkfifoat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mknod(path string, mode uint32, dev int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_mknod_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mknod_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mknod mknod "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mknodat(dirfd int, path string, mode uint32, dev int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_mknodat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mknodat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mknodat mknodat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Nanosleep(time *Timespec, leftover *Timespec) (err error) { + _, _, e1 := syscall_syscall(libc_nanosleep_trampoline_addr, uintptr(unsafe.Pointer(time)), uintptr(unsafe.Pointer(leftover)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_nanosleep_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_nanosleep nanosleep "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Open(path string, mode int, perm uint32) (fd int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + r0, _, e1 := syscall_syscall(libc_open_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm)) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_open_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_open open "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Openat(dirfd int, path string, mode int, perm uint32) (fd int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + r0, _, e1 := syscall_syscall6(libc_openat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm), 0, 0) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_openat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_openat openat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Pathconf(path string, name int) (val int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + r0, _, e1 := syscall_syscall(libc_pathconf_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(name), 0) + val = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pathconf_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pathconf pathconf "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pread(fd int, p []byte, offset int64) (n int, err error) { + var _p0 unsafe.Pointer + if len(p) > 0 { + _p0 = unsafe.Pointer(&p[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall6(libc_pread_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(offset), 0, 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pread_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pread pread "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pwrite(fd int, p []byte, offset int64) (n int, err error) { + var _p0 unsafe.Pointer + if len(p) > 0 { + _p0 = unsafe.Pointer(&p[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall6(libc_pwrite_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(offset), 0, 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pwrite_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pwrite pwrite "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func read(fd int, p []byte) (n int, err error) { + var _p0 unsafe.Pointer + if len(p) > 0 { + _p0 = unsafe.Pointer(&p[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_read_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_read read "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Readlink(path string, buf []byte) (n int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 unsafe.Pointer + if len(buf) > 0 { + _p1 = unsafe.Pointer(&buf[0]) + } else { + _p1 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall(libc_readlink_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_readlink_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_readlink readlink "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Readlinkat(dirfd int, path string, buf []byte) (n int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 unsafe.Pointer + if len(buf) > 0 { + _p1 = unsafe.Pointer(&buf[0]) + } else { + _p1 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall6(libc_readlinkat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf)), 0, 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_readlinkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_readlinkat readlinkat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Rename(from string, to string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(from) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(to) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_rename_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_rename_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_rename rename "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Renameat(fromfd int, from string, tofd int, to string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(from) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(to) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_renameat_trampoline_addr, uintptr(fromfd), uintptr(unsafe.Pointer(_p0)), uintptr(tofd), uintptr(unsafe.Pointer(_p1)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_renameat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_renameat renameat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Revoke(path string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_revoke_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_revoke_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_revoke revoke "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Rmdir(path string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_rmdir_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_rmdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_rmdir rmdir "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Seek(fd int, offset int64, whence int) (newoffset int64, err error) { + r0, _, e1 := syscall_syscall(libc_lseek_trampoline_addr, uintptr(fd), uintptr(offset), uintptr(whence)) + newoffset = int64(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_lseek_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_lseek lseek "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err error) { + r0, _, e1 := syscall_syscall6(libc_select_trampoline_addr, uintptr(nfd), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_select_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_select select "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setegid(egid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setegid_trampoline_addr, uintptr(egid), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setegid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setegid setegid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Seteuid(euid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_seteuid_trampoline_addr, uintptr(euid), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_seteuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_seteuid seteuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setgid(gid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setgid_trampoline_addr, uintptr(gid), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setgid setgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setlogin(name string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(name) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_setlogin_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setlogin_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setlogin setlogin "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setpgid(pid int, pgid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setpgid_trampoline_addr, uintptr(pid), uintptr(pgid), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setpgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setpgid setpgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setpriority(which int, who int, prio int) (err error) { + _, _, e1 := syscall_syscall(libc_setpriority_trampoline_addr, uintptr(which), uintptr(who), uintptr(prio)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setpriority_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setpriority setpriority "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setregid(rgid int, egid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setregid_trampoline_addr, uintptr(rgid), uintptr(egid), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setregid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setregid setregid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setreuid(ruid int, euid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setreuid_trampoline_addr, uintptr(ruid), uintptr(euid), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setreuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setreuid setreuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setresgid(rgid int, egid int, sgid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setresgid_trampoline_addr, uintptr(rgid), uintptr(egid), uintptr(sgid)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setresgid setresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setresuid(ruid int, euid int, suid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setresuid_trampoline_addr, uintptr(ruid), uintptr(euid), uintptr(suid)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setresuid setresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setrtable(rtable int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setrtable_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setrtable setrtable "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setsid() (pid int, err error) { + r0, _, e1 := syscall_rawSyscall(libc_setsid_trampoline_addr, 0, 0, 0) + pid = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setsid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setsid setsid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Settimeofday(tp *Timeval) (err error) { + _, _, e1 := syscall_rawSyscall(libc_settimeofday_trampoline_addr, uintptr(unsafe.Pointer(tp)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_settimeofday_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_settimeofday settimeofday "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setuid(uid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setuid_trampoline_addr, uintptr(uid), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setuid setuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Stat(path string, stat *Stat_t) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_stat_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_stat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_stat stat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Statfs(path string, stat *Statfs_t) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_statfs_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_statfs_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_statfs statfs "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Symlink(path string, link string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(link) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_symlink_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_symlink_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_symlink symlink "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Symlinkat(oldpath string, newdirfd int, newpath string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(oldpath) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(newpath) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_symlinkat_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(newdirfd), uintptr(unsafe.Pointer(_p1))) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_symlinkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_symlinkat symlinkat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Sync() (err error) { + _, _, e1 := syscall_syscall(libc_sync_trampoline_addr, 0, 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_sync_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sync sync "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Truncate(path string, length int64) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_truncate_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(length), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_truncate_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_truncate truncate "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Umask(newmask int) (oldmask int) { + r0, _, _ := syscall_syscall(libc_umask_trampoline_addr, uintptr(newmask), 0, 0) + oldmask = int(r0) + return +} + +var libc_umask_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_umask umask "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Unlink(path string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_unlink_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unlink_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unlink unlink "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Unlinkat(dirfd int, path string, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_unlinkat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(flags)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unlinkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unlinkat unlinkat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Unmount(path string, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_unmount_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unmount_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unmount unmount "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func write(fd int, p []byte) (n int, err error) { + var _p0 unsafe.Pointer + if len(p) > 0 { + _p0 = unsafe.Pointer(&p[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_write_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_write write "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) { + r0, _, e1 := syscall_syscall6(libc_mmap_trampoline_addr, uintptr(addr), uintptr(length), uintptr(prot), uintptr(flag), uintptr(fd), uintptr(pos)) + ret = uintptr(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mmap_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mmap mmap "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func munmap(addr uintptr, length uintptr) (err error) { + _, _, e1 := syscall_syscall(libc_munmap_trampoline_addr, uintptr(addr), uintptr(length), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_munmap_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_munmap munmap "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func readlen(fd int, buf *byte, nbuf int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func writelen(fd int, buf *byte, nbuf int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_utimensat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_utimensat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_utimensat utimensat "libc.so" diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s new file mode 100644 index 0000000..ca3f766 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s @@ -0,0 +1,808 @@ +// go run mkasm.go openbsd ppc64 +// Code generated by the command above; DO NOT EDIT. + +#include "textflag.h" + +TEXT libc_getgroups_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getgroups(SB) + RET +GLOBL ·libc_getgroups_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getgroups_trampoline_addr(SB)/8, $libc_getgroups_trampoline<>(SB) + +TEXT libc_setgroups_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_setgroups(SB) + RET +GLOBL ·libc_setgroups_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setgroups_trampoline_addr(SB)/8, $libc_setgroups_trampoline<>(SB) + +TEXT libc_wait4_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_wait4(SB) + RET +GLOBL ·libc_wait4_trampoline_addr(SB), RODATA, $8 +DATA ·libc_wait4_trampoline_addr(SB)/8, $libc_wait4_trampoline<>(SB) + +TEXT libc_accept_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_accept(SB) + RET +GLOBL ·libc_accept_trampoline_addr(SB), RODATA, $8 +DATA ·libc_accept_trampoline_addr(SB)/8, $libc_accept_trampoline<>(SB) + +TEXT libc_bind_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_bind(SB) + RET +GLOBL ·libc_bind_trampoline_addr(SB), RODATA, $8 +DATA ·libc_bind_trampoline_addr(SB)/8, $libc_bind_trampoline<>(SB) + +TEXT libc_connect_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_connect(SB) + RET +GLOBL ·libc_connect_trampoline_addr(SB), RODATA, $8 +DATA ·libc_connect_trampoline_addr(SB)/8, $libc_connect_trampoline<>(SB) + +TEXT libc_socket_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_socket(SB) + RET +GLOBL ·libc_socket_trampoline_addr(SB), RODATA, $8 +DATA ·libc_socket_trampoline_addr(SB)/8, $libc_socket_trampoline<>(SB) + +TEXT libc_getsockopt_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getsockopt(SB) + RET +GLOBL ·libc_getsockopt_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getsockopt_trampoline_addr(SB)/8, $libc_getsockopt_trampoline<>(SB) + +TEXT libc_setsockopt_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_setsockopt(SB) + RET +GLOBL ·libc_setsockopt_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setsockopt_trampoline_addr(SB)/8, $libc_setsockopt_trampoline<>(SB) + +TEXT libc_getpeername_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getpeername(SB) + RET +GLOBL ·libc_getpeername_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpeername_trampoline_addr(SB)/8, $libc_getpeername_trampoline<>(SB) + +TEXT libc_getsockname_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getsockname(SB) + RET +GLOBL ·libc_getsockname_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getsockname_trampoline_addr(SB)/8, $libc_getsockname_trampoline<>(SB) + +TEXT libc_shutdown_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_shutdown(SB) + RET +GLOBL ·libc_shutdown_trampoline_addr(SB), RODATA, $8 +DATA ·libc_shutdown_trampoline_addr(SB)/8, $libc_shutdown_trampoline<>(SB) + +TEXT libc_socketpair_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_socketpair(SB) + RET +GLOBL ·libc_socketpair_trampoline_addr(SB), RODATA, $8 +DATA ·libc_socketpair_trampoline_addr(SB)/8, $libc_socketpair_trampoline<>(SB) + +TEXT libc_recvfrom_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_recvfrom(SB) + RET +GLOBL ·libc_recvfrom_trampoline_addr(SB), RODATA, $8 +DATA ·libc_recvfrom_trampoline_addr(SB)/8, $libc_recvfrom_trampoline<>(SB) + +TEXT libc_sendto_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_sendto(SB) + RET +GLOBL ·libc_sendto_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sendto_trampoline_addr(SB)/8, $libc_sendto_trampoline<>(SB) + +TEXT libc_recvmsg_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_recvmsg(SB) + RET +GLOBL ·libc_recvmsg_trampoline_addr(SB), RODATA, $8 +DATA ·libc_recvmsg_trampoline_addr(SB)/8, $libc_recvmsg_trampoline<>(SB) + +TEXT libc_sendmsg_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_sendmsg(SB) + RET +GLOBL ·libc_sendmsg_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sendmsg_trampoline_addr(SB)/8, $libc_sendmsg_trampoline<>(SB) + +TEXT libc_kevent_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_kevent(SB) + RET +GLOBL ·libc_kevent_trampoline_addr(SB), RODATA, $8 +DATA ·libc_kevent_trampoline_addr(SB)/8, $libc_kevent_trampoline<>(SB) + +TEXT libc_utimes_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_utimes(SB) + RET +GLOBL ·libc_utimes_trampoline_addr(SB), RODATA, $8 +DATA ·libc_utimes_trampoline_addr(SB)/8, $libc_utimes_trampoline<>(SB) + +TEXT libc_futimes_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_futimes(SB) + RET +GLOBL ·libc_futimes_trampoline_addr(SB), RODATA, $8 +DATA ·libc_futimes_trampoline_addr(SB)/8, $libc_futimes_trampoline<>(SB) + +TEXT libc_poll_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_poll(SB) + RET +GLOBL ·libc_poll_trampoline_addr(SB), RODATA, $8 +DATA ·libc_poll_trampoline_addr(SB)/8, $libc_poll_trampoline<>(SB) + +TEXT libc_madvise_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_madvise(SB) + RET +GLOBL ·libc_madvise_trampoline_addr(SB), RODATA, $8 +DATA ·libc_madvise_trampoline_addr(SB)/8, $libc_madvise_trampoline<>(SB) + +TEXT libc_mlock_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_mlock(SB) + RET +GLOBL ·libc_mlock_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mlock_trampoline_addr(SB)/8, $libc_mlock_trampoline<>(SB) + +TEXT libc_mlockall_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_mlockall(SB) + RET +GLOBL ·libc_mlockall_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mlockall_trampoline_addr(SB)/8, $libc_mlockall_trampoline<>(SB) + +TEXT libc_mprotect_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_mprotect(SB) + RET +GLOBL ·libc_mprotect_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mprotect_trampoline_addr(SB)/8, $libc_mprotect_trampoline<>(SB) + +TEXT libc_msync_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_msync(SB) + RET +GLOBL ·libc_msync_trampoline_addr(SB), RODATA, $8 +DATA ·libc_msync_trampoline_addr(SB)/8, $libc_msync_trampoline<>(SB) + +TEXT libc_munlock_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_munlock(SB) + RET +GLOBL ·libc_munlock_trampoline_addr(SB), RODATA, $8 +DATA ·libc_munlock_trampoline_addr(SB)/8, $libc_munlock_trampoline<>(SB) + +TEXT libc_munlockall_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_munlockall(SB) + RET +GLOBL ·libc_munlockall_trampoline_addr(SB), RODATA, $8 +DATA ·libc_munlockall_trampoline_addr(SB)/8, $libc_munlockall_trampoline<>(SB) + +TEXT libc_pipe2_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_pipe2(SB) + RET +GLOBL ·libc_pipe2_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pipe2_trampoline_addr(SB)/8, $libc_pipe2_trampoline<>(SB) + +TEXT libc_getdents_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getdents(SB) + RET +GLOBL ·libc_getdents_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getdents_trampoline_addr(SB)/8, $libc_getdents_trampoline<>(SB) + +TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getcwd(SB) + RET +GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) + +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getresuid(SB) + RET +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getresgid(SB) + RET +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + +TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_ioctl(SB) + RET +GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_ioctl_trampoline_addr(SB)/8, $libc_ioctl_trampoline<>(SB) + +TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_sysctl(SB) + RET +GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) + +TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_ppoll(SB) + RET +GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $8 +DATA ·libc_ppoll_trampoline_addr(SB)/8, $libc_ppoll_trampoline<>(SB) + +TEXT libc_access_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_access(SB) + RET +GLOBL ·libc_access_trampoline_addr(SB), RODATA, $8 +DATA ·libc_access_trampoline_addr(SB)/8, $libc_access_trampoline<>(SB) + +TEXT libc_adjtime_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_adjtime(SB) + RET +GLOBL ·libc_adjtime_trampoline_addr(SB), RODATA, $8 +DATA ·libc_adjtime_trampoline_addr(SB)/8, $libc_adjtime_trampoline<>(SB) + +TEXT libc_chdir_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_chdir(SB) + RET +GLOBL ·libc_chdir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chdir_trampoline_addr(SB)/8, $libc_chdir_trampoline<>(SB) + +TEXT libc_chflags_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_chflags(SB) + RET +GLOBL ·libc_chflags_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chflags_trampoline_addr(SB)/8, $libc_chflags_trampoline<>(SB) + +TEXT libc_chmod_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_chmod(SB) + RET +GLOBL ·libc_chmod_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chmod_trampoline_addr(SB)/8, $libc_chmod_trampoline<>(SB) + +TEXT libc_chown_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_chown(SB) + RET +GLOBL ·libc_chown_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chown_trampoline_addr(SB)/8, $libc_chown_trampoline<>(SB) + +TEXT libc_chroot_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_chroot(SB) + RET +GLOBL ·libc_chroot_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chroot_trampoline_addr(SB)/8, $libc_chroot_trampoline<>(SB) + +TEXT libc_clock_gettime_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_clock_gettime(SB) + RET +GLOBL ·libc_clock_gettime_trampoline_addr(SB), RODATA, $8 +DATA ·libc_clock_gettime_trampoline_addr(SB)/8, $libc_clock_gettime_trampoline<>(SB) + +TEXT libc_close_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_close(SB) + RET +GLOBL ·libc_close_trampoline_addr(SB), RODATA, $8 +DATA ·libc_close_trampoline_addr(SB)/8, $libc_close_trampoline<>(SB) + +TEXT libc_dup_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_dup(SB) + RET +GLOBL ·libc_dup_trampoline_addr(SB), RODATA, $8 +DATA ·libc_dup_trampoline_addr(SB)/8, $libc_dup_trampoline<>(SB) + +TEXT libc_dup2_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_dup2(SB) + RET +GLOBL ·libc_dup2_trampoline_addr(SB), RODATA, $8 +DATA ·libc_dup2_trampoline_addr(SB)/8, $libc_dup2_trampoline<>(SB) + +TEXT libc_dup3_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_dup3(SB) + RET +GLOBL ·libc_dup3_trampoline_addr(SB), RODATA, $8 +DATA ·libc_dup3_trampoline_addr(SB)/8, $libc_dup3_trampoline<>(SB) + +TEXT libc_exit_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_exit(SB) + RET +GLOBL ·libc_exit_trampoline_addr(SB), RODATA, $8 +DATA ·libc_exit_trampoline_addr(SB)/8, $libc_exit_trampoline<>(SB) + +TEXT libc_faccessat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_faccessat(SB) + RET +GLOBL ·libc_faccessat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_faccessat_trampoline_addr(SB)/8, $libc_faccessat_trampoline<>(SB) + +TEXT libc_fchdir_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_fchdir(SB) + RET +GLOBL ·libc_fchdir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchdir_trampoline_addr(SB)/8, $libc_fchdir_trampoline<>(SB) + +TEXT libc_fchflags_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_fchflags(SB) + RET +GLOBL ·libc_fchflags_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchflags_trampoline_addr(SB)/8, $libc_fchflags_trampoline<>(SB) + +TEXT libc_fchmod_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_fchmod(SB) + RET +GLOBL ·libc_fchmod_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchmod_trampoline_addr(SB)/8, $libc_fchmod_trampoline<>(SB) + +TEXT libc_fchmodat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_fchmodat(SB) + RET +GLOBL ·libc_fchmodat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchmodat_trampoline_addr(SB)/8, $libc_fchmodat_trampoline<>(SB) + +TEXT libc_fchown_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_fchown(SB) + RET +GLOBL ·libc_fchown_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchown_trampoline_addr(SB)/8, $libc_fchown_trampoline<>(SB) + +TEXT libc_fchownat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_fchownat(SB) + RET +GLOBL ·libc_fchownat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchownat_trampoline_addr(SB)/8, $libc_fchownat_trampoline<>(SB) + +TEXT libc_flock_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_flock(SB) + RET +GLOBL ·libc_flock_trampoline_addr(SB), RODATA, $8 +DATA ·libc_flock_trampoline_addr(SB)/8, $libc_flock_trampoline<>(SB) + +TEXT libc_fpathconf_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_fpathconf(SB) + RET +GLOBL ·libc_fpathconf_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fpathconf_trampoline_addr(SB)/8, $libc_fpathconf_trampoline<>(SB) + +TEXT libc_fstat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_fstat(SB) + RET +GLOBL ·libc_fstat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fstat_trampoline_addr(SB)/8, $libc_fstat_trampoline<>(SB) + +TEXT libc_fstatat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_fstatat(SB) + RET +GLOBL ·libc_fstatat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fstatat_trampoline_addr(SB)/8, $libc_fstatat_trampoline<>(SB) + +TEXT libc_fstatfs_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_fstatfs(SB) + RET +GLOBL ·libc_fstatfs_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fstatfs_trampoline_addr(SB)/8, $libc_fstatfs_trampoline<>(SB) + +TEXT libc_fsync_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_fsync(SB) + RET +GLOBL ·libc_fsync_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fsync_trampoline_addr(SB)/8, $libc_fsync_trampoline<>(SB) + +TEXT libc_ftruncate_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_ftruncate(SB) + RET +GLOBL ·libc_ftruncate_trampoline_addr(SB), RODATA, $8 +DATA ·libc_ftruncate_trampoline_addr(SB)/8, $libc_ftruncate_trampoline<>(SB) + +TEXT libc_getegid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getegid(SB) + RET +GLOBL ·libc_getegid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getegid_trampoline_addr(SB)/8, $libc_getegid_trampoline<>(SB) + +TEXT libc_geteuid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_geteuid(SB) + RET +GLOBL ·libc_geteuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_geteuid_trampoline_addr(SB)/8, $libc_geteuid_trampoline<>(SB) + +TEXT libc_getgid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getgid(SB) + RET +GLOBL ·libc_getgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getgid_trampoline_addr(SB)/8, $libc_getgid_trampoline<>(SB) + +TEXT libc_getpgid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getpgid(SB) + RET +GLOBL ·libc_getpgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpgid_trampoline_addr(SB)/8, $libc_getpgid_trampoline<>(SB) + +TEXT libc_getpgrp_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getpgrp(SB) + RET +GLOBL ·libc_getpgrp_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpgrp_trampoline_addr(SB)/8, $libc_getpgrp_trampoline<>(SB) + +TEXT libc_getpid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getpid(SB) + RET +GLOBL ·libc_getpid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpid_trampoline_addr(SB)/8, $libc_getpid_trampoline<>(SB) + +TEXT libc_getppid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getppid(SB) + RET +GLOBL ·libc_getppid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getppid_trampoline_addr(SB)/8, $libc_getppid_trampoline<>(SB) + +TEXT libc_getpriority_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getpriority(SB) + RET +GLOBL ·libc_getpriority_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpriority_trampoline_addr(SB)/8, $libc_getpriority_trampoline<>(SB) + +TEXT libc_getrlimit_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getrlimit(SB) + RET +GLOBL ·libc_getrlimit_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getrlimit_trampoline_addr(SB)/8, $libc_getrlimit_trampoline<>(SB) + +TEXT libc_getrtable_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getrtable(SB) + RET +GLOBL ·libc_getrtable_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getrtable_trampoline_addr(SB)/8, $libc_getrtable_trampoline<>(SB) + +TEXT libc_getrusage_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getrusage(SB) + RET +GLOBL ·libc_getrusage_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getrusage_trampoline_addr(SB)/8, $libc_getrusage_trampoline<>(SB) + +TEXT libc_getsid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getsid(SB) + RET +GLOBL ·libc_getsid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getsid_trampoline_addr(SB)/8, $libc_getsid_trampoline<>(SB) + +TEXT libc_gettimeofday_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_gettimeofday(SB) + RET +GLOBL ·libc_gettimeofday_trampoline_addr(SB), RODATA, $8 +DATA ·libc_gettimeofday_trampoline_addr(SB)/8, $libc_gettimeofday_trampoline<>(SB) + +TEXT libc_getuid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getuid(SB) + RET +GLOBL ·libc_getuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getuid_trampoline_addr(SB)/8, $libc_getuid_trampoline<>(SB) + +TEXT libc_issetugid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_issetugid(SB) + RET +GLOBL ·libc_issetugid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_issetugid_trampoline_addr(SB)/8, $libc_issetugid_trampoline<>(SB) + +TEXT libc_kill_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_kill(SB) + RET +GLOBL ·libc_kill_trampoline_addr(SB), RODATA, $8 +DATA ·libc_kill_trampoline_addr(SB)/8, $libc_kill_trampoline<>(SB) + +TEXT libc_kqueue_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_kqueue(SB) + RET +GLOBL ·libc_kqueue_trampoline_addr(SB), RODATA, $8 +DATA ·libc_kqueue_trampoline_addr(SB)/8, $libc_kqueue_trampoline<>(SB) + +TEXT libc_lchown_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_lchown(SB) + RET +GLOBL ·libc_lchown_trampoline_addr(SB), RODATA, $8 +DATA ·libc_lchown_trampoline_addr(SB)/8, $libc_lchown_trampoline<>(SB) + +TEXT libc_link_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_link(SB) + RET +GLOBL ·libc_link_trampoline_addr(SB), RODATA, $8 +DATA ·libc_link_trampoline_addr(SB)/8, $libc_link_trampoline<>(SB) + +TEXT libc_linkat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_linkat(SB) + RET +GLOBL ·libc_linkat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_linkat_trampoline_addr(SB)/8, $libc_linkat_trampoline<>(SB) + +TEXT libc_listen_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_listen(SB) + RET +GLOBL ·libc_listen_trampoline_addr(SB), RODATA, $8 +DATA ·libc_listen_trampoline_addr(SB)/8, $libc_listen_trampoline<>(SB) + +TEXT libc_lstat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_lstat(SB) + RET +GLOBL ·libc_lstat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_lstat_trampoline_addr(SB)/8, $libc_lstat_trampoline<>(SB) + +TEXT libc_mkdir_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_mkdir(SB) + RET +GLOBL ·libc_mkdir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mkdir_trampoline_addr(SB)/8, $libc_mkdir_trampoline<>(SB) + +TEXT libc_mkdirat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_mkdirat(SB) + RET +GLOBL ·libc_mkdirat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mkdirat_trampoline_addr(SB)/8, $libc_mkdirat_trampoline<>(SB) + +TEXT libc_mkfifo_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_mkfifo(SB) + RET +GLOBL ·libc_mkfifo_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mkfifo_trampoline_addr(SB)/8, $libc_mkfifo_trampoline<>(SB) + +TEXT libc_mkfifoat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_mkfifoat(SB) + RET +GLOBL ·libc_mkfifoat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mkfifoat_trampoline_addr(SB)/8, $libc_mkfifoat_trampoline<>(SB) + +TEXT libc_mknod_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_mknod(SB) + RET +GLOBL ·libc_mknod_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mknod_trampoline_addr(SB)/8, $libc_mknod_trampoline<>(SB) + +TEXT libc_mknodat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_mknodat(SB) + RET +GLOBL ·libc_mknodat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mknodat_trampoline_addr(SB)/8, $libc_mknodat_trampoline<>(SB) + +TEXT libc_nanosleep_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_nanosleep(SB) + RET +GLOBL ·libc_nanosleep_trampoline_addr(SB), RODATA, $8 +DATA ·libc_nanosleep_trampoline_addr(SB)/8, $libc_nanosleep_trampoline<>(SB) + +TEXT libc_open_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_open(SB) + RET +GLOBL ·libc_open_trampoline_addr(SB), RODATA, $8 +DATA ·libc_open_trampoline_addr(SB)/8, $libc_open_trampoline<>(SB) + +TEXT libc_openat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_openat(SB) + RET +GLOBL ·libc_openat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_openat_trampoline_addr(SB)/8, $libc_openat_trampoline<>(SB) + +TEXT libc_pathconf_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_pathconf(SB) + RET +GLOBL ·libc_pathconf_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pathconf_trampoline_addr(SB)/8, $libc_pathconf_trampoline<>(SB) + +TEXT libc_pread_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_pread(SB) + RET +GLOBL ·libc_pread_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pread_trampoline_addr(SB)/8, $libc_pread_trampoline<>(SB) + +TEXT libc_pwrite_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_pwrite(SB) + RET +GLOBL ·libc_pwrite_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pwrite_trampoline_addr(SB)/8, $libc_pwrite_trampoline<>(SB) + +TEXT libc_read_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_read(SB) + RET +GLOBL ·libc_read_trampoline_addr(SB), RODATA, $8 +DATA ·libc_read_trampoline_addr(SB)/8, $libc_read_trampoline<>(SB) + +TEXT libc_readlink_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_readlink(SB) + RET +GLOBL ·libc_readlink_trampoline_addr(SB), RODATA, $8 +DATA ·libc_readlink_trampoline_addr(SB)/8, $libc_readlink_trampoline<>(SB) + +TEXT libc_readlinkat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_readlinkat(SB) + RET +GLOBL ·libc_readlinkat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_readlinkat_trampoline_addr(SB)/8, $libc_readlinkat_trampoline<>(SB) + +TEXT libc_rename_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_rename(SB) + RET +GLOBL ·libc_rename_trampoline_addr(SB), RODATA, $8 +DATA ·libc_rename_trampoline_addr(SB)/8, $libc_rename_trampoline<>(SB) + +TEXT libc_renameat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_renameat(SB) + RET +GLOBL ·libc_renameat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_renameat_trampoline_addr(SB)/8, $libc_renameat_trampoline<>(SB) + +TEXT libc_revoke_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_revoke(SB) + RET +GLOBL ·libc_revoke_trampoline_addr(SB), RODATA, $8 +DATA ·libc_revoke_trampoline_addr(SB)/8, $libc_revoke_trampoline<>(SB) + +TEXT libc_rmdir_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_rmdir(SB) + RET +GLOBL ·libc_rmdir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_rmdir_trampoline_addr(SB)/8, $libc_rmdir_trampoline<>(SB) + +TEXT libc_lseek_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_lseek(SB) + RET +GLOBL ·libc_lseek_trampoline_addr(SB), RODATA, $8 +DATA ·libc_lseek_trampoline_addr(SB)/8, $libc_lseek_trampoline<>(SB) + +TEXT libc_select_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_select(SB) + RET +GLOBL ·libc_select_trampoline_addr(SB), RODATA, $8 +DATA ·libc_select_trampoline_addr(SB)/8, $libc_select_trampoline<>(SB) + +TEXT libc_setegid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_setegid(SB) + RET +GLOBL ·libc_setegid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setegid_trampoline_addr(SB)/8, $libc_setegid_trampoline<>(SB) + +TEXT libc_seteuid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_seteuid(SB) + RET +GLOBL ·libc_seteuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_seteuid_trampoline_addr(SB)/8, $libc_seteuid_trampoline<>(SB) + +TEXT libc_setgid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_setgid(SB) + RET +GLOBL ·libc_setgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setgid_trampoline_addr(SB)/8, $libc_setgid_trampoline<>(SB) + +TEXT libc_setlogin_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_setlogin(SB) + RET +GLOBL ·libc_setlogin_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setlogin_trampoline_addr(SB)/8, $libc_setlogin_trampoline<>(SB) + +TEXT libc_setpgid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_setpgid(SB) + RET +GLOBL ·libc_setpgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setpgid_trampoline_addr(SB)/8, $libc_setpgid_trampoline<>(SB) + +TEXT libc_setpriority_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_setpriority(SB) + RET +GLOBL ·libc_setpriority_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setpriority_trampoline_addr(SB)/8, $libc_setpriority_trampoline<>(SB) + +TEXT libc_setregid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_setregid(SB) + RET +GLOBL ·libc_setregid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setregid_trampoline_addr(SB)/8, $libc_setregid_trampoline<>(SB) + +TEXT libc_setreuid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_setreuid(SB) + RET +GLOBL ·libc_setreuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setreuid_trampoline_addr(SB)/8, $libc_setreuid_trampoline<>(SB) + +TEXT libc_setresgid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_setresgid(SB) + RET +GLOBL ·libc_setresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setresgid_trampoline_addr(SB)/8, $libc_setresgid_trampoline<>(SB) + +TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_setresuid(SB) + RET +GLOBL ·libc_setresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setresuid_trampoline_addr(SB)/8, $libc_setresuid_trampoline<>(SB) + +TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_setrtable(SB) + RET +GLOBL ·libc_setrtable_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setrtable_trampoline_addr(SB)/8, $libc_setrtable_trampoline<>(SB) + +TEXT libc_setsid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_setsid(SB) + RET +GLOBL ·libc_setsid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setsid_trampoline_addr(SB)/8, $libc_setsid_trampoline<>(SB) + +TEXT libc_settimeofday_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_settimeofday(SB) + RET +GLOBL ·libc_settimeofday_trampoline_addr(SB), RODATA, $8 +DATA ·libc_settimeofday_trampoline_addr(SB)/8, $libc_settimeofday_trampoline<>(SB) + +TEXT libc_setuid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_setuid(SB) + RET +GLOBL ·libc_setuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setuid_trampoline_addr(SB)/8, $libc_setuid_trampoline<>(SB) + +TEXT libc_stat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_stat(SB) + RET +GLOBL ·libc_stat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_stat_trampoline_addr(SB)/8, $libc_stat_trampoline<>(SB) + +TEXT libc_statfs_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_statfs(SB) + RET +GLOBL ·libc_statfs_trampoline_addr(SB), RODATA, $8 +DATA ·libc_statfs_trampoline_addr(SB)/8, $libc_statfs_trampoline<>(SB) + +TEXT libc_symlink_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_symlink(SB) + RET +GLOBL ·libc_symlink_trampoline_addr(SB), RODATA, $8 +DATA ·libc_symlink_trampoline_addr(SB)/8, $libc_symlink_trampoline<>(SB) + +TEXT libc_symlinkat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_symlinkat(SB) + RET +GLOBL ·libc_symlinkat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_symlinkat_trampoline_addr(SB)/8, $libc_symlinkat_trampoline<>(SB) + +TEXT libc_sync_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_sync(SB) + RET +GLOBL ·libc_sync_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sync_trampoline_addr(SB)/8, $libc_sync_trampoline<>(SB) + +TEXT libc_truncate_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_truncate(SB) + RET +GLOBL ·libc_truncate_trampoline_addr(SB), RODATA, $8 +DATA ·libc_truncate_trampoline_addr(SB)/8, $libc_truncate_trampoline<>(SB) + +TEXT libc_umask_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_umask(SB) + RET +GLOBL ·libc_umask_trampoline_addr(SB), RODATA, $8 +DATA ·libc_umask_trampoline_addr(SB)/8, $libc_umask_trampoline<>(SB) + +TEXT libc_unlink_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_unlink(SB) + RET +GLOBL ·libc_unlink_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unlink_trampoline_addr(SB)/8, $libc_unlink_trampoline<>(SB) + +TEXT libc_unlinkat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_unlinkat(SB) + RET +GLOBL ·libc_unlinkat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unlinkat_trampoline_addr(SB)/8, $libc_unlinkat_trampoline<>(SB) + +TEXT libc_unmount_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_unmount(SB) + RET +GLOBL ·libc_unmount_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unmount_trampoline_addr(SB)/8, $libc_unmount_trampoline<>(SB) + +TEXT libc_write_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_write(SB) + RET +GLOBL ·libc_write_trampoline_addr(SB), RODATA, $8 +DATA ·libc_write_trampoline_addr(SB)/8, $libc_write_trampoline<>(SB) + +TEXT libc_mmap_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_mmap(SB) + RET +GLOBL ·libc_mmap_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mmap_trampoline_addr(SB)/8, $libc_mmap_trampoline<>(SB) + +TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_munmap(SB) + RET +GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 +DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) + +TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_utimensat(SB) + RET +GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go new file mode 100644 index 0000000..32cbbbc --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go @@ -0,0 +1,2251 @@ +// go run mksyscall.go -openbsd -libc -tags openbsd,riscv64 syscall_bsd.go syscall_openbsd.go syscall_openbsd_riscv64.go +// Code generated by the command above; see README.md. DO NOT EDIT. + +//go:build openbsd && riscv64 +// +build openbsd,riscv64 + +package unix + +import ( + "syscall" + "unsafe" +) + +var _ syscall.Errno + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getgroups(ngid int, gid *_Gid_t) (n int, err error) { + r0, _, e1 := syscall_rawSyscall(libc_getgroups_trampoline_addr, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getgroups_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getgroups getgroups "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func setgroups(ngid int, gid *_Gid_t) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setgroups_trampoline_addr, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setgroups_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setgroups setgroups "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func wait4(pid int, wstatus *_C_int, options int, rusage *Rusage) (wpid int, err error) { + r0, _, e1 := syscall_syscall6(libc_wait4_trampoline_addr, uintptr(pid), uintptr(unsafe.Pointer(wstatus)), uintptr(options), uintptr(unsafe.Pointer(rusage)), 0, 0) + wpid = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_wait4_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_wait4 wait4 "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { + r0, _, e1 := syscall_syscall(libc_accept_trampoline_addr, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_accept_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_accept accept "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { + _, _, e1 := syscall_syscall(libc_bind_trampoline_addr, uintptr(s), uintptr(addr), uintptr(addrlen)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_bind_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_bind bind "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func connect(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { + _, _, e1 := syscall_syscall(libc_connect_trampoline_addr, uintptr(s), uintptr(addr), uintptr(addrlen)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_connect_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_connect connect "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func socket(domain int, typ int, proto int) (fd int, err error) { + r0, _, e1 := syscall_rawSyscall(libc_socket_trampoline_addr, uintptr(domain), uintptr(typ), uintptr(proto)) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_socket_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_socket socket "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getsockopt(s int, level int, name int, val unsafe.Pointer, vallen *_Socklen) (err error) { + _, _, e1 := syscall_syscall6(libc_getsockopt_trampoline_addr, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(unsafe.Pointer(vallen)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getsockopt_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getsockopt getsockopt "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func setsockopt(s int, level int, name int, val unsafe.Pointer, vallen uintptr) (err error) { + _, _, e1 := syscall_syscall6(libc_setsockopt_trampoline_addr, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(vallen), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setsockopt_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setsockopt setsockopt "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getpeername(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { + _, _, e1 := syscall_rawSyscall(libc_getpeername_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getpeername_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpeername getpeername "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getsockname(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { + _, _, e1 := syscall_rawSyscall(libc_getsockname_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getsockname_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getsockname getsockname "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Shutdown(s int, how int) (err error) { + _, _, e1 := syscall_syscall(libc_shutdown_trampoline_addr, uintptr(s), uintptr(how), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_shutdown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_shutdown shutdown "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func socketpair(domain int, typ int, proto int, fd *[2]int32) (err error) { + _, _, e1 := syscall_rawSyscall6(libc_socketpair_trampoline_addr, uintptr(domain), uintptr(typ), uintptr(proto), uintptr(unsafe.Pointer(fd)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_socketpair_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_socketpair socketpair "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Socklen) (n int, err error) { + var _p0 unsafe.Pointer + if len(p) > 0 { + _p0 = unsafe.Pointer(&p[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall6(libc_recvfrom_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(flags), uintptr(unsafe.Pointer(from)), uintptr(unsafe.Pointer(fromlen))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_recvfrom_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_recvfrom recvfrom "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) (err error) { + var _p0 unsafe.Pointer + if len(buf) > 0 { + _p0 = unsafe.Pointer(&buf[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall6(libc_sendto_trampoline_addr, uintptr(s), uintptr(_p0), uintptr(len(buf)), uintptr(flags), uintptr(to), uintptr(addrlen)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_sendto_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sendto sendto "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func recvmsg(s int, msg *Msghdr, flags int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_recvmsg_trampoline_addr, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_recvmsg_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_recvmsg recvmsg "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_sendmsg_trampoline_addr, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_sendmsg_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sendmsg sendmsg "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func kevent(kq int, change unsafe.Pointer, nchange int, event unsafe.Pointer, nevent int, timeout *Timespec) (n int, err error) { + r0, _, e1 := syscall_syscall6(libc_kevent_trampoline_addr, uintptr(kq), uintptr(change), uintptr(nchange), uintptr(event), uintptr(nevent), uintptr(unsafe.Pointer(timeout))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_kevent_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_kevent kevent "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func utimes(path string, timeval *[2]Timeval) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_utimes_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(timeval)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_utimes_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_utimes utimes "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func futimes(fd int, timeval *[2]Timeval) (err error) { + _, _, e1 := syscall_syscall(libc_futimes_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(timeval)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_futimes_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_futimes futimes "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func poll(fds *PollFd, nfds int, timeout int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_poll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(timeout)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_poll_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_poll poll "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Madvise(b []byte, behav int) (err error) { + var _p0 unsafe.Pointer + if len(b) > 0 { + _p0 = unsafe.Pointer(&b[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall(libc_madvise_trampoline_addr, uintptr(_p0), uintptr(len(b)), uintptr(behav)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_madvise_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_madvise madvise "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mlock(b []byte) (err error) { + var _p0 unsafe.Pointer + if len(b) > 0 { + _p0 = unsafe.Pointer(&b[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall(libc_mlock_trampoline_addr, uintptr(_p0), uintptr(len(b)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mlock_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mlock mlock "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mlockall(flags int) (err error) { + _, _, e1 := syscall_syscall(libc_mlockall_trampoline_addr, uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mlockall_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mlockall mlockall "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mprotect(b []byte, prot int) (err error) { + var _p0 unsafe.Pointer + if len(b) > 0 { + _p0 = unsafe.Pointer(&b[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall(libc_mprotect_trampoline_addr, uintptr(_p0), uintptr(len(b)), uintptr(prot)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mprotect_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mprotect mprotect "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Msync(b []byte, flags int) (err error) { + var _p0 unsafe.Pointer + if len(b) > 0 { + _p0 = unsafe.Pointer(&b[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall(libc_msync_trampoline_addr, uintptr(_p0), uintptr(len(b)), uintptr(flags)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_msync_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_msync msync "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Munlock(b []byte) (err error) { + var _p0 unsafe.Pointer + if len(b) > 0 { + _p0 = unsafe.Pointer(&b[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall(libc_munlock_trampoline_addr, uintptr(_p0), uintptr(len(b)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_munlock_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_munlock munlock "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Munlockall() (err error) { + _, _, e1 := syscall_syscall(libc_munlockall_trampoline_addr, 0, 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_munlockall_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_munlockall munlockall "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pipe2(p *[2]_C_int, flags int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_pipe2_trampoline_addr, uintptr(unsafe.Pointer(p)), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pipe2_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pipe2 pipe2 "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getdents(fd int, buf []byte) (n int, err error) { + var _p0 unsafe.Pointer + if len(buf) > 0 { + _p0 = unsafe.Pointer(&buf[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall(libc_getdents_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(buf))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getdents_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getdents getdents "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getcwd(buf []byte) (n int, err error) { + var _p0 unsafe.Pointer + if len(buf) > 0 { + _p0 = unsafe.Pointer(&buf[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall(libc_getcwd_trampoline_addr, uintptr(_p0), uintptr(len(buf)), 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getcwd_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getcwd getcwd "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ioctl(fd int, req uint, arg uintptr) (err error) { + _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { + _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { + var _p0 unsafe.Pointer + if len(mib) > 0 { + _p0 = unsafe.Pointer(&mib[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall6(libc_sysctl_trampoline_addr, uintptr(_p0), uintptr(len(mib)), uintptr(unsafe.Pointer(old)), uintptr(unsafe.Pointer(oldlen)), uintptr(unsafe.Pointer(new)), uintptr(newlen)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_sysctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sysctl sysctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { + r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_ppoll_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ppoll ppoll "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Access(path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_access_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_access_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_access access "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Adjtime(delta *Timeval, olddelta *Timeval) (err error) { + _, _, e1 := syscall_syscall(libc_adjtime_trampoline_addr, uintptr(unsafe.Pointer(delta)), uintptr(unsafe.Pointer(olddelta)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_adjtime_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_adjtime adjtime "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Chdir(path string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_chdir_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_chdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chdir chdir "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Chflags(path string, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_chflags_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_chflags_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chflags chflags "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Chmod(path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_chmod_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_chmod_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chmod chmod "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Chown(path string, uid int, gid int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_chown_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_chown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chown chown "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Chroot(path string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_chroot_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_chroot_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chroot chroot "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ClockGettime(clockid int32, time *Timespec) (err error) { + _, _, e1 := syscall_syscall(libc_clock_gettime_trampoline_addr, uintptr(clockid), uintptr(unsafe.Pointer(time)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_clock_gettime_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_clock_gettime clock_gettime "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Close(fd int) (err error) { + _, _, e1 := syscall_syscall(libc_close_trampoline_addr, uintptr(fd), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_close_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_close close "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Dup(fd int) (nfd int, err error) { + r0, _, e1 := syscall_syscall(libc_dup_trampoline_addr, uintptr(fd), 0, 0) + nfd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_dup_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_dup dup "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Dup2(from int, to int) (err error) { + _, _, e1 := syscall_syscall(libc_dup2_trampoline_addr, uintptr(from), uintptr(to), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_dup2_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_dup2 dup2 "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Dup3(from int, to int, flags int) (err error) { + _, _, e1 := syscall_syscall(libc_dup3_trampoline_addr, uintptr(from), uintptr(to), uintptr(flags)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_dup3_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_dup3 dup3 "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Exit(code int) { + syscall_syscall(libc_exit_trampoline_addr, uintptr(code), 0, 0) + return +} + +var libc_exit_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_exit exit "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_faccessat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_faccessat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_faccessat faccessat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchdir(fd int) (err error) { + _, _, e1 := syscall_syscall(libc_fchdir_trampoline_addr, uintptr(fd), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fchdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchdir fchdir "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchflags(fd int, flags int) (err error) { + _, _, e1 := syscall_syscall(libc_fchflags_trampoline_addr, uintptr(fd), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fchflags_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchflags fchflags "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchmod(fd int, mode uint32) (err error) { + _, _, e1 := syscall_syscall(libc_fchmod_trampoline_addr, uintptr(fd), uintptr(mode), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fchmod_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchmod fchmod "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_fchmodat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fchmodat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchmodat fchmodat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchown(fd int, uid int, gid int) (err error) { + _, _, e1 := syscall_syscall(libc_fchown_trampoline_addr, uintptr(fd), uintptr(uid), uintptr(gid)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fchown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchown fchown "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchownat(dirfd int, path string, uid int, gid int, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_fchownat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fchownat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchownat fchownat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Flock(fd int, how int) (err error) { + _, _, e1 := syscall_syscall(libc_flock_trampoline_addr, uintptr(fd), uintptr(how), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_flock_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_flock flock "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fpathconf(fd int, name int) (val int, err error) { + r0, _, e1 := syscall_syscall(libc_fpathconf_trampoline_addr, uintptr(fd), uintptr(name), 0) + val = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fpathconf_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fpathconf fpathconf "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fstat(fd int, stat *Stat_t) (err error) { + _, _, e1 := syscall_syscall(libc_fstat_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fstat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fstat fstat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_fstatat_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fstatat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fstatat fstatat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fstatfs(fd int, stat *Statfs_t) (err error) { + _, _, e1 := syscall_syscall(libc_fstatfs_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fstatfs_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fstatfs fstatfs "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fsync(fd int) (err error) { + _, _, e1 := syscall_syscall(libc_fsync_trampoline_addr, uintptr(fd), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fsync_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fsync fsync "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Ftruncate(fd int, length int64) (err error) { + _, _, e1 := syscall_syscall(libc_ftruncate_trampoline_addr, uintptr(fd), uintptr(length), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_ftruncate_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ftruncate ftruncate "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getegid() (egid int) { + r0, _, _ := syscall_rawSyscall(libc_getegid_trampoline_addr, 0, 0, 0) + egid = int(r0) + return +} + +var libc_getegid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getegid getegid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Geteuid() (uid int) { + r0, _, _ := syscall_rawSyscall(libc_geteuid_trampoline_addr, 0, 0, 0) + uid = int(r0) + return +} + +var libc_geteuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_geteuid geteuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getgid() (gid int) { + r0, _, _ := syscall_rawSyscall(libc_getgid_trampoline_addr, 0, 0, 0) + gid = int(r0) + return +} + +var libc_getgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getgid getgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getpgid(pid int) (pgid int, err error) { + r0, _, e1 := syscall_rawSyscall(libc_getpgid_trampoline_addr, uintptr(pid), 0, 0) + pgid = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getpgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpgid getpgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getpgrp() (pgrp int) { + r0, _, _ := syscall_rawSyscall(libc_getpgrp_trampoline_addr, 0, 0, 0) + pgrp = int(r0) + return +} + +var libc_getpgrp_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpgrp getpgrp "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getpid() (pid int) { + r0, _, _ := syscall_rawSyscall(libc_getpid_trampoline_addr, 0, 0, 0) + pid = int(r0) + return +} + +var libc_getpid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpid getpid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getppid() (ppid int) { + r0, _, _ := syscall_rawSyscall(libc_getppid_trampoline_addr, 0, 0, 0) + ppid = int(r0) + return +} + +var libc_getppid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getppid getppid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getpriority(which int, who int) (prio int, err error) { + r0, _, e1 := syscall_syscall(libc_getpriority_trampoline_addr, uintptr(which), uintptr(who), 0) + prio = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getpriority_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpriority getpriority "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getrlimit(which int, lim *Rlimit) (err error) { + _, _, e1 := syscall_rawSyscall(libc_getrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getrlimit_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getrlimit getrlimit "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getrtable() (rtable int, err error) { + r0, _, e1 := syscall_rawSyscall(libc_getrtable_trampoline_addr, 0, 0, 0) + rtable = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getrtable_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getrtable getrtable "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getrusage(who int, rusage *Rusage) (err error) { + _, _, e1 := syscall_rawSyscall(libc_getrusage_trampoline_addr, uintptr(who), uintptr(unsafe.Pointer(rusage)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getrusage_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getrusage getrusage "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getsid(pid int) (sid int, err error) { + r0, _, e1 := syscall_rawSyscall(libc_getsid_trampoline_addr, uintptr(pid), 0, 0) + sid = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getsid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getsid getsid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Gettimeofday(tv *Timeval) (err error) { + _, _, e1 := syscall_rawSyscall(libc_gettimeofday_trampoline_addr, uintptr(unsafe.Pointer(tv)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_gettimeofday_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_gettimeofday gettimeofday "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getuid() (uid int) { + r0, _, _ := syscall_rawSyscall(libc_getuid_trampoline_addr, 0, 0, 0) + uid = int(r0) + return +} + +var libc_getuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getuid getuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Issetugid() (tainted bool) { + r0, _, _ := syscall_syscall(libc_issetugid_trampoline_addr, 0, 0, 0) + tainted = bool(r0 != 0) + return +} + +var libc_issetugid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_issetugid issetugid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Kill(pid int, signum syscall.Signal) (err error) { + _, _, e1 := syscall_syscall(libc_kill_trampoline_addr, uintptr(pid), uintptr(signum), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_kill_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_kill kill "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Kqueue() (fd int, err error) { + r0, _, e1 := syscall_syscall(libc_kqueue_trampoline_addr, 0, 0, 0) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_kqueue_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_kqueue kqueue "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Lchown(path string, uid int, gid int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_lchown_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_lchown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_lchown lchown "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Link(path string, link string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(link) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_link_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_link_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_link link "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Linkat(pathfd int, path string, linkfd int, link string, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(link) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_linkat_trampoline_addr, uintptr(pathfd), uintptr(unsafe.Pointer(_p0)), uintptr(linkfd), uintptr(unsafe.Pointer(_p1)), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_linkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_linkat linkat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Listen(s int, backlog int) (err error) { + _, _, e1 := syscall_syscall(libc_listen_trampoline_addr, uintptr(s), uintptr(backlog), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_listen_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_listen listen "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Lstat(path string, stat *Stat_t) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_lstat_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_lstat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_lstat lstat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mkdir(path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_mkdir_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mkdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkdir mkdir "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mkdirat(dirfd int, path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_mkdirat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mkdirat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkdirat mkdirat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mkfifo(path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_mkfifo_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mkfifo_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkfifo mkfifo "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mkfifoat(dirfd int, path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_mkfifoat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mkfifoat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkfifoat mkfifoat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mknod(path string, mode uint32, dev int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_mknod_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mknod_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mknod mknod "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mknodat(dirfd int, path string, mode uint32, dev int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_mknodat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mknodat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mknodat mknodat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Nanosleep(time *Timespec, leftover *Timespec) (err error) { + _, _, e1 := syscall_syscall(libc_nanosleep_trampoline_addr, uintptr(unsafe.Pointer(time)), uintptr(unsafe.Pointer(leftover)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_nanosleep_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_nanosleep nanosleep "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Open(path string, mode int, perm uint32) (fd int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + r0, _, e1 := syscall_syscall(libc_open_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm)) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_open_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_open open "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Openat(dirfd int, path string, mode int, perm uint32) (fd int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + r0, _, e1 := syscall_syscall6(libc_openat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm), 0, 0) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_openat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_openat openat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Pathconf(path string, name int) (val int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + r0, _, e1 := syscall_syscall(libc_pathconf_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(name), 0) + val = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pathconf_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pathconf pathconf "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pread(fd int, p []byte, offset int64) (n int, err error) { + var _p0 unsafe.Pointer + if len(p) > 0 { + _p0 = unsafe.Pointer(&p[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall6(libc_pread_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(offset), 0, 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pread_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pread pread "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pwrite(fd int, p []byte, offset int64) (n int, err error) { + var _p0 unsafe.Pointer + if len(p) > 0 { + _p0 = unsafe.Pointer(&p[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall6(libc_pwrite_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(offset), 0, 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pwrite_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pwrite pwrite "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func read(fd int, p []byte) (n int, err error) { + var _p0 unsafe.Pointer + if len(p) > 0 { + _p0 = unsafe.Pointer(&p[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_read_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_read read "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Readlink(path string, buf []byte) (n int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 unsafe.Pointer + if len(buf) > 0 { + _p1 = unsafe.Pointer(&buf[0]) + } else { + _p1 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall(libc_readlink_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_readlink_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_readlink readlink "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Readlinkat(dirfd int, path string, buf []byte) (n int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 unsafe.Pointer + if len(buf) > 0 { + _p1 = unsafe.Pointer(&buf[0]) + } else { + _p1 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall6(libc_readlinkat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf)), 0, 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_readlinkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_readlinkat readlinkat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Rename(from string, to string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(from) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(to) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_rename_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_rename_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_rename rename "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Renameat(fromfd int, from string, tofd int, to string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(from) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(to) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_renameat_trampoline_addr, uintptr(fromfd), uintptr(unsafe.Pointer(_p0)), uintptr(tofd), uintptr(unsafe.Pointer(_p1)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_renameat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_renameat renameat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Revoke(path string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_revoke_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_revoke_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_revoke revoke "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Rmdir(path string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_rmdir_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_rmdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_rmdir rmdir "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Seek(fd int, offset int64, whence int) (newoffset int64, err error) { + r0, _, e1 := syscall_syscall(libc_lseek_trampoline_addr, uintptr(fd), uintptr(offset), uintptr(whence)) + newoffset = int64(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_lseek_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_lseek lseek "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err error) { + r0, _, e1 := syscall_syscall6(libc_select_trampoline_addr, uintptr(nfd), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_select_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_select select "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setegid(egid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setegid_trampoline_addr, uintptr(egid), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setegid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setegid setegid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Seteuid(euid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_seteuid_trampoline_addr, uintptr(euid), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_seteuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_seteuid seteuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setgid(gid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setgid_trampoline_addr, uintptr(gid), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setgid setgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setlogin(name string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(name) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_setlogin_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setlogin_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setlogin setlogin "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setpgid(pid int, pgid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setpgid_trampoline_addr, uintptr(pid), uintptr(pgid), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setpgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setpgid setpgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setpriority(which int, who int, prio int) (err error) { + _, _, e1 := syscall_syscall(libc_setpriority_trampoline_addr, uintptr(which), uintptr(who), uintptr(prio)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setpriority_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setpriority setpriority "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setregid(rgid int, egid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setregid_trampoline_addr, uintptr(rgid), uintptr(egid), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setregid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setregid setregid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setreuid(ruid int, euid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setreuid_trampoline_addr, uintptr(ruid), uintptr(euid), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setreuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setreuid setreuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setresgid(rgid int, egid int, sgid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setresgid_trampoline_addr, uintptr(rgid), uintptr(egid), uintptr(sgid)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setresgid setresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setresuid(ruid int, euid int, suid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setresuid_trampoline_addr, uintptr(ruid), uintptr(euid), uintptr(suid)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setresuid setresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setrtable(rtable int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setrtable_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setrtable setrtable "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setsid() (pid int, err error) { + r0, _, e1 := syscall_rawSyscall(libc_setsid_trampoline_addr, 0, 0, 0) + pid = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setsid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setsid setsid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Settimeofday(tp *Timeval) (err error) { + _, _, e1 := syscall_rawSyscall(libc_settimeofday_trampoline_addr, uintptr(unsafe.Pointer(tp)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_settimeofday_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_settimeofday settimeofday "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setuid(uid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setuid_trampoline_addr, uintptr(uid), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setuid setuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Stat(path string, stat *Stat_t) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_stat_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_stat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_stat stat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Statfs(path string, stat *Statfs_t) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_statfs_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_statfs_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_statfs statfs "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Symlink(path string, link string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(link) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_symlink_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_symlink_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_symlink symlink "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Symlinkat(oldpath string, newdirfd int, newpath string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(oldpath) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(newpath) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_symlinkat_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(newdirfd), uintptr(unsafe.Pointer(_p1))) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_symlinkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_symlinkat symlinkat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Sync() (err error) { + _, _, e1 := syscall_syscall(libc_sync_trampoline_addr, 0, 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_sync_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sync sync "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Truncate(path string, length int64) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_truncate_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(length), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_truncate_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_truncate truncate "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Umask(newmask int) (oldmask int) { + r0, _, _ := syscall_syscall(libc_umask_trampoline_addr, uintptr(newmask), 0, 0) + oldmask = int(r0) + return +} + +var libc_umask_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_umask umask "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Unlink(path string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_unlink_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unlink_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unlink unlink "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Unlinkat(dirfd int, path string, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_unlinkat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(flags)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unlinkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unlinkat unlinkat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Unmount(path string, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_unmount_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unmount_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unmount unmount "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func write(fd int, p []byte) (n int, err error) { + var _p0 unsafe.Pointer + if len(p) > 0 { + _p0 = unsafe.Pointer(&p[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_write_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_write write "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) { + r0, _, e1 := syscall_syscall6(libc_mmap_trampoline_addr, uintptr(addr), uintptr(length), uintptr(prot), uintptr(flag), uintptr(fd), uintptr(pos)) + ret = uintptr(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mmap_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mmap mmap "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func munmap(addr uintptr, length uintptr) (err error) { + _, _, e1 := syscall_syscall(libc_munmap_trampoline_addr, uintptr(addr), uintptr(length), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_munmap_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_munmap munmap "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func readlen(fd int, buf *byte, nbuf int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func writelen(fd int, buf *byte, nbuf int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_utimensat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_utimensat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_utimensat utimensat "libc.so" diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s new file mode 100644 index 0000000..477a7d5 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s @@ -0,0 +1,674 @@ +// go run mkasm.go openbsd riscv64 +// Code generated by the command above; DO NOT EDIT. + +#include "textflag.h" + +TEXT libc_getgroups_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getgroups(SB) +GLOBL ·libc_getgroups_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getgroups_trampoline_addr(SB)/8, $libc_getgroups_trampoline<>(SB) + +TEXT libc_setgroups_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setgroups(SB) +GLOBL ·libc_setgroups_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setgroups_trampoline_addr(SB)/8, $libc_setgroups_trampoline<>(SB) + +TEXT libc_wait4_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_wait4(SB) +GLOBL ·libc_wait4_trampoline_addr(SB), RODATA, $8 +DATA ·libc_wait4_trampoline_addr(SB)/8, $libc_wait4_trampoline<>(SB) + +TEXT libc_accept_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_accept(SB) +GLOBL ·libc_accept_trampoline_addr(SB), RODATA, $8 +DATA ·libc_accept_trampoline_addr(SB)/8, $libc_accept_trampoline<>(SB) + +TEXT libc_bind_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_bind(SB) +GLOBL ·libc_bind_trampoline_addr(SB), RODATA, $8 +DATA ·libc_bind_trampoline_addr(SB)/8, $libc_bind_trampoline<>(SB) + +TEXT libc_connect_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_connect(SB) +GLOBL ·libc_connect_trampoline_addr(SB), RODATA, $8 +DATA ·libc_connect_trampoline_addr(SB)/8, $libc_connect_trampoline<>(SB) + +TEXT libc_socket_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_socket(SB) +GLOBL ·libc_socket_trampoline_addr(SB), RODATA, $8 +DATA ·libc_socket_trampoline_addr(SB)/8, $libc_socket_trampoline<>(SB) + +TEXT libc_getsockopt_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getsockopt(SB) +GLOBL ·libc_getsockopt_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getsockopt_trampoline_addr(SB)/8, $libc_getsockopt_trampoline<>(SB) + +TEXT libc_setsockopt_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setsockopt(SB) +GLOBL ·libc_setsockopt_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setsockopt_trampoline_addr(SB)/8, $libc_setsockopt_trampoline<>(SB) + +TEXT libc_getpeername_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpeername(SB) +GLOBL ·libc_getpeername_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpeername_trampoline_addr(SB)/8, $libc_getpeername_trampoline<>(SB) + +TEXT libc_getsockname_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getsockname(SB) +GLOBL ·libc_getsockname_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getsockname_trampoline_addr(SB)/8, $libc_getsockname_trampoline<>(SB) + +TEXT libc_shutdown_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_shutdown(SB) +GLOBL ·libc_shutdown_trampoline_addr(SB), RODATA, $8 +DATA ·libc_shutdown_trampoline_addr(SB)/8, $libc_shutdown_trampoline<>(SB) + +TEXT libc_socketpair_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_socketpair(SB) +GLOBL ·libc_socketpair_trampoline_addr(SB), RODATA, $8 +DATA ·libc_socketpair_trampoline_addr(SB)/8, $libc_socketpair_trampoline<>(SB) + +TEXT libc_recvfrom_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_recvfrom(SB) +GLOBL ·libc_recvfrom_trampoline_addr(SB), RODATA, $8 +DATA ·libc_recvfrom_trampoline_addr(SB)/8, $libc_recvfrom_trampoline<>(SB) + +TEXT libc_sendto_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sendto(SB) +GLOBL ·libc_sendto_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sendto_trampoline_addr(SB)/8, $libc_sendto_trampoline<>(SB) + +TEXT libc_recvmsg_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_recvmsg(SB) +GLOBL ·libc_recvmsg_trampoline_addr(SB), RODATA, $8 +DATA ·libc_recvmsg_trampoline_addr(SB)/8, $libc_recvmsg_trampoline<>(SB) + +TEXT libc_sendmsg_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sendmsg(SB) +GLOBL ·libc_sendmsg_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sendmsg_trampoline_addr(SB)/8, $libc_sendmsg_trampoline<>(SB) + +TEXT libc_kevent_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_kevent(SB) +GLOBL ·libc_kevent_trampoline_addr(SB), RODATA, $8 +DATA ·libc_kevent_trampoline_addr(SB)/8, $libc_kevent_trampoline<>(SB) + +TEXT libc_utimes_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_utimes(SB) +GLOBL ·libc_utimes_trampoline_addr(SB), RODATA, $8 +DATA ·libc_utimes_trampoline_addr(SB)/8, $libc_utimes_trampoline<>(SB) + +TEXT libc_futimes_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_futimes(SB) +GLOBL ·libc_futimes_trampoline_addr(SB), RODATA, $8 +DATA ·libc_futimes_trampoline_addr(SB)/8, $libc_futimes_trampoline<>(SB) + +TEXT libc_poll_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_poll(SB) +GLOBL ·libc_poll_trampoline_addr(SB), RODATA, $8 +DATA ·libc_poll_trampoline_addr(SB)/8, $libc_poll_trampoline<>(SB) + +TEXT libc_madvise_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_madvise(SB) +GLOBL ·libc_madvise_trampoline_addr(SB), RODATA, $8 +DATA ·libc_madvise_trampoline_addr(SB)/8, $libc_madvise_trampoline<>(SB) + +TEXT libc_mlock_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mlock(SB) +GLOBL ·libc_mlock_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mlock_trampoline_addr(SB)/8, $libc_mlock_trampoline<>(SB) + +TEXT libc_mlockall_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mlockall(SB) +GLOBL ·libc_mlockall_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mlockall_trampoline_addr(SB)/8, $libc_mlockall_trampoline<>(SB) + +TEXT libc_mprotect_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mprotect(SB) +GLOBL ·libc_mprotect_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mprotect_trampoline_addr(SB)/8, $libc_mprotect_trampoline<>(SB) + +TEXT libc_msync_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_msync(SB) +GLOBL ·libc_msync_trampoline_addr(SB), RODATA, $8 +DATA ·libc_msync_trampoline_addr(SB)/8, $libc_msync_trampoline<>(SB) + +TEXT libc_munlock_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_munlock(SB) +GLOBL ·libc_munlock_trampoline_addr(SB), RODATA, $8 +DATA ·libc_munlock_trampoline_addr(SB)/8, $libc_munlock_trampoline<>(SB) + +TEXT libc_munlockall_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_munlockall(SB) +GLOBL ·libc_munlockall_trampoline_addr(SB), RODATA, $8 +DATA ·libc_munlockall_trampoline_addr(SB)/8, $libc_munlockall_trampoline<>(SB) + +TEXT libc_pipe2_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pipe2(SB) +GLOBL ·libc_pipe2_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pipe2_trampoline_addr(SB)/8, $libc_pipe2_trampoline<>(SB) + +TEXT libc_getdents_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getdents(SB) +GLOBL ·libc_getdents_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getdents_trampoline_addr(SB)/8, $libc_getdents_trampoline<>(SB) + +TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getcwd(SB) +GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) + +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + +TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_ioctl(SB) +GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_ioctl_trampoline_addr(SB)/8, $libc_ioctl_trampoline<>(SB) + +TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sysctl(SB) +GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) + +TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_ppoll(SB) +GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $8 +DATA ·libc_ppoll_trampoline_addr(SB)/8, $libc_ppoll_trampoline<>(SB) + +TEXT libc_access_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_access(SB) +GLOBL ·libc_access_trampoline_addr(SB), RODATA, $8 +DATA ·libc_access_trampoline_addr(SB)/8, $libc_access_trampoline<>(SB) + +TEXT libc_adjtime_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_adjtime(SB) +GLOBL ·libc_adjtime_trampoline_addr(SB), RODATA, $8 +DATA ·libc_adjtime_trampoline_addr(SB)/8, $libc_adjtime_trampoline<>(SB) + +TEXT libc_chdir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chdir(SB) +GLOBL ·libc_chdir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chdir_trampoline_addr(SB)/8, $libc_chdir_trampoline<>(SB) + +TEXT libc_chflags_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chflags(SB) +GLOBL ·libc_chflags_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chflags_trampoline_addr(SB)/8, $libc_chflags_trampoline<>(SB) + +TEXT libc_chmod_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chmod(SB) +GLOBL ·libc_chmod_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chmod_trampoline_addr(SB)/8, $libc_chmod_trampoline<>(SB) + +TEXT libc_chown_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chown(SB) +GLOBL ·libc_chown_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chown_trampoline_addr(SB)/8, $libc_chown_trampoline<>(SB) + +TEXT libc_chroot_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chroot(SB) +GLOBL ·libc_chroot_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chroot_trampoline_addr(SB)/8, $libc_chroot_trampoline<>(SB) + +TEXT libc_clock_gettime_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_clock_gettime(SB) +GLOBL ·libc_clock_gettime_trampoline_addr(SB), RODATA, $8 +DATA ·libc_clock_gettime_trampoline_addr(SB)/8, $libc_clock_gettime_trampoline<>(SB) + +TEXT libc_close_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_close(SB) +GLOBL ·libc_close_trampoline_addr(SB), RODATA, $8 +DATA ·libc_close_trampoline_addr(SB)/8, $libc_close_trampoline<>(SB) + +TEXT libc_dup_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_dup(SB) +GLOBL ·libc_dup_trampoline_addr(SB), RODATA, $8 +DATA ·libc_dup_trampoline_addr(SB)/8, $libc_dup_trampoline<>(SB) + +TEXT libc_dup2_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_dup2(SB) +GLOBL ·libc_dup2_trampoline_addr(SB), RODATA, $8 +DATA ·libc_dup2_trampoline_addr(SB)/8, $libc_dup2_trampoline<>(SB) + +TEXT libc_dup3_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_dup3(SB) +GLOBL ·libc_dup3_trampoline_addr(SB), RODATA, $8 +DATA ·libc_dup3_trampoline_addr(SB)/8, $libc_dup3_trampoline<>(SB) + +TEXT libc_exit_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_exit(SB) +GLOBL ·libc_exit_trampoline_addr(SB), RODATA, $8 +DATA ·libc_exit_trampoline_addr(SB)/8, $libc_exit_trampoline<>(SB) + +TEXT libc_faccessat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_faccessat(SB) +GLOBL ·libc_faccessat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_faccessat_trampoline_addr(SB)/8, $libc_faccessat_trampoline<>(SB) + +TEXT libc_fchdir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchdir(SB) +GLOBL ·libc_fchdir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchdir_trampoline_addr(SB)/8, $libc_fchdir_trampoline<>(SB) + +TEXT libc_fchflags_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchflags(SB) +GLOBL ·libc_fchflags_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchflags_trampoline_addr(SB)/8, $libc_fchflags_trampoline<>(SB) + +TEXT libc_fchmod_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchmod(SB) +GLOBL ·libc_fchmod_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchmod_trampoline_addr(SB)/8, $libc_fchmod_trampoline<>(SB) + +TEXT libc_fchmodat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchmodat(SB) +GLOBL ·libc_fchmodat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchmodat_trampoline_addr(SB)/8, $libc_fchmodat_trampoline<>(SB) + +TEXT libc_fchown_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchown(SB) +GLOBL ·libc_fchown_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchown_trampoline_addr(SB)/8, $libc_fchown_trampoline<>(SB) + +TEXT libc_fchownat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchownat(SB) +GLOBL ·libc_fchownat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchownat_trampoline_addr(SB)/8, $libc_fchownat_trampoline<>(SB) + +TEXT libc_flock_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_flock(SB) +GLOBL ·libc_flock_trampoline_addr(SB), RODATA, $8 +DATA ·libc_flock_trampoline_addr(SB)/8, $libc_flock_trampoline<>(SB) + +TEXT libc_fpathconf_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fpathconf(SB) +GLOBL ·libc_fpathconf_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fpathconf_trampoline_addr(SB)/8, $libc_fpathconf_trampoline<>(SB) + +TEXT libc_fstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fstat(SB) +GLOBL ·libc_fstat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fstat_trampoline_addr(SB)/8, $libc_fstat_trampoline<>(SB) + +TEXT libc_fstatat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fstatat(SB) +GLOBL ·libc_fstatat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fstatat_trampoline_addr(SB)/8, $libc_fstatat_trampoline<>(SB) + +TEXT libc_fstatfs_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fstatfs(SB) +GLOBL ·libc_fstatfs_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fstatfs_trampoline_addr(SB)/8, $libc_fstatfs_trampoline<>(SB) + +TEXT libc_fsync_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fsync(SB) +GLOBL ·libc_fsync_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fsync_trampoline_addr(SB)/8, $libc_fsync_trampoline<>(SB) + +TEXT libc_ftruncate_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_ftruncate(SB) +GLOBL ·libc_ftruncate_trampoline_addr(SB), RODATA, $8 +DATA ·libc_ftruncate_trampoline_addr(SB)/8, $libc_ftruncate_trampoline<>(SB) + +TEXT libc_getegid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getegid(SB) +GLOBL ·libc_getegid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getegid_trampoline_addr(SB)/8, $libc_getegid_trampoline<>(SB) + +TEXT libc_geteuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_geteuid(SB) +GLOBL ·libc_geteuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_geteuid_trampoline_addr(SB)/8, $libc_geteuid_trampoline<>(SB) + +TEXT libc_getgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getgid(SB) +GLOBL ·libc_getgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getgid_trampoline_addr(SB)/8, $libc_getgid_trampoline<>(SB) + +TEXT libc_getpgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpgid(SB) +GLOBL ·libc_getpgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpgid_trampoline_addr(SB)/8, $libc_getpgid_trampoline<>(SB) + +TEXT libc_getpgrp_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpgrp(SB) +GLOBL ·libc_getpgrp_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpgrp_trampoline_addr(SB)/8, $libc_getpgrp_trampoline<>(SB) + +TEXT libc_getpid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpid(SB) +GLOBL ·libc_getpid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpid_trampoline_addr(SB)/8, $libc_getpid_trampoline<>(SB) + +TEXT libc_getppid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getppid(SB) +GLOBL ·libc_getppid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getppid_trampoline_addr(SB)/8, $libc_getppid_trampoline<>(SB) + +TEXT libc_getpriority_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpriority(SB) +GLOBL ·libc_getpriority_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpriority_trampoline_addr(SB)/8, $libc_getpriority_trampoline<>(SB) + +TEXT libc_getrlimit_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getrlimit(SB) +GLOBL ·libc_getrlimit_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getrlimit_trampoline_addr(SB)/8, $libc_getrlimit_trampoline<>(SB) + +TEXT libc_getrtable_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getrtable(SB) +GLOBL ·libc_getrtable_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getrtable_trampoline_addr(SB)/8, $libc_getrtable_trampoline<>(SB) + +TEXT libc_getrusage_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getrusage(SB) +GLOBL ·libc_getrusage_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getrusage_trampoline_addr(SB)/8, $libc_getrusage_trampoline<>(SB) + +TEXT libc_getsid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getsid(SB) +GLOBL ·libc_getsid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getsid_trampoline_addr(SB)/8, $libc_getsid_trampoline<>(SB) + +TEXT libc_gettimeofday_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_gettimeofday(SB) +GLOBL ·libc_gettimeofday_trampoline_addr(SB), RODATA, $8 +DATA ·libc_gettimeofday_trampoline_addr(SB)/8, $libc_gettimeofday_trampoline<>(SB) + +TEXT libc_getuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getuid(SB) +GLOBL ·libc_getuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getuid_trampoline_addr(SB)/8, $libc_getuid_trampoline<>(SB) + +TEXT libc_issetugid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_issetugid(SB) +GLOBL ·libc_issetugid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_issetugid_trampoline_addr(SB)/8, $libc_issetugid_trampoline<>(SB) + +TEXT libc_kill_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_kill(SB) +GLOBL ·libc_kill_trampoline_addr(SB), RODATA, $8 +DATA ·libc_kill_trampoline_addr(SB)/8, $libc_kill_trampoline<>(SB) + +TEXT libc_kqueue_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_kqueue(SB) +GLOBL ·libc_kqueue_trampoline_addr(SB), RODATA, $8 +DATA ·libc_kqueue_trampoline_addr(SB)/8, $libc_kqueue_trampoline<>(SB) + +TEXT libc_lchown_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_lchown(SB) +GLOBL ·libc_lchown_trampoline_addr(SB), RODATA, $8 +DATA ·libc_lchown_trampoline_addr(SB)/8, $libc_lchown_trampoline<>(SB) + +TEXT libc_link_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_link(SB) +GLOBL ·libc_link_trampoline_addr(SB), RODATA, $8 +DATA ·libc_link_trampoline_addr(SB)/8, $libc_link_trampoline<>(SB) + +TEXT libc_linkat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_linkat(SB) +GLOBL ·libc_linkat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_linkat_trampoline_addr(SB)/8, $libc_linkat_trampoline<>(SB) + +TEXT libc_listen_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_listen(SB) +GLOBL ·libc_listen_trampoline_addr(SB), RODATA, $8 +DATA ·libc_listen_trampoline_addr(SB)/8, $libc_listen_trampoline<>(SB) + +TEXT libc_lstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_lstat(SB) +GLOBL ·libc_lstat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_lstat_trampoline_addr(SB)/8, $libc_lstat_trampoline<>(SB) + +TEXT libc_mkdir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mkdir(SB) +GLOBL ·libc_mkdir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mkdir_trampoline_addr(SB)/8, $libc_mkdir_trampoline<>(SB) + +TEXT libc_mkdirat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mkdirat(SB) +GLOBL ·libc_mkdirat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mkdirat_trampoline_addr(SB)/8, $libc_mkdirat_trampoline<>(SB) + +TEXT libc_mkfifo_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mkfifo(SB) +GLOBL ·libc_mkfifo_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mkfifo_trampoline_addr(SB)/8, $libc_mkfifo_trampoline<>(SB) + +TEXT libc_mkfifoat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mkfifoat(SB) +GLOBL ·libc_mkfifoat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mkfifoat_trampoline_addr(SB)/8, $libc_mkfifoat_trampoline<>(SB) + +TEXT libc_mknod_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mknod(SB) +GLOBL ·libc_mknod_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mknod_trampoline_addr(SB)/8, $libc_mknod_trampoline<>(SB) + +TEXT libc_mknodat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mknodat(SB) +GLOBL ·libc_mknodat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mknodat_trampoline_addr(SB)/8, $libc_mknodat_trampoline<>(SB) + +TEXT libc_nanosleep_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_nanosleep(SB) +GLOBL ·libc_nanosleep_trampoline_addr(SB), RODATA, $8 +DATA ·libc_nanosleep_trampoline_addr(SB)/8, $libc_nanosleep_trampoline<>(SB) + +TEXT libc_open_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_open(SB) +GLOBL ·libc_open_trampoline_addr(SB), RODATA, $8 +DATA ·libc_open_trampoline_addr(SB)/8, $libc_open_trampoline<>(SB) + +TEXT libc_openat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_openat(SB) +GLOBL ·libc_openat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_openat_trampoline_addr(SB)/8, $libc_openat_trampoline<>(SB) + +TEXT libc_pathconf_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pathconf(SB) +GLOBL ·libc_pathconf_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pathconf_trampoline_addr(SB)/8, $libc_pathconf_trampoline<>(SB) + +TEXT libc_pread_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pread(SB) +GLOBL ·libc_pread_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pread_trampoline_addr(SB)/8, $libc_pread_trampoline<>(SB) + +TEXT libc_pwrite_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pwrite(SB) +GLOBL ·libc_pwrite_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pwrite_trampoline_addr(SB)/8, $libc_pwrite_trampoline<>(SB) + +TEXT libc_read_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_read(SB) +GLOBL ·libc_read_trampoline_addr(SB), RODATA, $8 +DATA ·libc_read_trampoline_addr(SB)/8, $libc_read_trampoline<>(SB) + +TEXT libc_readlink_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_readlink(SB) +GLOBL ·libc_readlink_trampoline_addr(SB), RODATA, $8 +DATA ·libc_readlink_trampoline_addr(SB)/8, $libc_readlink_trampoline<>(SB) + +TEXT libc_readlinkat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_readlinkat(SB) +GLOBL ·libc_readlinkat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_readlinkat_trampoline_addr(SB)/8, $libc_readlinkat_trampoline<>(SB) + +TEXT libc_rename_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_rename(SB) +GLOBL ·libc_rename_trampoline_addr(SB), RODATA, $8 +DATA ·libc_rename_trampoline_addr(SB)/8, $libc_rename_trampoline<>(SB) + +TEXT libc_renameat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_renameat(SB) +GLOBL ·libc_renameat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_renameat_trampoline_addr(SB)/8, $libc_renameat_trampoline<>(SB) + +TEXT libc_revoke_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_revoke(SB) +GLOBL ·libc_revoke_trampoline_addr(SB), RODATA, $8 +DATA ·libc_revoke_trampoline_addr(SB)/8, $libc_revoke_trampoline<>(SB) + +TEXT libc_rmdir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_rmdir(SB) +GLOBL ·libc_rmdir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_rmdir_trampoline_addr(SB)/8, $libc_rmdir_trampoline<>(SB) + +TEXT libc_lseek_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_lseek(SB) +GLOBL ·libc_lseek_trampoline_addr(SB), RODATA, $8 +DATA ·libc_lseek_trampoline_addr(SB)/8, $libc_lseek_trampoline<>(SB) + +TEXT libc_select_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_select(SB) +GLOBL ·libc_select_trampoline_addr(SB), RODATA, $8 +DATA ·libc_select_trampoline_addr(SB)/8, $libc_select_trampoline<>(SB) + +TEXT libc_setegid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setegid(SB) +GLOBL ·libc_setegid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setegid_trampoline_addr(SB)/8, $libc_setegid_trampoline<>(SB) + +TEXT libc_seteuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_seteuid(SB) +GLOBL ·libc_seteuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_seteuid_trampoline_addr(SB)/8, $libc_seteuid_trampoline<>(SB) + +TEXT libc_setgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setgid(SB) +GLOBL ·libc_setgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setgid_trampoline_addr(SB)/8, $libc_setgid_trampoline<>(SB) + +TEXT libc_setlogin_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setlogin(SB) +GLOBL ·libc_setlogin_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setlogin_trampoline_addr(SB)/8, $libc_setlogin_trampoline<>(SB) + +TEXT libc_setpgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setpgid(SB) +GLOBL ·libc_setpgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setpgid_trampoline_addr(SB)/8, $libc_setpgid_trampoline<>(SB) + +TEXT libc_setpriority_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setpriority(SB) +GLOBL ·libc_setpriority_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setpriority_trampoline_addr(SB)/8, $libc_setpriority_trampoline<>(SB) + +TEXT libc_setregid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setregid(SB) +GLOBL ·libc_setregid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setregid_trampoline_addr(SB)/8, $libc_setregid_trampoline<>(SB) + +TEXT libc_setreuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setreuid(SB) +GLOBL ·libc_setreuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setreuid_trampoline_addr(SB)/8, $libc_setreuid_trampoline<>(SB) + +TEXT libc_setresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setresgid(SB) +GLOBL ·libc_setresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setresgid_trampoline_addr(SB)/8, $libc_setresgid_trampoline<>(SB) + +TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setresuid(SB) +GLOBL ·libc_setresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setresuid_trampoline_addr(SB)/8, $libc_setresuid_trampoline<>(SB) + +TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setrtable(SB) +GLOBL ·libc_setrtable_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setrtable_trampoline_addr(SB)/8, $libc_setrtable_trampoline<>(SB) + +TEXT libc_setsid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setsid(SB) +GLOBL ·libc_setsid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setsid_trampoline_addr(SB)/8, $libc_setsid_trampoline<>(SB) + +TEXT libc_settimeofday_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_settimeofday(SB) +GLOBL ·libc_settimeofday_trampoline_addr(SB), RODATA, $8 +DATA ·libc_settimeofday_trampoline_addr(SB)/8, $libc_settimeofday_trampoline<>(SB) + +TEXT libc_setuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setuid(SB) +GLOBL ·libc_setuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setuid_trampoline_addr(SB)/8, $libc_setuid_trampoline<>(SB) + +TEXT libc_stat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_stat(SB) +GLOBL ·libc_stat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_stat_trampoline_addr(SB)/8, $libc_stat_trampoline<>(SB) + +TEXT libc_statfs_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_statfs(SB) +GLOBL ·libc_statfs_trampoline_addr(SB), RODATA, $8 +DATA ·libc_statfs_trampoline_addr(SB)/8, $libc_statfs_trampoline<>(SB) + +TEXT libc_symlink_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_symlink(SB) +GLOBL ·libc_symlink_trampoline_addr(SB), RODATA, $8 +DATA ·libc_symlink_trampoline_addr(SB)/8, $libc_symlink_trampoline<>(SB) + +TEXT libc_symlinkat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_symlinkat(SB) +GLOBL ·libc_symlinkat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_symlinkat_trampoline_addr(SB)/8, $libc_symlinkat_trampoline<>(SB) + +TEXT libc_sync_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sync(SB) +GLOBL ·libc_sync_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sync_trampoline_addr(SB)/8, $libc_sync_trampoline<>(SB) + +TEXT libc_truncate_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_truncate(SB) +GLOBL ·libc_truncate_trampoline_addr(SB), RODATA, $8 +DATA ·libc_truncate_trampoline_addr(SB)/8, $libc_truncate_trampoline<>(SB) + +TEXT libc_umask_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_umask(SB) +GLOBL ·libc_umask_trampoline_addr(SB), RODATA, $8 +DATA ·libc_umask_trampoline_addr(SB)/8, $libc_umask_trampoline<>(SB) + +TEXT libc_unlink_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unlink(SB) +GLOBL ·libc_unlink_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unlink_trampoline_addr(SB)/8, $libc_unlink_trampoline<>(SB) + +TEXT libc_unlinkat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unlinkat(SB) +GLOBL ·libc_unlinkat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unlinkat_trampoline_addr(SB)/8, $libc_unlinkat_trampoline<>(SB) + +TEXT libc_unmount_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unmount(SB) +GLOBL ·libc_unmount_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unmount_trampoline_addr(SB)/8, $libc_unmount_trampoline<>(SB) + +TEXT libc_write_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_write(SB) +GLOBL ·libc_write_trampoline_addr(SB), RODATA, $8 +DATA ·libc_write_trampoline_addr(SB)/8, $libc_write_trampoline<>(SB) + +TEXT libc_mmap_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mmap(SB) +GLOBL ·libc_mmap_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mmap_trampoline_addr(SB)/8, $libc_mmap_trampoline<>(SB) + +TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_munmap(SB) +GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 +DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) + +TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_utimensat(SB) +GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go index fdf53f8..609d1c5 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go @@ -38,6 +38,7 @@ import ( //go:cgo_import_dynamic libc_chmod chmod "libc.so" //go:cgo_import_dynamic libc_chown chown "libc.so" //go:cgo_import_dynamic libc_chroot chroot "libc.so" +//go:cgo_import_dynamic libc_clockgettime clockgettime "libc.so" //go:cgo_import_dynamic libc_close close "libc.so" //go:cgo_import_dynamic libc_creat creat "libc.so" //go:cgo_import_dynamic libc_dup dup "libc.so" @@ -109,7 +110,6 @@ import ( //go:cgo_import_dynamic libc_setpriority setpriority "libc.so" //go:cgo_import_dynamic libc_setregid setregid "libc.so" //go:cgo_import_dynamic libc_setreuid setreuid "libc.so" -//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so" //go:cgo_import_dynamic libc_setsid setsid "libc.so" //go:cgo_import_dynamic libc_setuid setuid "libc.so" //go:cgo_import_dynamic libc_shutdown shutdown "libsocket.so" @@ -147,6 +147,8 @@ import ( //go:cgo_import_dynamic libc_port_dissociate port_dissociate "libc.so" //go:cgo_import_dynamic libc_port_get port_get "libc.so" //go:cgo_import_dynamic libc_port_getn port_getn "libc.so" +//go:cgo_import_dynamic libc_putmsg putmsg "libc.so" +//go:cgo_import_dynamic libc_getmsg getmsg "libc.so" //go:linkname procpipe libc_pipe //go:linkname procpipe2 libc_pipe2 @@ -175,6 +177,7 @@ import ( //go:linkname procChmod libc_chmod //go:linkname procChown libc_chown //go:linkname procChroot libc_chroot +//go:linkname procClockGettime libc_clockgettime //go:linkname procClose libc_close //go:linkname procCreat libc_creat //go:linkname procDup libc_dup @@ -246,7 +249,6 @@ import ( //go:linkname procSetpriority libc_setpriority //go:linkname procSetregid libc_setregid //go:linkname procSetreuid libc_setreuid -//go:linkname procSetrlimit libc_setrlimit //go:linkname procSetsid libc_setsid //go:linkname procSetuid libc_setuid //go:linkname procshutdown libc_shutdown @@ -284,6 +286,8 @@ import ( //go:linkname procport_dissociate libc_port_dissociate //go:linkname procport_get libc_port_get //go:linkname procport_getn libc_port_getn +//go:linkname procputmsg libc_putmsg +//go:linkname procgetmsg libc_getmsg var ( procpipe, @@ -313,6 +317,7 @@ var ( procChmod, procChown, procChroot, + procClockGettime, procClose, procCreat, procDup, @@ -384,7 +389,6 @@ var ( procSetpriority, procSetregid, procSetreuid, - procSetrlimit, procSetsid, procSetuid, procshutdown, @@ -421,7 +425,9 @@ var ( procport_associate, procport_dissociate, procport_get, - procport_getn syscallFunc + procport_getn, + procputmsg, + procgetmsg syscallFunc ) // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -637,7 +643,18 @@ func __minor(version int, dev uint64) (val uint) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func ioctlRet(fd int, req uint, arg uintptr) (ret int, err error) { +func ioctlRet(fd int, req int, arg uintptr) (ret int, err error) { + r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procioctl)), 3, uintptr(fd), uintptr(req), uintptr(arg), 0, 0, 0) + ret = int(r0) + if e1 != 0 { + err = e1 + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ioctlPtrRet(fd int, req int, arg unsafe.Pointer) (ret int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procioctl)), 3, uintptr(fd), uintptr(req), uintptr(arg), 0, 0, 0) ret = int(r0) if e1 != 0 { @@ -744,6 +761,16 @@ func Chroot(path string) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ClockGettime(clockid int32, time *Timespec) (err error) { + _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procClockGettime)), 2, uintptr(clockid), uintptr(unsafe.Pointer(time)), 0, 0, 0, 0) + if e1 != 0 { + err = e1 + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Close(fd int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procClose)), 1, uintptr(fd), 0, 0, 0, 0, 0) if e1 != 0 { @@ -1620,16 +1647,6 @@ func Setreuid(ruid int, euid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetrlimit)), 2, uintptr(which), uintptr(unsafe.Pointer(lim)), 0, 0, 0, 0) - if e1 != 0 { - err = e1 - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetsid)), 0, 0, 0, 0, 0, 0, 0) pid = int(r0) @@ -2065,3 +2082,23 @@ func port_getn(port int, pe *portEvent, max uint32, nget *uint32, timeout *Times } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func putmsg(fd int, clptr *strbuf, dataptr *strbuf, flags int) (err error) { + _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procputmsg)), 4, uintptr(fd), uintptr(unsafe.Pointer(clptr)), uintptr(unsafe.Pointer(dataptr)), uintptr(flags), 0, 0) + if e1 != 0 { + err = e1 + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getmsg(fd int, clptr *strbuf, dataptr *strbuf, flags *int) (err error) { + _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procgetmsg)), 4, uintptr(fd), uintptr(unsafe.Pointer(clptr)), uintptr(unsafe.Pointer(dataptr)), uintptr(unsafe.Pointer(flags)), 0, 0) + if e1 != 0 { + err = e1 + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go b/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go index f207945..c316817 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go @@ -257,7 +257,17 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func ioctl(fd int, req uint, arg uintptr) (err error) { +func ioctl(fd int, req int, arg uintptr) (err error) { + _, _, e1 := syscall_syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { err = errnoErr(e1) diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_386.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_386.go index 9e9d0b2..55e0484 100644 --- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_386.go @@ -17,6 +17,7 @@ var sysctlMib = []mibentry{ {"ddb.max_line", []_C_int{9, 3}}, {"ddb.max_width", []_C_int{9, 2}}, {"ddb.panic", []_C_int{9, 5}}, + {"ddb.profile", []_C_int{9, 9}}, {"ddb.radix", []_C_int{9, 1}}, {"ddb.tab_stop_width", []_C_int{9, 4}}, {"ddb.trigger", []_C_int{9, 8}}, @@ -33,29 +34,37 @@ var sysctlMib = []mibentry{ {"hw.ncpufound", []_C_int{6, 21}}, {"hw.ncpuonline", []_C_int{6, 25}}, {"hw.pagesize", []_C_int{6, 7}}, + {"hw.perfpolicy", []_C_int{6, 23}}, {"hw.physmem", []_C_int{6, 19}}, + {"hw.power", []_C_int{6, 26}}, {"hw.product", []_C_int{6, 15}}, {"hw.serialno", []_C_int{6, 17}}, {"hw.setperf", []_C_int{6, 13}}, + {"hw.smt", []_C_int{6, 24}}, {"hw.usermem", []_C_int{6, 20}}, {"hw.uuid", []_C_int{6, 18}}, {"hw.vendor", []_C_int{6, 14}}, {"hw.version", []_C_int{6, 16}}, - {"kern.arandom", []_C_int{1, 37}}, + {"kern.allowdt", []_C_int{1, 65}}, + {"kern.allowkmem", []_C_int{1, 52}}, {"kern.argmax", []_C_int{1, 8}}, + {"kern.audio", []_C_int{1, 84}}, {"kern.boottime", []_C_int{1, 21}}, {"kern.bufcachepercent", []_C_int{1, 72}}, {"kern.ccpu", []_C_int{1, 45}}, {"kern.clockrate", []_C_int{1, 12}}, + {"kern.consbuf", []_C_int{1, 83}}, + {"kern.consbufsize", []_C_int{1, 82}}, {"kern.consdev", []_C_int{1, 75}}, {"kern.cp_time", []_C_int{1, 40}}, {"kern.cp_time2", []_C_int{1, 71}}, - {"kern.cryptodevallowsoft", []_C_int{1, 53}}, + {"kern.cpustats", []_C_int{1, 85}}, {"kern.domainname", []_C_int{1, 22}}, {"kern.file", []_C_int{1, 73}}, {"kern.forkstat", []_C_int{1, 42}}, {"kern.fscale", []_C_int{1, 46}}, {"kern.fsync", []_C_int{1, 33}}, + {"kern.global_ptrace", []_C_int{1, 81}}, {"kern.hostid", []_C_int{1, 11}}, {"kern.hostname", []_C_int{1, 10}}, {"kern.intrcnt.nintrcnt", []_C_int{1, 63, 1}}, @@ -78,17 +87,16 @@ var sysctlMib = []mibentry{ {"kern.ngroups", []_C_int{1, 18}}, {"kern.nosuidcoredump", []_C_int{1, 32}}, {"kern.nprocs", []_C_int{1, 47}}, - {"kern.nselcoll", []_C_int{1, 43}}, {"kern.nthreads", []_C_int{1, 26}}, {"kern.numvnodes", []_C_int{1, 58}}, {"kern.osrelease", []_C_int{1, 2}}, {"kern.osrevision", []_C_int{1, 3}}, {"kern.ostype", []_C_int{1, 1}}, {"kern.osversion", []_C_int{1, 27}}, + {"kern.pfstatus", []_C_int{1, 86}}, {"kern.pool_debug", []_C_int{1, 77}}, {"kern.posix1version", []_C_int{1, 17}}, {"kern.proc", []_C_int{1, 66}}, - {"kern.random", []_C_int{1, 31}}, {"kern.rawpartition", []_C_int{1, 24}}, {"kern.saved_ids", []_C_int{1, 20}}, {"kern.securelevel", []_C_int{1, 9}}, @@ -106,21 +114,20 @@ var sysctlMib = []mibentry{ {"kern.timecounter.hardware", []_C_int{1, 69, 3}}, {"kern.timecounter.tick", []_C_int{1, 69, 1}}, {"kern.timecounter.timestepwarnings", []_C_int{1, 69, 2}}, - {"kern.tty.maxptys", []_C_int{1, 44, 6}}, - {"kern.tty.nptys", []_C_int{1, 44, 7}}, + {"kern.timeout_stats", []_C_int{1, 87}}, {"kern.tty.tk_cancc", []_C_int{1, 44, 4}}, {"kern.tty.tk_nin", []_C_int{1, 44, 1}}, {"kern.tty.tk_nout", []_C_int{1, 44, 2}}, {"kern.tty.tk_rawcc", []_C_int{1, 44, 3}}, {"kern.tty.ttyinfo", []_C_int{1, 44, 5}}, {"kern.ttycount", []_C_int{1, 57}}, - {"kern.userasymcrypto", []_C_int{1, 60}}, - {"kern.usercrypto", []_C_int{1, 52}}, - {"kern.usermount", []_C_int{1, 30}}, + {"kern.utc_offset", []_C_int{1, 88}}, {"kern.version", []_C_int{1, 4}}, - {"kern.vnode", []_C_int{1, 13}}, + {"kern.video", []_C_int{1, 89}}, {"kern.watchdog.auto", []_C_int{1, 64, 2}}, {"kern.watchdog.period", []_C_int{1, 64, 1}}, + {"kern.witnesswatch", []_C_int{1, 53}}, + {"kern.wxabort", []_C_int{1, 74}}, {"net.bpf.bufsize", []_C_int{4, 31, 1}}, {"net.bpf.maxbufsize", []_C_int{4, 31, 2}}, {"net.inet.ah.enable", []_C_int{4, 2, 51, 1}}, @@ -148,7 +155,9 @@ var sysctlMib = []mibentry{ {"net.inet.icmp.stats", []_C_int{4, 2, 1, 7}}, {"net.inet.icmp.tstamprepl", []_C_int{4, 2, 1, 6}}, {"net.inet.igmp.stats", []_C_int{4, 2, 2, 1}}, + {"net.inet.ip.arpdown", []_C_int{4, 2, 0, 40}}, {"net.inet.ip.arpqueued", []_C_int{4, 2, 0, 36}}, + {"net.inet.ip.arptimeout", []_C_int{4, 2, 0, 39}}, {"net.inet.ip.encdebug", []_C_int{4, 2, 0, 12}}, {"net.inet.ip.forwarding", []_C_int{4, 2, 0, 1}}, {"net.inet.ip.ifq.congestion", []_C_int{4, 2, 0, 30, 4}}, @@ -157,8 +166,10 @@ var sysctlMib = []mibentry{ {"net.inet.ip.ifq.maxlen", []_C_int{4, 2, 0, 30, 2}}, {"net.inet.ip.maxqueue", []_C_int{4, 2, 0, 11}}, {"net.inet.ip.mforwarding", []_C_int{4, 2, 0, 31}}, + {"net.inet.ip.mrtmfc", []_C_int{4, 2, 0, 37}}, {"net.inet.ip.mrtproto", []_C_int{4, 2, 0, 34}}, {"net.inet.ip.mrtstats", []_C_int{4, 2, 0, 35}}, + {"net.inet.ip.mrtvif", []_C_int{4, 2, 0, 38}}, {"net.inet.ip.mtu", []_C_int{4, 2, 0, 4}}, {"net.inet.ip.mtudisc", []_C_int{4, 2, 0, 27}}, {"net.inet.ip.mtudisctimeout", []_C_int{4, 2, 0, 28}}, @@ -175,9 +186,7 @@ var sysctlMib = []mibentry{ {"net.inet.ipcomp.stats", []_C_int{4, 2, 108, 2}}, {"net.inet.ipip.allow", []_C_int{4, 2, 4, 1}}, {"net.inet.ipip.stats", []_C_int{4, 2, 4, 2}}, - {"net.inet.mobileip.allow", []_C_int{4, 2, 55, 1}}, {"net.inet.pfsync.stats", []_C_int{4, 2, 240, 1}}, - {"net.inet.pim.stats", []_C_int{4, 2, 103, 1}}, {"net.inet.tcp.ackonpush", []_C_int{4, 2, 6, 13}}, {"net.inet.tcp.always_keepalive", []_C_int{4, 2, 6, 22}}, {"net.inet.tcp.baddynamic", []_C_int{4, 2, 6, 6}}, @@ -191,6 +200,7 @@ var sysctlMib = []mibentry{ {"net.inet.tcp.reasslimit", []_C_int{4, 2, 6, 18}}, {"net.inet.tcp.rfc1323", []_C_int{4, 2, 6, 1}}, {"net.inet.tcp.rfc3390", []_C_int{4, 2, 6, 17}}, + {"net.inet.tcp.rootonly", []_C_int{4, 2, 6, 24}}, {"net.inet.tcp.rstppslimit", []_C_int{4, 2, 6, 12}}, {"net.inet.tcp.sack", []_C_int{4, 2, 6, 10}}, {"net.inet.tcp.sackholelimit", []_C_int{4, 2, 6, 20}}, @@ -198,9 +208,12 @@ var sysctlMib = []mibentry{ {"net.inet.tcp.stats", []_C_int{4, 2, 6, 21}}, {"net.inet.tcp.synbucketlimit", []_C_int{4, 2, 6, 16}}, {"net.inet.tcp.syncachelimit", []_C_int{4, 2, 6, 15}}, + {"net.inet.tcp.synhashsize", []_C_int{4, 2, 6, 25}}, + {"net.inet.tcp.synuselimit", []_C_int{4, 2, 6, 23}}, {"net.inet.udp.baddynamic", []_C_int{4, 2, 17, 2}}, {"net.inet.udp.checksum", []_C_int{4, 2, 17, 1}}, {"net.inet.udp.recvspace", []_C_int{4, 2, 17, 3}}, + {"net.inet.udp.rootonly", []_C_int{4, 2, 17, 6}}, {"net.inet.udp.sendspace", []_C_int{4, 2, 17, 4}}, {"net.inet.udp.stats", []_C_int{4, 2, 17, 5}}, {"net.inet6.divert.recvspace", []_C_int{4, 24, 86, 1}}, @@ -213,13 +226,8 @@ var sysctlMib = []mibentry{ {"net.inet6.icmp6.nd6_delay", []_C_int{4, 24, 30, 8}}, {"net.inet6.icmp6.nd6_maxnudhint", []_C_int{4, 24, 30, 15}}, {"net.inet6.icmp6.nd6_mmaxtries", []_C_int{4, 24, 30, 10}}, - {"net.inet6.icmp6.nd6_prune", []_C_int{4, 24, 30, 6}}, {"net.inet6.icmp6.nd6_umaxtries", []_C_int{4, 24, 30, 9}}, - {"net.inet6.icmp6.nd6_useloopback", []_C_int{4, 24, 30, 11}}, - {"net.inet6.icmp6.nodeinfo", []_C_int{4, 24, 30, 13}}, - {"net.inet6.icmp6.rediraccept", []_C_int{4, 24, 30, 2}}, {"net.inet6.icmp6.redirtimeout", []_C_int{4, 24, 30, 3}}, - {"net.inet6.ip6.accept_rtadv", []_C_int{4, 24, 17, 12}}, {"net.inet6.ip6.auto_flowlabel", []_C_int{4, 24, 17, 17}}, {"net.inet6.ip6.dad_count", []_C_int{4, 24, 17, 16}}, {"net.inet6.ip6.dad_pending", []_C_int{4, 24, 17, 49}}, @@ -232,20 +240,19 @@ var sysctlMib = []mibentry{ {"net.inet6.ip6.maxdynroutes", []_C_int{4, 24, 17, 48}}, {"net.inet6.ip6.maxfragpackets", []_C_int{4, 24, 17, 9}}, {"net.inet6.ip6.maxfrags", []_C_int{4, 24, 17, 41}}, - {"net.inet6.ip6.maxifdefrouters", []_C_int{4, 24, 17, 47}}, - {"net.inet6.ip6.maxifprefixes", []_C_int{4, 24, 17, 46}}, {"net.inet6.ip6.mforwarding", []_C_int{4, 24, 17, 42}}, + {"net.inet6.ip6.mrtmfc", []_C_int{4, 24, 17, 53}}, + {"net.inet6.ip6.mrtmif", []_C_int{4, 24, 17, 52}}, {"net.inet6.ip6.mrtproto", []_C_int{4, 24, 17, 8}}, {"net.inet6.ip6.mtudisctimeout", []_C_int{4, 24, 17, 50}}, {"net.inet6.ip6.multicast_mtudisc", []_C_int{4, 24, 17, 44}}, {"net.inet6.ip6.multipath", []_C_int{4, 24, 17, 43}}, {"net.inet6.ip6.neighborgcthresh", []_C_int{4, 24, 17, 45}}, {"net.inet6.ip6.redirect", []_C_int{4, 24, 17, 2}}, - {"net.inet6.ip6.rr_prune", []_C_int{4, 24, 17, 22}}, + {"net.inet6.ip6.soiikey", []_C_int{4, 24, 17, 54}}, {"net.inet6.ip6.sourcecheck", []_C_int{4, 24, 17, 10}}, {"net.inet6.ip6.sourcecheck_logint", []_C_int{4, 24, 17, 11}}, {"net.inet6.ip6.use_deprecated", []_C_int{4, 24, 17, 21}}, - {"net.inet6.ip6.v6only", []_C_int{4, 24, 17, 24}}, {"net.key.sadb_dump", []_C_int{4, 30, 1}}, {"net.key.spd_dump", []_C_int{4, 30, 2}}, {"net.mpls.ifq.congestion", []_C_int{4, 33, 3, 4}}, @@ -254,12 +261,12 @@ var sysctlMib = []mibentry{ {"net.mpls.ifq.maxlen", []_C_int{4, 33, 3, 2}}, {"net.mpls.mapttl_ip", []_C_int{4, 33, 5}}, {"net.mpls.mapttl_ip6", []_C_int{4, 33, 6}}, - {"net.mpls.maxloop_inkernel", []_C_int{4, 33, 4}}, {"net.mpls.ttl", []_C_int{4, 33, 2}}, {"net.pflow.stats", []_C_int{4, 34, 1}}, {"net.pipex.enable", []_C_int{4, 35, 1}}, {"vm.anonmin", []_C_int{2, 7}}, {"vm.loadavg", []_C_int{2, 2}}, + {"vm.malloc_conf", []_C_int{2, 12}}, {"vm.maxslp", []_C_int{2, 10}}, {"vm.nkmempages", []_C_int{2, 6}}, {"vm.psstrings", []_C_int{2, 3}}, diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_amd64.go index adecd09..d2243cf 100644 --- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_amd64.go @@ -36,23 +36,29 @@ var sysctlMib = []mibentry{ {"hw.pagesize", []_C_int{6, 7}}, {"hw.perfpolicy", []_C_int{6, 23}}, {"hw.physmem", []_C_int{6, 19}}, + {"hw.power", []_C_int{6, 26}}, {"hw.product", []_C_int{6, 15}}, {"hw.serialno", []_C_int{6, 17}}, {"hw.setperf", []_C_int{6, 13}}, + {"hw.smt", []_C_int{6, 24}}, {"hw.usermem", []_C_int{6, 20}}, {"hw.uuid", []_C_int{6, 18}}, {"hw.vendor", []_C_int{6, 14}}, {"hw.version", []_C_int{6, 16}}, + {"kern.allowdt", []_C_int{1, 65}}, {"kern.allowkmem", []_C_int{1, 52}}, {"kern.argmax", []_C_int{1, 8}}, + {"kern.audio", []_C_int{1, 84}}, {"kern.boottime", []_C_int{1, 21}}, {"kern.bufcachepercent", []_C_int{1, 72}}, {"kern.ccpu", []_C_int{1, 45}}, {"kern.clockrate", []_C_int{1, 12}}, + {"kern.consbuf", []_C_int{1, 83}}, + {"kern.consbufsize", []_C_int{1, 82}}, {"kern.consdev", []_C_int{1, 75}}, {"kern.cp_time", []_C_int{1, 40}}, {"kern.cp_time2", []_C_int{1, 71}}, - {"kern.dnsjackport", []_C_int{1, 13}}, + {"kern.cpustats", []_C_int{1, 85}}, {"kern.domainname", []_C_int{1, 22}}, {"kern.file", []_C_int{1, 73}}, {"kern.forkstat", []_C_int{1, 42}}, @@ -81,13 +87,13 @@ var sysctlMib = []mibentry{ {"kern.ngroups", []_C_int{1, 18}}, {"kern.nosuidcoredump", []_C_int{1, 32}}, {"kern.nprocs", []_C_int{1, 47}}, - {"kern.nselcoll", []_C_int{1, 43}}, {"kern.nthreads", []_C_int{1, 26}}, {"kern.numvnodes", []_C_int{1, 58}}, {"kern.osrelease", []_C_int{1, 2}}, {"kern.osrevision", []_C_int{1, 3}}, {"kern.ostype", []_C_int{1, 1}}, {"kern.osversion", []_C_int{1, 27}}, + {"kern.pfstatus", []_C_int{1, 86}}, {"kern.pool_debug", []_C_int{1, 77}}, {"kern.posix1version", []_C_int{1, 17}}, {"kern.proc", []_C_int{1, 66}}, @@ -108,15 +114,19 @@ var sysctlMib = []mibentry{ {"kern.timecounter.hardware", []_C_int{1, 69, 3}}, {"kern.timecounter.tick", []_C_int{1, 69, 1}}, {"kern.timecounter.timestepwarnings", []_C_int{1, 69, 2}}, + {"kern.timeout_stats", []_C_int{1, 87}}, {"kern.tty.tk_cancc", []_C_int{1, 44, 4}}, {"kern.tty.tk_nin", []_C_int{1, 44, 1}}, {"kern.tty.tk_nout", []_C_int{1, 44, 2}}, {"kern.tty.tk_rawcc", []_C_int{1, 44, 3}}, {"kern.tty.ttyinfo", []_C_int{1, 44, 5}}, {"kern.ttycount", []_C_int{1, 57}}, + {"kern.utc_offset", []_C_int{1, 88}}, {"kern.version", []_C_int{1, 4}}, + {"kern.video", []_C_int{1, 89}}, {"kern.watchdog.auto", []_C_int{1, 64, 2}}, {"kern.watchdog.period", []_C_int{1, 64, 1}}, + {"kern.witnesswatch", []_C_int{1, 53}}, {"kern.wxabort", []_C_int{1, 74}}, {"net.bpf.bufsize", []_C_int{4, 31, 1}}, {"net.bpf.maxbufsize", []_C_int{4, 31, 2}}, @@ -176,7 +186,6 @@ var sysctlMib = []mibentry{ {"net.inet.ipcomp.stats", []_C_int{4, 2, 108, 2}}, {"net.inet.ipip.allow", []_C_int{4, 2, 4, 1}}, {"net.inet.ipip.stats", []_C_int{4, 2, 4, 2}}, - {"net.inet.mobileip.allow", []_C_int{4, 2, 55, 1}}, {"net.inet.pfsync.stats", []_C_int{4, 2, 240, 1}}, {"net.inet.tcp.ackonpush", []_C_int{4, 2, 6, 13}}, {"net.inet.tcp.always_keepalive", []_C_int{4, 2, 6, 22}}, @@ -252,12 +261,12 @@ var sysctlMib = []mibentry{ {"net.mpls.ifq.maxlen", []_C_int{4, 33, 3, 2}}, {"net.mpls.mapttl_ip", []_C_int{4, 33, 5}}, {"net.mpls.mapttl_ip6", []_C_int{4, 33, 6}}, - {"net.mpls.maxloop_inkernel", []_C_int{4, 33, 4}}, {"net.mpls.ttl", []_C_int{4, 33, 2}}, {"net.pflow.stats", []_C_int{4, 34, 1}}, {"net.pipex.enable", []_C_int{4, 35, 1}}, {"vm.anonmin", []_C_int{2, 7}}, {"vm.loadavg", []_C_int{2, 2}}, + {"vm.malloc_conf", []_C_int{2, 12}}, {"vm.maxslp", []_C_int{2, 10}}, {"vm.nkmempages", []_C_int{2, 6}}, {"vm.psstrings", []_C_int{2, 3}}, diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm.go index 8ea52a4..82dc51b 100644 --- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm.go @@ -17,6 +17,7 @@ var sysctlMib = []mibentry{ {"ddb.max_line", []_C_int{9, 3}}, {"ddb.max_width", []_C_int{9, 2}}, {"ddb.panic", []_C_int{9, 5}}, + {"ddb.profile", []_C_int{9, 9}}, {"ddb.radix", []_C_int{9, 1}}, {"ddb.tab_stop_width", []_C_int{9, 4}}, {"ddb.trigger", []_C_int{9, 8}}, @@ -33,29 +34,37 @@ var sysctlMib = []mibentry{ {"hw.ncpufound", []_C_int{6, 21}}, {"hw.ncpuonline", []_C_int{6, 25}}, {"hw.pagesize", []_C_int{6, 7}}, + {"hw.perfpolicy", []_C_int{6, 23}}, {"hw.physmem", []_C_int{6, 19}}, + {"hw.power", []_C_int{6, 26}}, {"hw.product", []_C_int{6, 15}}, {"hw.serialno", []_C_int{6, 17}}, {"hw.setperf", []_C_int{6, 13}}, + {"hw.smt", []_C_int{6, 24}}, {"hw.usermem", []_C_int{6, 20}}, {"hw.uuid", []_C_int{6, 18}}, {"hw.vendor", []_C_int{6, 14}}, {"hw.version", []_C_int{6, 16}}, - {"kern.arandom", []_C_int{1, 37}}, + {"kern.allowdt", []_C_int{1, 65}}, + {"kern.allowkmem", []_C_int{1, 52}}, {"kern.argmax", []_C_int{1, 8}}, + {"kern.audio", []_C_int{1, 84}}, {"kern.boottime", []_C_int{1, 21}}, {"kern.bufcachepercent", []_C_int{1, 72}}, {"kern.ccpu", []_C_int{1, 45}}, {"kern.clockrate", []_C_int{1, 12}}, + {"kern.consbuf", []_C_int{1, 83}}, + {"kern.consbufsize", []_C_int{1, 82}}, {"kern.consdev", []_C_int{1, 75}}, {"kern.cp_time", []_C_int{1, 40}}, {"kern.cp_time2", []_C_int{1, 71}}, - {"kern.cryptodevallowsoft", []_C_int{1, 53}}, + {"kern.cpustats", []_C_int{1, 85}}, {"kern.domainname", []_C_int{1, 22}}, {"kern.file", []_C_int{1, 73}}, {"kern.forkstat", []_C_int{1, 42}}, {"kern.fscale", []_C_int{1, 46}}, {"kern.fsync", []_C_int{1, 33}}, + {"kern.global_ptrace", []_C_int{1, 81}}, {"kern.hostid", []_C_int{1, 11}}, {"kern.hostname", []_C_int{1, 10}}, {"kern.intrcnt.nintrcnt", []_C_int{1, 63, 1}}, @@ -78,17 +87,16 @@ var sysctlMib = []mibentry{ {"kern.ngroups", []_C_int{1, 18}}, {"kern.nosuidcoredump", []_C_int{1, 32}}, {"kern.nprocs", []_C_int{1, 47}}, - {"kern.nselcoll", []_C_int{1, 43}}, {"kern.nthreads", []_C_int{1, 26}}, {"kern.numvnodes", []_C_int{1, 58}}, {"kern.osrelease", []_C_int{1, 2}}, {"kern.osrevision", []_C_int{1, 3}}, {"kern.ostype", []_C_int{1, 1}}, {"kern.osversion", []_C_int{1, 27}}, + {"kern.pfstatus", []_C_int{1, 86}}, {"kern.pool_debug", []_C_int{1, 77}}, {"kern.posix1version", []_C_int{1, 17}}, {"kern.proc", []_C_int{1, 66}}, - {"kern.random", []_C_int{1, 31}}, {"kern.rawpartition", []_C_int{1, 24}}, {"kern.saved_ids", []_C_int{1, 20}}, {"kern.securelevel", []_C_int{1, 9}}, @@ -106,21 +114,20 @@ var sysctlMib = []mibentry{ {"kern.timecounter.hardware", []_C_int{1, 69, 3}}, {"kern.timecounter.tick", []_C_int{1, 69, 1}}, {"kern.timecounter.timestepwarnings", []_C_int{1, 69, 2}}, - {"kern.tty.maxptys", []_C_int{1, 44, 6}}, - {"kern.tty.nptys", []_C_int{1, 44, 7}}, + {"kern.timeout_stats", []_C_int{1, 87}}, {"kern.tty.tk_cancc", []_C_int{1, 44, 4}}, {"kern.tty.tk_nin", []_C_int{1, 44, 1}}, {"kern.tty.tk_nout", []_C_int{1, 44, 2}}, {"kern.tty.tk_rawcc", []_C_int{1, 44, 3}}, {"kern.tty.ttyinfo", []_C_int{1, 44, 5}}, {"kern.ttycount", []_C_int{1, 57}}, - {"kern.userasymcrypto", []_C_int{1, 60}}, - {"kern.usercrypto", []_C_int{1, 52}}, - {"kern.usermount", []_C_int{1, 30}}, + {"kern.utc_offset", []_C_int{1, 88}}, {"kern.version", []_C_int{1, 4}}, - {"kern.vnode", []_C_int{1, 13}}, + {"kern.video", []_C_int{1, 89}}, {"kern.watchdog.auto", []_C_int{1, 64, 2}}, {"kern.watchdog.period", []_C_int{1, 64, 1}}, + {"kern.witnesswatch", []_C_int{1, 53}}, + {"kern.wxabort", []_C_int{1, 74}}, {"net.bpf.bufsize", []_C_int{4, 31, 1}}, {"net.bpf.maxbufsize", []_C_int{4, 31, 2}}, {"net.inet.ah.enable", []_C_int{4, 2, 51, 1}}, @@ -148,7 +155,9 @@ var sysctlMib = []mibentry{ {"net.inet.icmp.stats", []_C_int{4, 2, 1, 7}}, {"net.inet.icmp.tstamprepl", []_C_int{4, 2, 1, 6}}, {"net.inet.igmp.stats", []_C_int{4, 2, 2, 1}}, + {"net.inet.ip.arpdown", []_C_int{4, 2, 0, 40}}, {"net.inet.ip.arpqueued", []_C_int{4, 2, 0, 36}}, + {"net.inet.ip.arptimeout", []_C_int{4, 2, 0, 39}}, {"net.inet.ip.encdebug", []_C_int{4, 2, 0, 12}}, {"net.inet.ip.forwarding", []_C_int{4, 2, 0, 1}}, {"net.inet.ip.ifq.congestion", []_C_int{4, 2, 0, 30, 4}}, @@ -157,8 +166,10 @@ var sysctlMib = []mibentry{ {"net.inet.ip.ifq.maxlen", []_C_int{4, 2, 0, 30, 2}}, {"net.inet.ip.maxqueue", []_C_int{4, 2, 0, 11}}, {"net.inet.ip.mforwarding", []_C_int{4, 2, 0, 31}}, + {"net.inet.ip.mrtmfc", []_C_int{4, 2, 0, 37}}, {"net.inet.ip.mrtproto", []_C_int{4, 2, 0, 34}}, {"net.inet.ip.mrtstats", []_C_int{4, 2, 0, 35}}, + {"net.inet.ip.mrtvif", []_C_int{4, 2, 0, 38}}, {"net.inet.ip.mtu", []_C_int{4, 2, 0, 4}}, {"net.inet.ip.mtudisc", []_C_int{4, 2, 0, 27}}, {"net.inet.ip.mtudisctimeout", []_C_int{4, 2, 0, 28}}, @@ -175,9 +186,7 @@ var sysctlMib = []mibentry{ {"net.inet.ipcomp.stats", []_C_int{4, 2, 108, 2}}, {"net.inet.ipip.allow", []_C_int{4, 2, 4, 1}}, {"net.inet.ipip.stats", []_C_int{4, 2, 4, 2}}, - {"net.inet.mobileip.allow", []_C_int{4, 2, 55, 1}}, {"net.inet.pfsync.stats", []_C_int{4, 2, 240, 1}}, - {"net.inet.pim.stats", []_C_int{4, 2, 103, 1}}, {"net.inet.tcp.ackonpush", []_C_int{4, 2, 6, 13}}, {"net.inet.tcp.always_keepalive", []_C_int{4, 2, 6, 22}}, {"net.inet.tcp.baddynamic", []_C_int{4, 2, 6, 6}}, @@ -191,6 +200,7 @@ var sysctlMib = []mibentry{ {"net.inet.tcp.reasslimit", []_C_int{4, 2, 6, 18}}, {"net.inet.tcp.rfc1323", []_C_int{4, 2, 6, 1}}, {"net.inet.tcp.rfc3390", []_C_int{4, 2, 6, 17}}, + {"net.inet.tcp.rootonly", []_C_int{4, 2, 6, 24}}, {"net.inet.tcp.rstppslimit", []_C_int{4, 2, 6, 12}}, {"net.inet.tcp.sack", []_C_int{4, 2, 6, 10}}, {"net.inet.tcp.sackholelimit", []_C_int{4, 2, 6, 20}}, @@ -198,9 +208,12 @@ var sysctlMib = []mibentry{ {"net.inet.tcp.stats", []_C_int{4, 2, 6, 21}}, {"net.inet.tcp.synbucketlimit", []_C_int{4, 2, 6, 16}}, {"net.inet.tcp.syncachelimit", []_C_int{4, 2, 6, 15}}, + {"net.inet.tcp.synhashsize", []_C_int{4, 2, 6, 25}}, + {"net.inet.tcp.synuselimit", []_C_int{4, 2, 6, 23}}, {"net.inet.udp.baddynamic", []_C_int{4, 2, 17, 2}}, {"net.inet.udp.checksum", []_C_int{4, 2, 17, 1}}, {"net.inet.udp.recvspace", []_C_int{4, 2, 17, 3}}, + {"net.inet.udp.rootonly", []_C_int{4, 2, 17, 6}}, {"net.inet.udp.sendspace", []_C_int{4, 2, 17, 4}}, {"net.inet.udp.stats", []_C_int{4, 2, 17, 5}}, {"net.inet6.divert.recvspace", []_C_int{4, 24, 86, 1}}, @@ -213,13 +226,8 @@ var sysctlMib = []mibentry{ {"net.inet6.icmp6.nd6_delay", []_C_int{4, 24, 30, 8}}, {"net.inet6.icmp6.nd6_maxnudhint", []_C_int{4, 24, 30, 15}}, {"net.inet6.icmp6.nd6_mmaxtries", []_C_int{4, 24, 30, 10}}, - {"net.inet6.icmp6.nd6_prune", []_C_int{4, 24, 30, 6}}, {"net.inet6.icmp6.nd6_umaxtries", []_C_int{4, 24, 30, 9}}, - {"net.inet6.icmp6.nd6_useloopback", []_C_int{4, 24, 30, 11}}, - {"net.inet6.icmp6.nodeinfo", []_C_int{4, 24, 30, 13}}, - {"net.inet6.icmp6.rediraccept", []_C_int{4, 24, 30, 2}}, {"net.inet6.icmp6.redirtimeout", []_C_int{4, 24, 30, 3}}, - {"net.inet6.ip6.accept_rtadv", []_C_int{4, 24, 17, 12}}, {"net.inet6.ip6.auto_flowlabel", []_C_int{4, 24, 17, 17}}, {"net.inet6.ip6.dad_count", []_C_int{4, 24, 17, 16}}, {"net.inet6.ip6.dad_pending", []_C_int{4, 24, 17, 49}}, @@ -232,20 +240,19 @@ var sysctlMib = []mibentry{ {"net.inet6.ip6.maxdynroutes", []_C_int{4, 24, 17, 48}}, {"net.inet6.ip6.maxfragpackets", []_C_int{4, 24, 17, 9}}, {"net.inet6.ip6.maxfrags", []_C_int{4, 24, 17, 41}}, - {"net.inet6.ip6.maxifdefrouters", []_C_int{4, 24, 17, 47}}, - {"net.inet6.ip6.maxifprefixes", []_C_int{4, 24, 17, 46}}, {"net.inet6.ip6.mforwarding", []_C_int{4, 24, 17, 42}}, + {"net.inet6.ip6.mrtmfc", []_C_int{4, 24, 17, 53}}, + {"net.inet6.ip6.mrtmif", []_C_int{4, 24, 17, 52}}, {"net.inet6.ip6.mrtproto", []_C_int{4, 24, 17, 8}}, {"net.inet6.ip6.mtudisctimeout", []_C_int{4, 24, 17, 50}}, {"net.inet6.ip6.multicast_mtudisc", []_C_int{4, 24, 17, 44}}, {"net.inet6.ip6.multipath", []_C_int{4, 24, 17, 43}}, {"net.inet6.ip6.neighborgcthresh", []_C_int{4, 24, 17, 45}}, {"net.inet6.ip6.redirect", []_C_int{4, 24, 17, 2}}, - {"net.inet6.ip6.rr_prune", []_C_int{4, 24, 17, 22}}, + {"net.inet6.ip6.soiikey", []_C_int{4, 24, 17, 54}}, {"net.inet6.ip6.sourcecheck", []_C_int{4, 24, 17, 10}}, {"net.inet6.ip6.sourcecheck_logint", []_C_int{4, 24, 17, 11}}, {"net.inet6.ip6.use_deprecated", []_C_int{4, 24, 17, 21}}, - {"net.inet6.ip6.v6only", []_C_int{4, 24, 17, 24}}, {"net.key.sadb_dump", []_C_int{4, 30, 1}}, {"net.key.spd_dump", []_C_int{4, 30, 2}}, {"net.mpls.ifq.congestion", []_C_int{4, 33, 3, 4}}, @@ -254,12 +261,12 @@ var sysctlMib = []mibentry{ {"net.mpls.ifq.maxlen", []_C_int{4, 33, 3, 2}}, {"net.mpls.mapttl_ip", []_C_int{4, 33, 5}}, {"net.mpls.mapttl_ip6", []_C_int{4, 33, 6}}, - {"net.mpls.maxloop_inkernel", []_C_int{4, 33, 4}}, {"net.mpls.ttl", []_C_int{4, 33, 2}}, {"net.pflow.stats", []_C_int{4, 34, 1}}, {"net.pipex.enable", []_C_int{4, 35, 1}}, {"vm.anonmin", []_C_int{2, 7}}, {"vm.loadavg", []_C_int{2, 2}}, + {"vm.malloc_conf", []_C_int{2, 12}}, {"vm.maxslp", []_C_int{2, 10}}, {"vm.nkmempages", []_C_int{2, 6}}, {"vm.psstrings", []_C_int{2, 3}}, diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm64.go index 154b57a..cbdda1a 100644 --- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm64.go @@ -36,6 +36,7 @@ var sysctlMib = []mibentry{ {"hw.pagesize", []_C_int{6, 7}}, {"hw.perfpolicy", []_C_int{6, 23}}, {"hw.physmem", []_C_int{6, 19}}, + {"hw.power", []_C_int{6, 26}}, {"hw.product", []_C_int{6, 15}}, {"hw.serialno", []_C_int{6, 17}}, {"hw.setperf", []_C_int{6, 13}}, @@ -44,6 +45,7 @@ var sysctlMib = []mibentry{ {"hw.uuid", []_C_int{6, 18}}, {"hw.vendor", []_C_int{6, 14}}, {"hw.version", []_C_int{6, 16}}, + {"kern.allowdt", []_C_int{1, 65}}, {"kern.allowkmem", []_C_int{1, 52}}, {"kern.argmax", []_C_int{1, 8}}, {"kern.audio", []_C_int{1, 84}}, @@ -51,6 +53,8 @@ var sysctlMib = []mibentry{ {"kern.bufcachepercent", []_C_int{1, 72}}, {"kern.ccpu", []_C_int{1, 45}}, {"kern.clockrate", []_C_int{1, 12}}, + {"kern.consbuf", []_C_int{1, 83}}, + {"kern.consbufsize", []_C_int{1, 82}}, {"kern.consdev", []_C_int{1, 75}}, {"kern.cp_time", []_C_int{1, 40}}, {"kern.cp_time2", []_C_int{1, 71}}, @@ -83,13 +87,13 @@ var sysctlMib = []mibentry{ {"kern.ngroups", []_C_int{1, 18}}, {"kern.nosuidcoredump", []_C_int{1, 32}}, {"kern.nprocs", []_C_int{1, 47}}, - {"kern.nselcoll", []_C_int{1, 43}}, {"kern.nthreads", []_C_int{1, 26}}, {"kern.numvnodes", []_C_int{1, 58}}, {"kern.osrelease", []_C_int{1, 2}}, {"kern.osrevision", []_C_int{1, 3}}, {"kern.ostype", []_C_int{1, 1}}, {"kern.osversion", []_C_int{1, 27}}, + {"kern.pfstatus", []_C_int{1, 86}}, {"kern.pool_debug", []_C_int{1, 77}}, {"kern.posix1version", []_C_int{1, 17}}, {"kern.proc", []_C_int{1, 66}}, @@ -110,13 +114,16 @@ var sysctlMib = []mibentry{ {"kern.timecounter.hardware", []_C_int{1, 69, 3}}, {"kern.timecounter.tick", []_C_int{1, 69, 1}}, {"kern.timecounter.timestepwarnings", []_C_int{1, 69, 2}}, + {"kern.timeout_stats", []_C_int{1, 87}}, {"kern.tty.tk_cancc", []_C_int{1, 44, 4}}, {"kern.tty.tk_nin", []_C_int{1, 44, 1}}, {"kern.tty.tk_nout", []_C_int{1, 44, 2}}, {"kern.tty.tk_rawcc", []_C_int{1, 44, 3}}, {"kern.tty.ttyinfo", []_C_int{1, 44, 5}}, {"kern.ttycount", []_C_int{1, 57}}, + {"kern.utc_offset", []_C_int{1, 88}}, {"kern.version", []_C_int{1, 4}}, + {"kern.video", []_C_int{1, 89}}, {"kern.watchdog.auto", []_C_int{1, 64, 2}}, {"kern.watchdog.period", []_C_int{1, 64, 1}}, {"kern.witnesswatch", []_C_int{1, 53}}, @@ -179,7 +186,6 @@ var sysctlMib = []mibentry{ {"net.inet.ipcomp.stats", []_C_int{4, 2, 108, 2}}, {"net.inet.ipip.allow", []_C_int{4, 2, 4, 1}}, {"net.inet.ipip.stats", []_C_int{4, 2, 4, 2}}, - {"net.inet.mobileip.allow", []_C_int{4, 2, 55, 1}}, {"net.inet.pfsync.stats", []_C_int{4, 2, 240, 1}}, {"net.inet.tcp.ackonpush", []_C_int{4, 2, 6, 13}}, {"net.inet.tcp.always_keepalive", []_C_int{4, 2, 6, 22}}, @@ -255,7 +261,6 @@ var sysctlMib = []mibentry{ {"net.mpls.ifq.maxlen", []_C_int{4, 33, 3, 2}}, {"net.mpls.mapttl_ip", []_C_int{4, 33, 5}}, {"net.mpls.mapttl_ip6", []_C_int{4, 33, 6}}, - {"net.mpls.maxloop_inkernel", []_C_int{4, 33, 4}}, {"net.mpls.ttl", []_C_int{4, 33, 2}}, {"net.pflow.stats", []_C_int{4, 34, 1}}, {"net.pipex.enable", []_C_int{4, 35, 1}}, diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_mips64.go index d96bb2b..f55eae1 100644 --- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_mips64.go @@ -36,6 +36,7 @@ var sysctlMib = []mibentry{ {"hw.pagesize", []_C_int{6, 7}}, {"hw.perfpolicy", []_C_int{6, 23}}, {"hw.physmem", []_C_int{6, 19}}, + {"hw.power", []_C_int{6, 26}}, {"hw.product", []_C_int{6, 15}}, {"hw.serialno", []_C_int{6, 17}}, {"hw.setperf", []_C_int{6, 13}}, @@ -86,7 +87,6 @@ var sysctlMib = []mibentry{ {"kern.ngroups", []_C_int{1, 18}}, {"kern.nosuidcoredump", []_C_int{1, 32}}, {"kern.nprocs", []_C_int{1, 47}}, - {"kern.nselcoll", []_C_int{1, 43}}, {"kern.nthreads", []_C_int{1, 26}}, {"kern.numvnodes", []_C_int{1, 58}}, {"kern.osrelease", []_C_int{1, 2}}, @@ -123,6 +123,7 @@ var sysctlMib = []mibentry{ {"kern.ttycount", []_C_int{1, 57}}, {"kern.utc_offset", []_C_int{1, 88}}, {"kern.version", []_C_int{1, 4}}, + {"kern.video", []_C_int{1, 89}}, {"kern.watchdog.auto", []_C_int{1, 64, 2}}, {"kern.watchdog.period", []_C_int{1, 64, 1}}, {"kern.witnesswatch", []_C_int{1, 53}}, diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_ppc64.go new file mode 100644 index 0000000..e440544 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_ppc64.go @@ -0,0 +1,281 @@ +// go run mksysctl_openbsd.go +// Code generated by the command above; DO NOT EDIT. + +//go:build ppc64 && openbsd +// +build ppc64,openbsd + +package unix + +type mibentry struct { + ctlname string + ctloid []_C_int +} + +var sysctlMib = []mibentry{ + {"ddb.console", []_C_int{9, 6}}, + {"ddb.log", []_C_int{9, 7}}, + {"ddb.max_line", []_C_int{9, 3}}, + {"ddb.max_width", []_C_int{9, 2}}, + {"ddb.panic", []_C_int{9, 5}}, + {"ddb.profile", []_C_int{9, 9}}, + {"ddb.radix", []_C_int{9, 1}}, + {"ddb.tab_stop_width", []_C_int{9, 4}}, + {"ddb.trigger", []_C_int{9, 8}}, + {"fs.posix.setuid", []_C_int{3, 1, 1}}, + {"hw.allowpowerdown", []_C_int{6, 22}}, + {"hw.byteorder", []_C_int{6, 4}}, + {"hw.cpuspeed", []_C_int{6, 12}}, + {"hw.diskcount", []_C_int{6, 10}}, + {"hw.disknames", []_C_int{6, 8}}, + {"hw.diskstats", []_C_int{6, 9}}, + {"hw.machine", []_C_int{6, 1}}, + {"hw.model", []_C_int{6, 2}}, + {"hw.ncpu", []_C_int{6, 3}}, + {"hw.ncpufound", []_C_int{6, 21}}, + {"hw.ncpuonline", []_C_int{6, 25}}, + {"hw.pagesize", []_C_int{6, 7}}, + {"hw.perfpolicy", []_C_int{6, 23}}, + {"hw.physmem", []_C_int{6, 19}}, + {"hw.power", []_C_int{6, 26}}, + {"hw.product", []_C_int{6, 15}}, + {"hw.serialno", []_C_int{6, 17}}, + {"hw.setperf", []_C_int{6, 13}}, + {"hw.smt", []_C_int{6, 24}}, + {"hw.usermem", []_C_int{6, 20}}, + {"hw.uuid", []_C_int{6, 18}}, + {"hw.vendor", []_C_int{6, 14}}, + {"hw.version", []_C_int{6, 16}}, + {"kern.allowdt", []_C_int{1, 65}}, + {"kern.allowkmem", []_C_int{1, 52}}, + {"kern.argmax", []_C_int{1, 8}}, + {"kern.audio", []_C_int{1, 84}}, + {"kern.boottime", []_C_int{1, 21}}, + {"kern.bufcachepercent", []_C_int{1, 72}}, + {"kern.ccpu", []_C_int{1, 45}}, + {"kern.clockrate", []_C_int{1, 12}}, + {"kern.consbuf", []_C_int{1, 83}}, + {"kern.consbufsize", []_C_int{1, 82}}, + {"kern.consdev", []_C_int{1, 75}}, + {"kern.cp_time", []_C_int{1, 40}}, + {"kern.cp_time2", []_C_int{1, 71}}, + {"kern.cpustats", []_C_int{1, 85}}, + {"kern.domainname", []_C_int{1, 22}}, + {"kern.file", []_C_int{1, 73}}, + {"kern.forkstat", []_C_int{1, 42}}, + {"kern.fscale", []_C_int{1, 46}}, + {"kern.fsync", []_C_int{1, 33}}, + {"kern.global_ptrace", []_C_int{1, 81}}, + {"kern.hostid", []_C_int{1, 11}}, + {"kern.hostname", []_C_int{1, 10}}, + {"kern.intrcnt.nintrcnt", []_C_int{1, 63, 1}}, + {"kern.job_control", []_C_int{1, 19}}, + {"kern.malloc.buckets", []_C_int{1, 39, 1}}, + {"kern.malloc.kmemnames", []_C_int{1, 39, 3}}, + {"kern.maxclusters", []_C_int{1, 67}}, + {"kern.maxfiles", []_C_int{1, 7}}, + {"kern.maxlocksperuid", []_C_int{1, 70}}, + {"kern.maxpartitions", []_C_int{1, 23}}, + {"kern.maxproc", []_C_int{1, 6}}, + {"kern.maxthread", []_C_int{1, 25}}, + {"kern.maxvnodes", []_C_int{1, 5}}, + {"kern.mbstat", []_C_int{1, 59}}, + {"kern.msgbuf", []_C_int{1, 48}}, + {"kern.msgbufsize", []_C_int{1, 38}}, + {"kern.nchstats", []_C_int{1, 41}}, + {"kern.netlivelocks", []_C_int{1, 76}}, + {"kern.nfiles", []_C_int{1, 56}}, + {"kern.ngroups", []_C_int{1, 18}}, + {"kern.nosuidcoredump", []_C_int{1, 32}}, + {"kern.nprocs", []_C_int{1, 47}}, + {"kern.nthreads", []_C_int{1, 26}}, + {"kern.numvnodes", []_C_int{1, 58}}, + {"kern.osrelease", []_C_int{1, 2}}, + {"kern.osrevision", []_C_int{1, 3}}, + {"kern.ostype", []_C_int{1, 1}}, + {"kern.osversion", []_C_int{1, 27}}, + {"kern.pfstatus", []_C_int{1, 86}}, + {"kern.pool_debug", []_C_int{1, 77}}, + {"kern.posix1version", []_C_int{1, 17}}, + {"kern.proc", []_C_int{1, 66}}, + {"kern.rawpartition", []_C_int{1, 24}}, + {"kern.saved_ids", []_C_int{1, 20}}, + {"kern.securelevel", []_C_int{1, 9}}, + {"kern.seminfo", []_C_int{1, 61}}, + {"kern.shminfo", []_C_int{1, 62}}, + {"kern.somaxconn", []_C_int{1, 28}}, + {"kern.sominconn", []_C_int{1, 29}}, + {"kern.splassert", []_C_int{1, 54}}, + {"kern.stackgap_random", []_C_int{1, 50}}, + {"kern.sysvipc_info", []_C_int{1, 51}}, + {"kern.sysvmsg", []_C_int{1, 34}}, + {"kern.sysvsem", []_C_int{1, 35}}, + {"kern.sysvshm", []_C_int{1, 36}}, + {"kern.timecounter.choice", []_C_int{1, 69, 4}}, + {"kern.timecounter.hardware", []_C_int{1, 69, 3}}, + {"kern.timecounter.tick", []_C_int{1, 69, 1}}, + {"kern.timecounter.timestepwarnings", []_C_int{1, 69, 2}}, + {"kern.timeout_stats", []_C_int{1, 87}}, + {"kern.tty.tk_cancc", []_C_int{1, 44, 4}}, + {"kern.tty.tk_nin", []_C_int{1, 44, 1}}, + {"kern.tty.tk_nout", []_C_int{1, 44, 2}}, + {"kern.tty.tk_rawcc", []_C_int{1, 44, 3}}, + {"kern.tty.ttyinfo", []_C_int{1, 44, 5}}, + {"kern.ttycount", []_C_int{1, 57}}, + {"kern.utc_offset", []_C_int{1, 88}}, + {"kern.version", []_C_int{1, 4}}, + {"kern.video", []_C_int{1, 89}}, + {"kern.watchdog.auto", []_C_int{1, 64, 2}}, + {"kern.watchdog.period", []_C_int{1, 64, 1}}, + {"kern.witnesswatch", []_C_int{1, 53}}, + {"kern.wxabort", []_C_int{1, 74}}, + {"net.bpf.bufsize", []_C_int{4, 31, 1}}, + {"net.bpf.maxbufsize", []_C_int{4, 31, 2}}, + {"net.inet.ah.enable", []_C_int{4, 2, 51, 1}}, + {"net.inet.ah.stats", []_C_int{4, 2, 51, 2}}, + {"net.inet.carp.allow", []_C_int{4, 2, 112, 1}}, + {"net.inet.carp.log", []_C_int{4, 2, 112, 3}}, + {"net.inet.carp.preempt", []_C_int{4, 2, 112, 2}}, + {"net.inet.carp.stats", []_C_int{4, 2, 112, 4}}, + {"net.inet.divert.recvspace", []_C_int{4, 2, 258, 1}}, + {"net.inet.divert.sendspace", []_C_int{4, 2, 258, 2}}, + {"net.inet.divert.stats", []_C_int{4, 2, 258, 3}}, + {"net.inet.esp.enable", []_C_int{4, 2, 50, 1}}, + {"net.inet.esp.stats", []_C_int{4, 2, 50, 4}}, + {"net.inet.esp.udpencap", []_C_int{4, 2, 50, 2}}, + {"net.inet.esp.udpencap_port", []_C_int{4, 2, 50, 3}}, + {"net.inet.etherip.allow", []_C_int{4, 2, 97, 1}}, + {"net.inet.etherip.stats", []_C_int{4, 2, 97, 2}}, + {"net.inet.gre.allow", []_C_int{4, 2, 47, 1}}, + {"net.inet.gre.wccp", []_C_int{4, 2, 47, 2}}, + {"net.inet.icmp.bmcastecho", []_C_int{4, 2, 1, 2}}, + {"net.inet.icmp.errppslimit", []_C_int{4, 2, 1, 3}}, + {"net.inet.icmp.maskrepl", []_C_int{4, 2, 1, 1}}, + {"net.inet.icmp.rediraccept", []_C_int{4, 2, 1, 4}}, + {"net.inet.icmp.redirtimeout", []_C_int{4, 2, 1, 5}}, + {"net.inet.icmp.stats", []_C_int{4, 2, 1, 7}}, + {"net.inet.icmp.tstamprepl", []_C_int{4, 2, 1, 6}}, + {"net.inet.igmp.stats", []_C_int{4, 2, 2, 1}}, + {"net.inet.ip.arpdown", []_C_int{4, 2, 0, 40}}, + {"net.inet.ip.arpqueued", []_C_int{4, 2, 0, 36}}, + {"net.inet.ip.arptimeout", []_C_int{4, 2, 0, 39}}, + {"net.inet.ip.encdebug", []_C_int{4, 2, 0, 12}}, + {"net.inet.ip.forwarding", []_C_int{4, 2, 0, 1}}, + {"net.inet.ip.ifq.congestion", []_C_int{4, 2, 0, 30, 4}}, + {"net.inet.ip.ifq.drops", []_C_int{4, 2, 0, 30, 3}}, + {"net.inet.ip.ifq.len", []_C_int{4, 2, 0, 30, 1}}, + {"net.inet.ip.ifq.maxlen", []_C_int{4, 2, 0, 30, 2}}, + {"net.inet.ip.maxqueue", []_C_int{4, 2, 0, 11}}, + {"net.inet.ip.mforwarding", []_C_int{4, 2, 0, 31}}, + {"net.inet.ip.mrtmfc", []_C_int{4, 2, 0, 37}}, + {"net.inet.ip.mrtproto", []_C_int{4, 2, 0, 34}}, + {"net.inet.ip.mrtstats", []_C_int{4, 2, 0, 35}}, + {"net.inet.ip.mrtvif", []_C_int{4, 2, 0, 38}}, + {"net.inet.ip.mtu", []_C_int{4, 2, 0, 4}}, + {"net.inet.ip.mtudisc", []_C_int{4, 2, 0, 27}}, + {"net.inet.ip.mtudisctimeout", []_C_int{4, 2, 0, 28}}, + {"net.inet.ip.multipath", []_C_int{4, 2, 0, 32}}, + {"net.inet.ip.portfirst", []_C_int{4, 2, 0, 7}}, + {"net.inet.ip.porthifirst", []_C_int{4, 2, 0, 9}}, + {"net.inet.ip.porthilast", []_C_int{4, 2, 0, 10}}, + {"net.inet.ip.portlast", []_C_int{4, 2, 0, 8}}, + {"net.inet.ip.redirect", []_C_int{4, 2, 0, 2}}, + {"net.inet.ip.sourceroute", []_C_int{4, 2, 0, 5}}, + {"net.inet.ip.stats", []_C_int{4, 2, 0, 33}}, + {"net.inet.ip.ttl", []_C_int{4, 2, 0, 3}}, + {"net.inet.ipcomp.enable", []_C_int{4, 2, 108, 1}}, + {"net.inet.ipcomp.stats", []_C_int{4, 2, 108, 2}}, + {"net.inet.ipip.allow", []_C_int{4, 2, 4, 1}}, + {"net.inet.ipip.stats", []_C_int{4, 2, 4, 2}}, + {"net.inet.pfsync.stats", []_C_int{4, 2, 240, 1}}, + {"net.inet.tcp.ackonpush", []_C_int{4, 2, 6, 13}}, + {"net.inet.tcp.always_keepalive", []_C_int{4, 2, 6, 22}}, + {"net.inet.tcp.baddynamic", []_C_int{4, 2, 6, 6}}, + {"net.inet.tcp.drop", []_C_int{4, 2, 6, 19}}, + {"net.inet.tcp.ecn", []_C_int{4, 2, 6, 14}}, + {"net.inet.tcp.ident", []_C_int{4, 2, 6, 9}}, + {"net.inet.tcp.keepidle", []_C_int{4, 2, 6, 3}}, + {"net.inet.tcp.keepinittime", []_C_int{4, 2, 6, 2}}, + {"net.inet.tcp.keepintvl", []_C_int{4, 2, 6, 4}}, + {"net.inet.tcp.mssdflt", []_C_int{4, 2, 6, 11}}, + {"net.inet.tcp.reasslimit", []_C_int{4, 2, 6, 18}}, + {"net.inet.tcp.rfc1323", []_C_int{4, 2, 6, 1}}, + {"net.inet.tcp.rfc3390", []_C_int{4, 2, 6, 17}}, + {"net.inet.tcp.rootonly", []_C_int{4, 2, 6, 24}}, + {"net.inet.tcp.rstppslimit", []_C_int{4, 2, 6, 12}}, + {"net.inet.tcp.sack", []_C_int{4, 2, 6, 10}}, + {"net.inet.tcp.sackholelimit", []_C_int{4, 2, 6, 20}}, + {"net.inet.tcp.slowhz", []_C_int{4, 2, 6, 5}}, + {"net.inet.tcp.stats", []_C_int{4, 2, 6, 21}}, + {"net.inet.tcp.synbucketlimit", []_C_int{4, 2, 6, 16}}, + {"net.inet.tcp.syncachelimit", []_C_int{4, 2, 6, 15}}, + {"net.inet.tcp.synhashsize", []_C_int{4, 2, 6, 25}}, + {"net.inet.tcp.synuselimit", []_C_int{4, 2, 6, 23}}, + {"net.inet.udp.baddynamic", []_C_int{4, 2, 17, 2}}, + {"net.inet.udp.checksum", []_C_int{4, 2, 17, 1}}, + {"net.inet.udp.recvspace", []_C_int{4, 2, 17, 3}}, + {"net.inet.udp.rootonly", []_C_int{4, 2, 17, 6}}, + {"net.inet.udp.sendspace", []_C_int{4, 2, 17, 4}}, + {"net.inet.udp.stats", []_C_int{4, 2, 17, 5}}, + {"net.inet6.divert.recvspace", []_C_int{4, 24, 86, 1}}, + {"net.inet6.divert.sendspace", []_C_int{4, 24, 86, 2}}, + {"net.inet6.divert.stats", []_C_int{4, 24, 86, 3}}, + {"net.inet6.icmp6.errppslimit", []_C_int{4, 24, 30, 14}}, + {"net.inet6.icmp6.mtudisc_hiwat", []_C_int{4, 24, 30, 16}}, + {"net.inet6.icmp6.mtudisc_lowat", []_C_int{4, 24, 30, 17}}, + {"net.inet6.icmp6.nd6_debug", []_C_int{4, 24, 30, 18}}, + {"net.inet6.icmp6.nd6_delay", []_C_int{4, 24, 30, 8}}, + {"net.inet6.icmp6.nd6_maxnudhint", []_C_int{4, 24, 30, 15}}, + {"net.inet6.icmp6.nd6_mmaxtries", []_C_int{4, 24, 30, 10}}, + {"net.inet6.icmp6.nd6_umaxtries", []_C_int{4, 24, 30, 9}}, + {"net.inet6.icmp6.redirtimeout", []_C_int{4, 24, 30, 3}}, + {"net.inet6.ip6.auto_flowlabel", []_C_int{4, 24, 17, 17}}, + {"net.inet6.ip6.dad_count", []_C_int{4, 24, 17, 16}}, + {"net.inet6.ip6.dad_pending", []_C_int{4, 24, 17, 49}}, + {"net.inet6.ip6.defmcasthlim", []_C_int{4, 24, 17, 18}}, + {"net.inet6.ip6.forwarding", []_C_int{4, 24, 17, 1}}, + {"net.inet6.ip6.forwsrcrt", []_C_int{4, 24, 17, 5}}, + {"net.inet6.ip6.hdrnestlimit", []_C_int{4, 24, 17, 15}}, + {"net.inet6.ip6.hlim", []_C_int{4, 24, 17, 3}}, + {"net.inet6.ip6.log_interval", []_C_int{4, 24, 17, 14}}, + {"net.inet6.ip6.maxdynroutes", []_C_int{4, 24, 17, 48}}, + {"net.inet6.ip6.maxfragpackets", []_C_int{4, 24, 17, 9}}, + {"net.inet6.ip6.maxfrags", []_C_int{4, 24, 17, 41}}, + {"net.inet6.ip6.mforwarding", []_C_int{4, 24, 17, 42}}, + {"net.inet6.ip6.mrtmfc", []_C_int{4, 24, 17, 53}}, + {"net.inet6.ip6.mrtmif", []_C_int{4, 24, 17, 52}}, + {"net.inet6.ip6.mrtproto", []_C_int{4, 24, 17, 8}}, + {"net.inet6.ip6.mtudisctimeout", []_C_int{4, 24, 17, 50}}, + {"net.inet6.ip6.multicast_mtudisc", []_C_int{4, 24, 17, 44}}, + {"net.inet6.ip6.multipath", []_C_int{4, 24, 17, 43}}, + {"net.inet6.ip6.neighborgcthresh", []_C_int{4, 24, 17, 45}}, + {"net.inet6.ip6.redirect", []_C_int{4, 24, 17, 2}}, + {"net.inet6.ip6.soiikey", []_C_int{4, 24, 17, 54}}, + {"net.inet6.ip6.sourcecheck", []_C_int{4, 24, 17, 10}}, + {"net.inet6.ip6.sourcecheck_logint", []_C_int{4, 24, 17, 11}}, + {"net.inet6.ip6.use_deprecated", []_C_int{4, 24, 17, 21}}, + {"net.key.sadb_dump", []_C_int{4, 30, 1}}, + {"net.key.spd_dump", []_C_int{4, 30, 2}}, + {"net.mpls.ifq.congestion", []_C_int{4, 33, 3, 4}}, + {"net.mpls.ifq.drops", []_C_int{4, 33, 3, 3}}, + {"net.mpls.ifq.len", []_C_int{4, 33, 3, 1}}, + {"net.mpls.ifq.maxlen", []_C_int{4, 33, 3, 2}}, + {"net.mpls.mapttl_ip", []_C_int{4, 33, 5}}, + {"net.mpls.mapttl_ip6", []_C_int{4, 33, 6}}, + {"net.mpls.ttl", []_C_int{4, 33, 2}}, + {"net.pflow.stats", []_C_int{4, 34, 1}}, + {"net.pipex.enable", []_C_int{4, 35, 1}}, + {"vm.anonmin", []_C_int{2, 7}}, + {"vm.loadavg", []_C_int{2, 2}}, + {"vm.malloc_conf", []_C_int{2, 12}}, + {"vm.maxslp", []_C_int{2, 10}}, + {"vm.nkmempages", []_C_int{2, 6}}, + {"vm.psstrings", []_C_int{2, 3}}, + {"vm.swapencrypt.enable", []_C_int{2, 5, 0}}, + {"vm.swapencrypt.keyscreated", []_C_int{2, 5, 1}}, + {"vm.swapencrypt.keysdeleted", []_C_int{2, 5, 2}}, + {"vm.uspace", []_C_int{2, 11}}, + {"vm.uvmexp", []_C_int{2, 4}}, + {"vm.vmmeter", []_C_int{2, 1}}, + {"vm.vnodemin", []_C_int{2, 9}}, + {"vm.vtextmin", []_C_int{2, 8}}, +} diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_riscv64.go new file mode 100644 index 0000000..a0db82f --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_riscv64.go @@ -0,0 +1,282 @@ +// go run mksysctl_openbsd.go +// Code generated by the command above; DO NOT EDIT. + +//go:build riscv64 && openbsd +// +build riscv64,openbsd + +package unix + +type mibentry struct { + ctlname string + ctloid []_C_int +} + +var sysctlMib = []mibentry{ + {"ddb.console", []_C_int{9, 6}}, + {"ddb.log", []_C_int{9, 7}}, + {"ddb.max_line", []_C_int{9, 3}}, + {"ddb.max_width", []_C_int{9, 2}}, + {"ddb.panic", []_C_int{9, 5}}, + {"ddb.profile", []_C_int{9, 9}}, + {"ddb.radix", []_C_int{9, 1}}, + {"ddb.tab_stop_width", []_C_int{9, 4}}, + {"ddb.trigger", []_C_int{9, 8}}, + {"fs.posix.setuid", []_C_int{3, 1, 1}}, + {"hw.allowpowerdown", []_C_int{6, 22}}, + {"hw.byteorder", []_C_int{6, 4}}, + {"hw.cpuspeed", []_C_int{6, 12}}, + {"hw.diskcount", []_C_int{6, 10}}, + {"hw.disknames", []_C_int{6, 8}}, + {"hw.diskstats", []_C_int{6, 9}}, + {"hw.machine", []_C_int{6, 1}}, + {"hw.model", []_C_int{6, 2}}, + {"hw.ncpu", []_C_int{6, 3}}, + {"hw.ncpufound", []_C_int{6, 21}}, + {"hw.ncpuonline", []_C_int{6, 25}}, + {"hw.pagesize", []_C_int{6, 7}}, + {"hw.perfpolicy", []_C_int{6, 23}}, + {"hw.physmem", []_C_int{6, 19}}, + {"hw.power", []_C_int{6, 26}}, + {"hw.product", []_C_int{6, 15}}, + {"hw.serialno", []_C_int{6, 17}}, + {"hw.setperf", []_C_int{6, 13}}, + {"hw.smt", []_C_int{6, 24}}, + {"hw.usermem", []_C_int{6, 20}}, + {"hw.uuid", []_C_int{6, 18}}, + {"hw.vendor", []_C_int{6, 14}}, + {"hw.version", []_C_int{6, 16}}, + {"kern.allowdt", []_C_int{1, 65}}, + {"kern.allowkmem", []_C_int{1, 52}}, + {"kern.argmax", []_C_int{1, 8}}, + {"kern.audio", []_C_int{1, 84}}, + {"kern.boottime", []_C_int{1, 21}}, + {"kern.bufcachepercent", []_C_int{1, 72}}, + {"kern.ccpu", []_C_int{1, 45}}, + {"kern.clockrate", []_C_int{1, 12}}, + {"kern.consbuf", []_C_int{1, 83}}, + {"kern.consbufsize", []_C_int{1, 82}}, + {"kern.consdev", []_C_int{1, 75}}, + {"kern.cp_time", []_C_int{1, 40}}, + {"kern.cp_time2", []_C_int{1, 71}}, + {"kern.cpustats", []_C_int{1, 85}}, + {"kern.domainname", []_C_int{1, 22}}, + {"kern.file", []_C_int{1, 73}}, + {"kern.forkstat", []_C_int{1, 42}}, + {"kern.fscale", []_C_int{1, 46}}, + {"kern.fsync", []_C_int{1, 33}}, + {"kern.global_ptrace", []_C_int{1, 81}}, + {"kern.hostid", []_C_int{1, 11}}, + {"kern.hostname", []_C_int{1, 10}}, + {"kern.intrcnt.nintrcnt", []_C_int{1, 63, 1}}, + {"kern.job_control", []_C_int{1, 19}}, + {"kern.malloc.buckets", []_C_int{1, 39, 1}}, + {"kern.malloc.kmemnames", []_C_int{1, 39, 3}}, + {"kern.maxclusters", []_C_int{1, 67}}, + {"kern.maxfiles", []_C_int{1, 7}}, + {"kern.maxlocksperuid", []_C_int{1, 70}}, + {"kern.maxpartitions", []_C_int{1, 23}}, + {"kern.maxproc", []_C_int{1, 6}}, + {"kern.maxthread", []_C_int{1, 25}}, + {"kern.maxvnodes", []_C_int{1, 5}}, + {"kern.mbstat", []_C_int{1, 59}}, + {"kern.msgbuf", []_C_int{1, 48}}, + {"kern.msgbufsize", []_C_int{1, 38}}, + {"kern.nchstats", []_C_int{1, 41}}, + {"kern.netlivelocks", []_C_int{1, 76}}, + {"kern.nfiles", []_C_int{1, 56}}, + {"kern.ngroups", []_C_int{1, 18}}, + {"kern.nosuidcoredump", []_C_int{1, 32}}, + {"kern.nprocs", []_C_int{1, 47}}, + {"kern.nselcoll", []_C_int{1, 43}}, + {"kern.nthreads", []_C_int{1, 26}}, + {"kern.numvnodes", []_C_int{1, 58}}, + {"kern.osrelease", []_C_int{1, 2}}, + {"kern.osrevision", []_C_int{1, 3}}, + {"kern.ostype", []_C_int{1, 1}}, + {"kern.osversion", []_C_int{1, 27}}, + {"kern.pfstatus", []_C_int{1, 86}}, + {"kern.pool_debug", []_C_int{1, 77}}, + {"kern.posix1version", []_C_int{1, 17}}, + {"kern.proc", []_C_int{1, 66}}, + {"kern.rawpartition", []_C_int{1, 24}}, + {"kern.saved_ids", []_C_int{1, 20}}, + {"kern.securelevel", []_C_int{1, 9}}, + {"kern.seminfo", []_C_int{1, 61}}, + {"kern.shminfo", []_C_int{1, 62}}, + {"kern.somaxconn", []_C_int{1, 28}}, + {"kern.sominconn", []_C_int{1, 29}}, + {"kern.splassert", []_C_int{1, 54}}, + {"kern.stackgap_random", []_C_int{1, 50}}, + {"kern.sysvipc_info", []_C_int{1, 51}}, + {"kern.sysvmsg", []_C_int{1, 34}}, + {"kern.sysvsem", []_C_int{1, 35}}, + {"kern.sysvshm", []_C_int{1, 36}}, + {"kern.timecounter.choice", []_C_int{1, 69, 4}}, + {"kern.timecounter.hardware", []_C_int{1, 69, 3}}, + {"kern.timecounter.tick", []_C_int{1, 69, 1}}, + {"kern.timecounter.timestepwarnings", []_C_int{1, 69, 2}}, + {"kern.timeout_stats", []_C_int{1, 87}}, + {"kern.tty.tk_cancc", []_C_int{1, 44, 4}}, + {"kern.tty.tk_nin", []_C_int{1, 44, 1}}, + {"kern.tty.tk_nout", []_C_int{1, 44, 2}}, + {"kern.tty.tk_rawcc", []_C_int{1, 44, 3}}, + {"kern.tty.ttyinfo", []_C_int{1, 44, 5}}, + {"kern.ttycount", []_C_int{1, 57}}, + {"kern.utc_offset", []_C_int{1, 88}}, + {"kern.version", []_C_int{1, 4}}, + {"kern.video", []_C_int{1, 89}}, + {"kern.watchdog.auto", []_C_int{1, 64, 2}}, + {"kern.watchdog.period", []_C_int{1, 64, 1}}, + {"kern.witnesswatch", []_C_int{1, 53}}, + {"kern.wxabort", []_C_int{1, 74}}, + {"net.bpf.bufsize", []_C_int{4, 31, 1}}, + {"net.bpf.maxbufsize", []_C_int{4, 31, 2}}, + {"net.inet.ah.enable", []_C_int{4, 2, 51, 1}}, + {"net.inet.ah.stats", []_C_int{4, 2, 51, 2}}, + {"net.inet.carp.allow", []_C_int{4, 2, 112, 1}}, + {"net.inet.carp.log", []_C_int{4, 2, 112, 3}}, + {"net.inet.carp.preempt", []_C_int{4, 2, 112, 2}}, + {"net.inet.carp.stats", []_C_int{4, 2, 112, 4}}, + {"net.inet.divert.recvspace", []_C_int{4, 2, 258, 1}}, + {"net.inet.divert.sendspace", []_C_int{4, 2, 258, 2}}, + {"net.inet.divert.stats", []_C_int{4, 2, 258, 3}}, + {"net.inet.esp.enable", []_C_int{4, 2, 50, 1}}, + {"net.inet.esp.stats", []_C_int{4, 2, 50, 4}}, + {"net.inet.esp.udpencap", []_C_int{4, 2, 50, 2}}, + {"net.inet.esp.udpencap_port", []_C_int{4, 2, 50, 3}}, + {"net.inet.etherip.allow", []_C_int{4, 2, 97, 1}}, + {"net.inet.etherip.stats", []_C_int{4, 2, 97, 2}}, + {"net.inet.gre.allow", []_C_int{4, 2, 47, 1}}, + {"net.inet.gre.wccp", []_C_int{4, 2, 47, 2}}, + {"net.inet.icmp.bmcastecho", []_C_int{4, 2, 1, 2}}, + {"net.inet.icmp.errppslimit", []_C_int{4, 2, 1, 3}}, + {"net.inet.icmp.maskrepl", []_C_int{4, 2, 1, 1}}, + {"net.inet.icmp.rediraccept", []_C_int{4, 2, 1, 4}}, + {"net.inet.icmp.redirtimeout", []_C_int{4, 2, 1, 5}}, + {"net.inet.icmp.stats", []_C_int{4, 2, 1, 7}}, + {"net.inet.icmp.tstamprepl", []_C_int{4, 2, 1, 6}}, + {"net.inet.igmp.stats", []_C_int{4, 2, 2, 1}}, + {"net.inet.ip.arpdown", []_C_int{4, 2, 0, 40}}, + {"net.inet.ip.arpqueued", []_C_int{4, 2, 0, 36}}, + {"net.inet.ip.arptimeout", []_C_int{4, 2, 0, 39}}, + {"net.inet.ip.encdebug", []_C_int{4, 2, 0, 12}}, + {"net.inet.ip.forwarding", []_C_int{4, 2, 0, 1}}, + {"net.inet.ip.ifq.congestion", []_C_int{4, 2, 0, 30, 4}}, + {"net.inet.ip.ifq.drops", []_C_int{4, 2, 0, 30, 3}}, + {"net.inet.ip.ifq.len", []_C_int{4, 2, 0, 30, 1}}, + {"net.inet.ip.ifq.maxlen", []_C_int{4, 2, 0, 30, 2}}, + {"net.inet.ip.maxqueue", []_C_int{4, 2, 0, 11}}, + {"net.inet.ip.mforwarding", []_C_int{4, 2, 0, 31}}, + {"net.inet.ip.mrtmfc", []_C_int{4, 2, 0, 37}}, + {"net.inet.ip.mrtproto", []_C_int{4, 2, 0, 34}}, + {"net.inet.ip.mrtstats", []_C_int{4, 2, 0, 35}}, + {"net.inet.ip.mrtvif", []_C_int{4, 2, 0, 38}}, + {"net.inet.ip.mtu", []_C_int{4, 2, 0, 4}}, + {"net.inet.ip.mtudisc", []_C_int{4, 2, 0, 27}}, + {"net.inet.ip.mtudisctimeout", []_C_int{4, 2, 0, 28}}, + {"net.inet.ip.multipath", []_C_int{4, 2, 0, 32}}, + {"net.inet.ip.portfirst", []_C_int{4, 2, 0, 7}}, + {"net.inet.ip.porthifirst", []_C_int{4, 2, 0, 9}}, + {"net.inet.ip.porthilast", []_C_int{4, 2, 0, 10}}, + {"net.inet.ip.portlast", []_C_int{4, 2, 0, 8}}, + {"net.inet.ip.redirect", []_C_int{4, 2, 0, 2}}, + {"net.inet.ip.sourceroute", []_C_int{4, 2, 0, 5}}, + {"net.inet.ip.stats", []_C_int{4, 2, 0, 33}}, + {"net.inet.ip.ttl", []_C_int{4, 2, 0, 3}}, + {"net.inet.ipcomp.enable", []_C_int{4, 2, 108, 1}}, + {"net.inet.ipcomp.stats", []_C_int{4, 2, 108, 2}}, + {"net.inet.ipip.allow", []_C_int{4, 2, 4, 1}}, + {"net.inet.ipip.stats", []_C_int{4, 2, 4, 2}}, + {"net.inet.pfsync.stats", []_C_int{4, 2, 240, 1}}, + {"net.inet.tcp.ackonpush", []_C_int{4, 2, 6, 13}}, + {"net.inet.tcp.always_keepalive", []_C_int{4, 2, 6, 22}}, + {"net.inet.tcp.baddynamic", []_C_int{4, 2, 6, 6}}, + {"net.inet.tcp.drop", []_C_int{4, 2, 6, 19}}, + {"net.inet.tcp.ecn", []_C_int{4, 2, 6, 14}}, + {"net.inet.tcp.ident", []_C_int{4, 2, 6, 9}}, + {"net.inet.tcp.keepidle", []_C_int{4, 2, 6, 3}}, + {"net.inet.tcp.keepinittime", []_C_int{4, 2, 6, 2}}, + {"net.inet.tcp.keepintvl", []_C_int{4, 2, 6, 4}}, + {"net.inet.tcp.mssdflt", []_C_int{4, 2, 6, 11}}, + {"net.inet.tcp.reasslimit", []_C_int{4, 2, 6, 18}}, + {"net.inet.tcp.rfc1323", []_C_int{4, 2, 6, 1}}, + {"net.inet.tcp.rfc3390", []_C_int{4, 2, 6, 17}}, + {"net.inet.tcp.rootonly", []_C_int{4, 2, 6, 24}}, + {"net.inet.tcp.rstppslimit", []_C_int{4, 2, 6, 12}}, + {"net.inet.tcp.sack", []_C_int{4, 2, 6, 10}}, + {"net.inet.tcp.sackholelimit", []_C_int{4, 2, 6, 20}}, + {"net.inet.tcp.slowhz", []_C_int{4, 2, 6, 5}}, + {"net.inet.tcp.stats", []_C_int{4, 2, 6, 21}}, + {"net.inet.tcp.synbucketlimit", []_C_int{4, 2, 6, 16}}, + {"net.inet.tcp.syncachelimit", []_C_int{4, 2, 6, 15}}, + {"net.inet.tcp.synhashsize", []_C_int{4, 2, 6, 25}}, + {"net.inet.tcp.synuselimit", []_C_int{4, 2, 6, 23}}, + {"net.inet.udp.baddynamic", []_C_int{4, 2, 17, 2}}, + {"net.inet.udp.checksum", []_C_int{4, 2, 17, 1}}, + {"net.inet.udp.recvspace", []_C_int{4, 2, 17, 3}}, + {"net.inet.udp.rootonly", []_C_int{4, 2, 17, 6}}, + {"net.inet.udp.sendspace", []_C_int{4, 2, 17, 4}}, + {"net.inet.udp.stats", []_C_int{4, 2, 17, 5}}, + {"net.inet6.divert.recvspace", []_C_int{4, 24, 86, 1}}, + {"net.inet6.divert.sendspace", []_C_int{4, 24, 86, 2}}, + {"net.inet6.divert.stats", []_C_int{4, 24, 86, 3}}, + {"net.inet6.icmp6.errppslimit", []_C_int{4, 24, 30, 14}}, + {"net.inet6.icmp6.mtudisc_hiwat", []_C_int{4, 24, 30, 16}}, + {"net.inet6.icmp6.mtudisc_lowat", []_C_int{4, 24, 30, 17}}, + {"net.inet6.icmp6.nd6_debug", []_C_int{4, 24, 30, 18}}, + {"net.inet6.icmp6.nd6_delay", []_C_int{4, 24, 30, 8}}, + {"net.inet6.icmp6.nd6_maxnudhint", []_C_int{4, 24, 30, 15}}, + {"net.inet6.icmp6.nd6_mmaxtries", []_C_int{4, 24, 30, 10}}, + {"net.inet6.icmp6.nd6_umaxtries", []_C_int{4, 24, 30, 9}}, + {"net.inet6.icmp6.redirtimeout", []_C_int{4, 24, 30, 3}}, + {"net.inet6.ip6.auto_flowlabel", []_C_int{4, 24, 17, 17}}, + {"net.inet6.ip6.dad_count", []_C_int{4, 24, 17, 16}}, + {"net.inet6.ip6.dad_pending", []_C_int{4, 24, 17, 49}}, + {"net.inet6.ip6.defmcasthlim", []_C_int{4, 24, 17, 18}}, + {"net.inet6.ip6.forwarding", []_C_int{4, 24, 17, 1}}, + {"net.inet6.ip6.forwsrcrt", []_C_int{4, 24, 17, 5}}, + {"net.inet6.ip6.hdrnestlimit", []_C_int{4, 24, 17, 15}}, + {"net.inet6.ip6.hlim", []_C_int{4, 24, 17, 3}}, + {"net.inet6.ip6.log_interval", []_C_int{4, 24, 17, 14}}, + {"net.inet6.ip6.maxdynroutes", []_C_int{4, 24, 17, 48}}, + {"net.inet6.ip6.maxfragpackets", []_C_int{4, 24, 17, 9}}, + {"net.inet6.ip6.maxfrags", []_C_int{4, 24, 17, 41}}, + {"net.inet6.ip6.mforwarding", []_C_int{4, 24, 17, 42}}, + {"net.inet6.ip6.mrtmfc", []_C_int{4, 24, 17, 53}}, + {"net.inet6.ip6.mrtmif", []_C_int{4, 24, 17, 52}}, + {"net.inet6.ip6.mrtproto", []_C_int{4, 24, 17, 8}}, + {"net.inet6.ip6.mtudisctimeout", []_C_int{4, 24, 17, 50}}, + {"net.inet6.ip6.multicast_mtudisc", []_C_int{4, 24, 17, 44}}, + {"net.inet6.ip6.multipath", []_C_int{4, 24, 17, 43}}, + {"net.inet6.ip6.neighborgcthresh", []_C_int{4, 24, 17, 45}}, + {"net.inet6.ip6.redirect", []_C_int{4, 24, 17, 2}}, + {"net.inet6.ip6.soiikey", []_C_int{4, 24, 17, 54}}, + {"net.inet6.ip6.sourcecheck", []_C_int{4, 24, 17, 10}}, + {"net.inet6.ip6.sourcecheck_logint", []_C_int{4, 24, 17, 11}}, + {"net.inet6.ip6.use_deprecated", []_C_int{4, 24, 17, 21}}, + {"net.key.sadb_dump", []_C_int{4, 30, 1}}, + {"net.key.spd_dump", []_C_int{4, 30, 2}}, + {"net.mpls.ifq.congestion", []_C_int{4, 33, 3, 4}}, + {"net.mpls.ifq.drops", []_C_int{4, 33, 3, 3}}, + {"net.mpls.ifq.len", []_C_int{4, 33, 3, 1}}, + {"net.mpls.ifq.maxlen", []_C_int{4, 33, 3, 2}}, + {"net.mpls.mapttl_ip", []_C_int{4, 33, 5}}, + {"net.mpls.mapttl_ip6", []_C_int{4, 33, 6}}, + {"net.mpls.ttl", []_C_int{4, 33, 2}}, + {"net.pflow.stats", []_C_int{4, 34, 1}}, + {"net.pipex.enable", []_C_int{4, 35, 1}}, + {"vm.anonmin", []_C_int{2, 7}}, + {"vm.loadavg", []_C_int{2, 2}}, + {"vm.malloc_conf", []_C_int{2, 12}}, + {"vm.maxslp", []_C_int{2, 10}}, + {"vm.nkmempages", []_C_int{2, 6}}, + {"vm.psstrings", []_C_int{2, 3}}, + {"vm.swapencrypt.enable", []_C_int{2, 5, 0}}, + {"vm.swapencrypt.keyscreated", []_C_int{2, 5, 1}}, + {"vm.swapencrypt.keysdeleted", []_C_int{2, 5, 2}}, + {"vm.uspace", []_C_int{2, 11}}, + {"vm.uvmexp", []_C_int{2, 4}}, + {"vm.vmmeter", []_C_int{2, 1}}, + {"vm.vnodemin", []_C_int{2, 9}}, + {"vm.vtextmin", []_C_int{2, 8}}, +} diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go index 62192e1..c9c4ad0 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go @@ -1,4 +1,4 @@ -// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/include -m32 /tmp/include/asm/unistd.h +// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/386/include -m32 /tmp/386/include/asm/unistd.h // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && linux diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go index 490aab5..12ff341 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go @@ -1,4 +1,4 @@ -// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/include -m64 /tmp/include/asm/unistd.h +// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/amd64/include -m64 /tmp/amd64/include/asm/unistd.h // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && linux diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go index aca17b6..c3fb5e7 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go @@ -1,4 +1,4 @@ -// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/include /tmp/include/asm/unistd.h +// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/arm/include /tmp/arm/include/asm/unistd.h // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && linux diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go index 54b4dfa..358c847 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go @@ -1,4 +1,4 @@ -// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/include -fsigned-char /tmp/include/asm/unistd.h +// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/arm64/include -fsigned-char /tmp/arm64/include/asm/unistd.h // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && linux diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go index 44a764c..81c4849 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go @@ -1,4 +1,4 @@ -// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/include /tmp/include/asm/unistd.h +// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/loong64/include /tmp/loong64/include/asm/unistd.h // Code generated by the command above; see README.md. DO NOT EDIT. //go:build loong64 && linux diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go index 65a99ef..202a57e 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go @@ -1,4 +1,4 @@ -// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/include /tmp/include/asm/unistd.h +// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/mips/include /tmp/mips/include/asm/unistd.h // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips && linux diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go index 841c8a6..1fbceb5 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go @@ -1,4 +1,4 @@ -// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/include /tmp/include/asm/unistd.h +// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/mips64/include /tmp/mips64/include/asm/unistd.h // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64 && linux diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go index e26a7c7..b4ffb7a 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go @@ -1,4 +1,4 @@ -// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/include /tmp/include/asm/unistd.h +// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/mips64le/include /tmp/mips64le/include/asm/unistd.h // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64le && linux diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go index 2644726..867985f 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go @@ -1,4 +1,4 @@ -// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/include /tmp/include/asm/unistd.h +// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/mipsle/include /tmp/mipsle/include/asm/unistd.h // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mipsle && linux diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go index 26aefc1..a8cce69 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go @@ -1,4 +1,4 @@ -// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/include /tmp/include/asm/unistd.h +// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/ppc/include /tmp/ppc/include/asm/unistd.h // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc && linux diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go index 8d4cd9d..d44c5b3 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go @@ -1,4 +1,4 @@ -// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/include /tmp/include/asm/unistd.h +// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/ppc64/include /tmp/ppc64/include/asm/unistd.h // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64 && linux diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go index 3b405d1..4214dd9 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go @@ -1,4 +1,4 @@ -// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/include /tmp/include/asm/unistd.h +// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/ppc64le/include /tmp/ppc64le/include/asm/unistd.h // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64le && linux diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go index 3a9c96b..3e594a8 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go @@ -1,4 +1,4 @@ -// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/include /tmp/include/asm/unistd.h +// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/riscv64/include /tmp/riscv64/include/asm/unistd.h // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && linux diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go index 8ffa664..e6ed7d6 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go @@ -1,4 +1,4 @@ -// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/include -fsigned-char /tmp/include/asm/unistd.h +// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/s390x/include -fsigned-char /tmp/s390x/include/asm/unistd.h // Code generated by the command above; see README.md. DO NOT EDIT. //go:build s390x && linux @@ -372,6 +372,7 @@ const ( SYS_LANDLOCK_CREATE_RULESET = 444 SYS_LANDLOCK_ADD_RULE = 445 SYS_LANDLOCK_RESTRICT_SELF = 446 + SYS_MEMFD_SECRET = 447 SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go index 6a39640..92f628e 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go @@ -1,4 +1,4 @@ -// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/include /tmp/include/asm/unistd.h +// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/sparc64/include /tmp/sparc64/include/asm/unistd.h // Code generated by the command above; see README.md. DO NOT EDIT. //go:build sparc64 && linux diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_386.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_386.go index 817edbf..5977338 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_386.go @@ -6,6 +6,7 @@ package unix +// Deprecated: Use libc wrappers instead of direct syscalls. const ( SYS_EXIT = 1 // { void sys_exit(int rval); } SYS_FORK = 2 // { int sys_fork(void); } diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_amd64.go index ea45361..16af291 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_amd64.go @@ -6,6 +6,7 @@ package unix +// Deprecated: Use libc wrappers instead of direct syscalls. const ( SYS_EXIT = 1 // { void sys_exit(int rval); } SYS_FORK = 2 // { int sys_fork(void); } diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm.go index 467971e..f59b18a 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm.go @@ -6,6 +6,7 @@ package unix +// Deprecated: Use libc wrappers instead of direct syscalls. const ( SYS_EXIT = 1 // { void sys_exit(int rval); } SYS_FORK = 2 // { int sys_fork(void); } diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm64.go index 32eec5e..721ef59 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm64.go @@ -6,6 +6,7 @@ package unix +// Deprecated: Use libc wrappers instead of direct syscalls. const ( SYS_EXIT = 1 // { void sys_exit(int rval); } SYS_FORK = 2 // { int sys_fork(void); } diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_mips64.go index a37f773..01c43a0 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_mips64.go @@ -6,6 +6,7 @@ package unix +// Deprecated: Use libc wrappers instead of direct syscalls. const ( SYS_EXIT = 1 // { void sys_exit(int rval); } SYS_FORK = 2 // { int sys_fork(void); } diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_ppc64.go new file mode 100644 index 0000000..f258cfa --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_ppc64.go @@ -0,0 +1,218 @@ +// go run mksysnum.go https://cvsweb.openbsd.org/cgi-bin/cvsweb/~checkout~/src/sys/kern/syscalls.master +// Code generated by the command above; see README.md. DO NOT EDIT. + +//go:build ppc64 && openbsd +// +build ppc64,openbsd + +package unix + +const ( + SYS_EXIT = 1 // { void sys_exit(int rval); } + SYS_FORK = 2 // { int sys_fork(void); } + SYS_READ = 3 // { ssize_t sys_read(int fd, void *buf, size_t nbyte); } + SYS_WRITE = 4 // { ssize_t sys_write(int fd, const void *buf, size_t nbyte); } + SYS_OPEN = 5 // { int sys_open(const char *path, int flags, ... mode_t mode); } + SYS_CLOSE = 6 // { int sys_close(int fd); } + SYS_GETENTROPY = 7 // { int sys_getentropy(void *buf, size_t nbyte); } + SYS___TFORK = 8 // { int sys___tfork(const struct __tfork *param, size_t psize); } + SYS_LINK = 9 // { int sys_link(const char *path, const char *link); } + SYS_UNLINK = 10 // { int sys_unlink(const char *path); } + SYS_WAIT4 = 11 // { pid_t sys_wait4(pid_t pid, int *status, int options, struct rusage *rusage); } + SYS_CHDIR = 12 // { int sys_chdir(const char *path); } + SYS_FCHDIR = 13 // { int sys_fchdir(int fd); } + SYS_MKNOD = 14 // { int sys_mknod(const char *path, mode_t mode, dev_t dev); } + SYS_CHMOD = 15 // { int sys_chmod(const char *path, mode_t mode); } + SYS_CHOWN = 16 // { int sys_chown(const char *path, uid_t uid, gid_t gid); } + SYS_OBREAK = 17 // { int sys_obreak(char *nsize); } break + SYS_GETDTABLECOUNT = 18 // { int sys_getdtablecount(void); } + SYS_GETRUSAGE = 19 // { int sys_getrusage(int who, struct rusage *rusage); } + SYS_GETPID = 20 // { pid_t sys_getpid(void); } + SYS_MOUNT = 21 // { int sys_mount(const char *type, const char *path, int flags, void *data); } + SYS_UNMOUNT = 22 // { int sys_unmount(const char *path, int flags); } + SYS_SETUID = 23 // { int sys_setuid(uid_t uid); } + SYS_GETUID = 24 // { uid_t sys_getuid(void); } + SYS_GETEUID = 25 // { uid_t sys_geteuid(void); } + SYS_PTRACE = 26 // { int sys_ptrace(int req, pid_t pid, caddr_t addr, int data); } + SYS_RECVMSG = 27 // { ssize_t sys_recvmsg(int s, struct msghdr *msg, int flags); } + SYS_SENDMSG = 28 // { ssize_t sys_sendmsg(int s, const struct msghdr *msg, int flags); } + SYS_RECVFROM = 29 // { ssize_t sys_recvfrom(int s, void *buf, size_t len, int flags, struct sockaddr *from, socklen_t *fromlenaddr); } + SYS_ACCEPT = 30 // { int sys_accept(int s, struct sockaddr *name, socklen_t *anamelen); } + SYS_GETPEERNAME = 31 // { int sys_getpeername(int fdes, struct sockaddr *asa, socklen_t *alen); } + SYS_GETSOCKNAME = 32 // { int sys_getsockname(int fdes, struct sockaddr *asa, socklen_t *alen); } + SYS_ACCESS = 33 // { int sys_access(const char *path, int amode); } + SYS_CHFLAGS = 34 // { int sys_chflags(const char *path, u_int flags); } + SYS_FCHFLAGS = 35 // { int sys_fchflags(int fd, u_int flags); } + SYS_SYNC = 36 // { void sys_sync(void); } + SYS_STAT = 38 // { int sys_stat(const char *path, struct stat *ub); } + SYS_GETPPID = 39 // { pid_t sys_getppid(void); } + SYS_LSTAT = 40 // { int sys_lstat(const char *path, struct stat *ub); } + SYS_DUP = 41 // { int sys_dup(int fd); } + SYS_FSTATAT = 42 // { int sys_fstatat(int fd, const char *path, struct stat *buf, int flag); } + SYS_GETEGID = 43 // { gid_t sys_getegid(void); } + SYS_PROFIL = 44 // { int sys_profil(caddr_t samples, size_t size, u_long offset, u_int scale); } + SYS_KTRACE = 45 // { int sys_ktrace(const char *fname, int ops, int facs, pid_t pid); } + SYS_SIGACTION = 46 // { int sys_sigaction(int signum, const struct sigaction *nsa, struct sigaction *osa); } + SYS_GETGID = 47 // { gid_t sys_getgid(void); } + SYS_SIGPROCMASK = 48 // { int sys_sigprocmask(int how, sigset_t mask); } + SYS_SETLOGIN = 50 // { int sys_setlogin(const char *namebuf); } + SYS_ACCT = 51 // { int sys_acct(const char *path); } + SYS_SIGPENDING = 52 // { int sys_sigpending(void); } + SYS_FSTAT = 53 // { int sys_fstat(int fd, struct stat *sb); } + SYS_IOCTL = 54 // { int sys_ioctl(int fd, u_long com, ... void *data); } + SYS_REBOOT = 55 // { int sys_reboot(int opt); } + SYS_REVOKE = 56 // { int sys_revoke(const char *path); } + SYS_SYMLINK = 57 // { int sys_symlink(const char *path, const char *link); } + SYS_READLINK = 58 // { ssize_t sys_readlink(const char *path, char *buf, size_t count); } + SYS_EXECVE = 59 // { int sys_execve(const char *path, char * const *argp, char * const *envp); } + SYS_UMASK = 60 // { mode_t sys_umask(mode_t newmask); } + SYS_CHROOT = 61 // { int sys_chroot(const char *path); } + SYS_GETFSSTAT = 62 // { int sys_getfsstat(struct statfs *buf, size_t bufsize, int flags); } + SYS_STATFS = 63 // { int sys_statfs(const char *path, struct statfs *buf); } + SYS_FSTATFS = 64 // { int sys_fstatfs(int fd, struct statfs *buf); } + SYS_FHSTATFS = 65 // { int sys_fhstatfs(const fhandle_t *fhp, struct statfs *buf); } + SYS_VFORK = 66 // { int sys_vfork(void); } + SYS_GETTIMEOFDAY = 67 // { int sys_gettimeofday(struct timeval *tp, struct timezone *tzp); } + SYS_SETTIMEOFDAY = 68 // { int sys_settimeofday(const struct timeval *tv, const struct timezone *tzp); } + SYS_SETITIMER = 69 // { int sys_setitimer(int which, const struct itimerval *itv, struct itimerval *oitv); } + SYS_GETITIMER = 70 // { int sys_getitimer(int which, struct itimerval *itv); } + SYS_SELECT = 71 // { int sys_select(int nd, fd_set *in, fd_set *ou, fd_set *ex, struct timeval *tv); } + SYS_KEVENT = 72 // { int sys_kevent(int fd, const struct kevent *changelist, int nchanges, struct kevent *eventlist, int nevents, const struct timespec *timeout); } + SYS_MUNMAP = 73 // { int sys_munmap(void *addr, size_t len); } + SYS_MPROTECT = 74 // { int sys_mprotect(void *addr, size_t len, int prot); } + SYS_MADVISE = 75 // { int sys_madvise(void *addr, size_t len, int behav); } + SYS_UTIMES = 76 // { int sys_utimes(const char *path, const struct timeval *tptr); } + SYS_FUTIMES = 77 // { int sys_futimes(int fd, const struct timeval *tptr); } + SYS_GETGROUPS = 79 // { int sys_getgroups(int gidsetsize, gid_t *gidset); } + SYS_SETGROUPS = 80 // { int sys_setgroups(int gidsetsize, const gid_t *gidset); } + SYS_GETPGRP = 81 // { int sys_getpgrp(void); } + SYS_SETPGID = 82 // { int sys_setpgid(pid_t pid, pid_t pgid); } + SYS_FUTEX = 83 // { int sys_futex(uint32_t *f, int op, int val, const struct timespec *timeout, uint32_t *g); } + SYS_UTIMENSAT = 84 // { int sys_utimensat(int fd, const char *path, const struct timespec *times, int flag); } + SYS_FUTIMENS = 85 // { int sys_futimens(int fd, const struct timespec *times); } + SYS_KBIND = 86 // { int sys_kbind(const struct __kbind *param, size_t psize, int64_t proc_cookie); } + SYS_CLOCK_GETTIME = 87 // { int sys_clock_gettime(clockid_t clock_id, struct timespec *tp); } + SYS_CLOCK_SETTIME = 88 // { int sys_clock_settime(clockid_t clock_id, const struct timespec *tp); } + SYS_CLOCK_GETRES = 89 // { int sys_clock_getres(clockid_t clock_id, struct timespec *tp); } + SYS_DUP2 = 90 // { int sys_dup2(int from, int to); } + SYS_NANOSLEEP = 91 // { int sys_nanosleep(const struct timespec *rqtp, struct timespec *rmtp); } + SYS_FCNTL = 92 // { int sys_fcntl(int fd, int cmd, ... void *arg); } + SYS_ACCEPT4 = 93 // { int sys_accept4(int s, struct sockaddr *name, socklen_t *anamelen, int flags); } + SYS___THRSLEEP = 94 // { int sys___thrsleep(const volatile void *ident, clockid_t clock_id, const struct timespec *tp, void *lock, const int *abort); } + SYS_FSYNC = 95 // { int sys_fsync(int fd); } + SYS_SETPRIORITY = 96 // { int sys_setpriority(int which, id_t who, int prio); } + SYS_SOCKET = 97 // { int sys_socket(int domain, int type, int protocol); } + SYS_CONNECT = 98 // { int sys_connect(int s, const struct sockaddr *name, socklen_t namelen); } + SYS_GETDENTS = 99 // { int sys_getdents(int fd, void *buf, size_t buflen); } + SYS_GETPRIORITY = 100 // { int sys_getpriority(int which, id_t who); } + SYS_PIPE2 = 101 // { int sys_pipe2(int *fdp, int flags); } + SYS_DUP3 = 102 // { int sys_dup3(int from, int to, int flags); } + SYS_SIGRETURN = 103 // { int sys_sigreturn(struct sigcontext *sigcntxp); } + SYS_BIND = 104 // { int sys_bind(int s, const struct sockaddr *name, socklen_t namelen); } + SYS_SETSOCKOPT = 105 // { int sys_setsockopt(int s, int level, int name, const void *val, socklen_t valsize); } + SYS_LISTEN = 106 // { int sys_listen(int s, int backlog); } + SYS_CHFLAGSAT = 107 // { int sys_chflagsat(int fd, const char *path, u_int flags, int atflags); } + SYS_PLEDGE = 108 // { int sys_pledge(const char *promises, const char *execpromises); } + SYS_PPOLL = 109 // { int sys_ppoll(struct pollfd *fds, u_int nfds, const struct timespec *ts, const sigset_t *mask); } + SYS_PSELECT = 110 // { int sys_pselect(int nd, fd_set *in, fd_set *ou, fd_set *ex, const struct timespec *ts, const sigset_t *mask); } + SYS_SIGSUSPEND = 111 // { int sys_sigsuspend(int mask); } + SYS_SENDSYSLOG = 112 // { int sys_sendsyslog(const char *buf, size_t nbyte, int flags); } + SYS_UNVEIL = 114 // { int sys_unveil(const char *path, const char *permissions); } + SYS_GETSOCKOPT = 118 // { int sys_getsockopt(int s, int level, int name, void *val, socklen_t *avalsize); } + SYS_THRKILL = 119 // { int sys_thrkill(pid_t tid, int signum, void *tcb); } + SYS_READV = 120 // { ssize_t sys_readv(int fd, const struct iovec *iovp, int iovcnt); } + SYS_WRITEV = 121 // { ssize_t sys_writev(int fd, const struct iovec *iovp, int iovcnt); } + SYS_KILL = 122 // { int sys_kill(int pid, int signum); } + SYS_FCHOWN = 123 // { int sys_fchown(int fd, uid_t uid, gid_t gid); } + SYS_FCHMOD = 124 // { int sys_fchmod(int fd, mode_t mode); } + SYS_SETREUID = 126 // { int sys_setreuid(uid_t ruid, uid_t euid); } + SYS_SETREGID = 127 // { int sys_setregid(gid_t rgid, gid_t egid); } + SYS_RENAME = 128 // { int sys_rename(const char *from, const char *to); } + SYS_FLOCK = 131 // { int sys_flock(int fd, int how); } + SYS_MKFIFO = 132 // { int sys_mkfifo(const char *path, mode_t mode); } + SYS_SENDTO = 133 // { ssize_t sys_sendto(int s, const void *buf, size_t len, int flags, const struct sockaddr *to, socklen_t tolen); } + SYS_SHUTDOWN = 134 // { int sys_shutdown(int s, int how); } + SYS_SOCKETPAIR = 135 // { int sys_socketpair(int domain, int type, int protocol, int *rsv); } + SYS_MKDIR = 136 // { int sys_mkdir(const char *path, mode_t mode); } + SYS_RMDIR = 137 // { int sys_rmdir(const char *path); } + SYS_ADJTIME = 140 // { int sys_adjtime(const struct timeval *delta, struct timeval *olddelta); } + SYS_GETLOGIN_R = 141 // { int sys_getlogin_r(char *namebuf, u_int namelen); } + SYS_SETSID = 147 // { int sys_setsid(void); } + SYS_QUOTACTL = 148 // { int sys_quotactl(const char *path, int cmd, int uid, char *arg); } + SYS_NFSSVC = 155 // { int sys_nfssvc(int flag, void *argp); } + SYS_GETFH = 161 // { int sys_getfh(const char *fname, fhandle_t *fhp); } + SYS_SYSARCH = 165 // { int sys_sysarch(int op, void *parms); } + SYS_PREAD = 173 // { ssize_t sys_pread(int fd, void *buf, size_t nbyte, int pad, off_t offset); } + SYS_PWRITE = 174 // { ssize_t sys_pwrite(int fd, const void *buf, size_t nbyte, int pad, off_t offset); } + SYS_SETGID = 181 // { int sys_setgid(gid_t gid); } + SYS_SETEGID = 182 // { int sys_setegid(gid_t egid); } + SYS_SETEUID = 183 // { int sys_seteuid(uid_t euid); } + SYS_PATHCONF = 191 // { long sys_pathconf(const char *path, int name); } + SYS_FPATHCONF = 192 // { long sys_fpathconf(int fd, int name); } + SYS_SWAPCTL = 193 // { int sys_swapctl(int cmd, const void *arg, int misc); } + SYS_GETRLIMIT = 194 // { int sys_getrlimit(int which, struct rlimit *rlp); } + SYS_SETRLIMIT = 195 // { int sys_setrlimit(int which, const struct rlimit *rlp); } + SYS_MMAP = 197 // { void *sys_mmap(void *addr, size_t len, int prot, int flags, int fd, long pad, off_t pos); } + SYS_LSEEK = 199 // { off_t sys_lseek(int fd, int pad, off_t offset, int whence); } + SYS_TRUNCATE = 200 // { int sys_truncate(const char *path, int pad, off_t length); } + SYS_FTRUNCATE = 201 // { int sys_ftruncate(int fd, int pad, off_t length); } + SYS_SYSCTL = 202 // { int sys_sysctl(const int *name, u_int namelen, void *old, size_t *oldlenp, void *new, size_t newlen); } + SYS_MLOCK = 203 // { int sys_mlock(const void *addr, size_t len); } + SYS_MUNLOCK = 204 // { int sys_munlock(const void *addr, size_t len); } + SYS_GETPGID = 207 // { pid_t sys_getpgid(pid_t pid); } + SYS_UTRACE = 209 // { int sys_utrace(const char *label, const void *addr, size_t len); } + SYS_SEMGET = 221 // { int sys_semget(key_t key, int nsems, int semflg); } + SYS_MSGGET = 225 // { int sys_msgget(key_t key, int msgflg); } + SYS_MSGSND = 226 // { int sys_msgsnd(int msqid, const void *msgp, size_t msgsz, int msgflg); } + SYS_MSGRCV = 227 // { int sys_msgrcv(int msqid, void *msgp, size_t msgsz, long msgtyp, int msgflg); } + SYS_SHMAT = 228 // { void *sys_shmat(int shmid, const void *shmaddr, int shmflg); } + SYS_SHMDT = 230 // { int sys_shmdt(const void *shmaddr); } + SYS_MINHERIT = 250 // { int sys_minherit(void *addr, size_t len, int inherit); } + SYS_POLL = 252 // { int sys_poll(struct pollfd *fds, u_int nfds, int timeout); } + SYS_ISSETUGID = 253 // { int sys_issetugid(void); } + SYS_LCHOWN = 254 // { int sys_lchown(const char *path, uid_t uid, gid_t gid); } + SYS_GETSID = 255 // { pid_t sys_getsid(pid_t pid); } + SYS_MSYNC = 256 // { int sys_msync(void *addr, size_t len, int flags); } + SYS_PIPE = 263 // { int sys_pipe(int *fdp); } + SYS_FHOPEN = 264 // { int sys_fhopen(const fhandle_t *fhp, int flags); } + SYS_PREADV = 267 // { ssize_t sys_preadv(int fd, const struct iovec *iovp, int iovcnt, int pad, off_t offset); } + SYS_PWRITEV = 268 // { ssize_t sys_pwritev(int fd, const struct iovec *iovp, int iovcnt, int pad, off_t offset); } + SYS_KQUEUE = 269 // { int sys_kqueue(void); } + SYS_MLOCKALL = 271 // { int sys_mlockall(int flags); } + SYS_MUNLOCKALL = 272 // { int sys_munlockall(void); } + SYS_GETRESUID = 281 // { int sys_getresuid(uid_t *ruid, uid_t *euid, uid_t *suid); } + SYS_SETRESUID = 282 // { int sys_setresuid(uid_t ruid, uid_t euid, uid_t suid); } + SYS_GETRESGID = 283 // { int sys_getresgid(gid_t *rgid, gid_t *egid, gid_t *sgid); } + SYS_SETRESGID = 284 // { int sys_setresgid(gid_t rgid, gid_t egid, gid_t sgid); } + SYS_MQUERY = 286 // { void *sys_mquery(void *addr, size_t len, int prot, int flags, int fd, long pad, off_t pos); } + SYS_CLOSEFROM = 287 // { int sys_closefrom(int fd); } + SYS_SIGALTSTACK = 288 // { int sys_sigaltstack(const struct sigaltstack *nss, struct sigaltstack *oss); } + SYS_SHMGET = 289 // { int sys_shmget(key_t key, size_t size, int shmflg); } + SYS_SEMOP = 290 // { int sys_semop(int semid, struct sembuf *sops, size_t nsops); } + SYS_FHSTAT = 294 // { int sys_fhstat(const fhandle_t *fhp, struct stat *sb); } + SYS___SEMCTL = 295 // { int sys___semctl(int semid, int semnum, int cmd, union semun *arg); } + SYS_SHMCTL = 296 // { int sys_shmctl(int shmid, int cmd, struct shmid_ds *buf); } + SYS_MSGCTL = 297 // { int sys_msgctl(int msqid, int cmd, struct msqid_ds *buf); } + SYS_SCHED_YIELD = 298 // { int sys_sched_yield(void); } + SYS_GETTHRID = 299 // { pid_t sys_getthrid(void); } + SYS___THRWAKEUP = 301 // { int sys___thrwakeup(const volatile void *ident, int n); } + SYS___THREXIT = 302 // { void sys___threxit(pid_t *notdead); } + SYS___THRSIGDIVERT = 303 // { int sys___thrsigdivert(sigset_t sigmask, siginfo_t *info, const struct timespec *timeout); } + SYS___GETCWD = 304 // { int sys___getcwd(char *buf, size_t len); } + SYS_ADJFREQ = 305 // { int sys_adjfreq(const int64_t *freq, int64_t *oldfreq); } + SYS_SETRTABLE = 310 // { int sys_setrtable(int rtableid); } + SYS_GETRTABLE = 311 // { int sys_getrtable(void); } + SYS_FACCESSAT = 313 // { int sys_faccessat(int fd, const char *path, int amode, int flag); } + SYS_FCHMODAT = 314 // { int sys_fchmodat(int fd, const char *path, mode_t mode, int flag); } + SYS_FCHOWNAT = 315 // { int sys_fchownat(int fd, const char *path, uid_t uid, gid_t gid, int flag); } + SYS_LINKAT = 317 // { int sys_linkat(int fd1, const char *path1, int fd2, const char *path2, int flag); } + SYS_MKDIRAT = 318 // { int sys_mkdirat(int fd, const char *path, mode_t mode); } + SYS_MKFIFOAT = 319 // { int sys_mkfifoat(int fd, const char *path, mode_t mode); } + SYS_MKNODAT = 320 // { int sys_mknodat(int fd, const char *path, mode_t mode, dev_t dev); } + SYS_OPENAT = 321 // { int sys_openat(int fd, const char *path, int flags, ... mode_t mode); } + SYS_READLINKAT = 322 // { ssize_t sys_readlinkat(int fd, const char *path, char *buf, size_t count); } + SYS_RENAMEAT = 323 // { int sys_renameat(int fromfd, const char *from, int tofd, const char *to); } + SYS_SYMLINKAT = 324 // { int sys_symlinkat(const char *path, int fd, const char *link); } + SYS_UNLINKAT = 325 // { int sys_unlinkat(int fd, const char *path, int flag); } + SYS___SET_TCB = 329 // { void sys___set_tcb(void *tcb); } + SYS___GET_TCB = 330 // { void *sys___get_tcb(void); } +) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_riscv64.go new file mode 100644 index 0000000..07919e0 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_riscv64.go @@ -0,0 +1,219 @@ +// go run mksysnum.go https://cvsweb.openbsd.org/cgi-bin/cvsweb/~checkout~/src/sys/kern/syscalls.master +// Code generated by the command above; see README.md. DO NOT EDIT. + +//go:build riscv64 && openbsd +// +build riscv64,openbsd + +package unix + +// Deprecated: Use libc wrappers instead of direct syscalls. +const ( + SYS_EXIT = 1 // { void sys_exit(int rval); } + SYS_FORK = 2 // { int sys_fork(void); } + SYS_READ = 3 // { ssize_t sys_read(int fd, void *buf, size_t nbyte); } + SYS_WRITE = 4 // { ssize_t sys_write(int fd, const void *buf, size_t nbyte); } + SYS_OPEN = 5 // { int sys_open(const char *path, int flags, ... mode_t mode); } + SYS_CLOSE = 6 // { int sys_close(int fd); } + SYS_GETENTROPY = 7 // { int sys_getentropy(void *buf, size_t nbyte); } + SYS___TFORK = 8 // { int sys___tfork(const struct __tfork *param, size_t psize); } + SYS_LINK = 9 // { int sys_link(const char *path, const char *link); } + SYS_UNLINK = 10 // { int sys_unlink(const char *path); } + SYS_WAIT4 = 11 // { pid_t sys_wait4(pid_t pid, int *status, int options, struct rusage *rusage); } + SYS_CHDIR = 12 // { int sys_chdir(const char *path); } + SYS_FCHDIR = 13 // { int sys_fchdir(int fd); } + SYS_MKNOD = 14 // { int sys_mknod(const char *path, mode_t mode, dev_t dev); } + SYS_CHMOD = 15 // { int sys_chmod(const char *path, mode_t mode); } + SYS_CHOWN = 16 // { int sys_chown(const char *path, uid_t uid, gid_t gid); } + SYS_OBREAK = 17 // { int sys_obreak(char *nsize); } break + SYS_GETDTABLECOUNT = 18 // { int sys_getdtablecount(void); } + SYS_GETRUSAGE = 19 // { int sys_getrusage(int who, struct rusage *rusage); } + SYS_GETPID = 20 // { pid_t sys_getpid(void); } + SYS_MOUNT = 21 // { int sys_mount(const char *type, const char *path, int flags, void *data); } + SYS_UNMOUNT = 22 // { int sys_unmount(const char *path, int flags); } + SYS_SETUID = 23 // { int sys_setuid(uid_t uid); } + SYS_GETUID = 24 // { uid_t sys_getuid(void); } + SYS_GETEUID = 25 // { uid_t sys_geteuid(void); } + SYS_PTRACE = 26 // { int sys_ptrace(int req, pid_t pid, caddr_t addr, int data); } + SYS_RECVMSG = 27 // { ssize_t sys_recvmsg(int s, struct msghdr *msg, int flags); } + SYS_SENDMSG = 28 // { ssize_t sys_sendmsg(int s, const struct msghdr *msg, int flags); } + SYS_RECVFROM = 29 // { ssize_t sys_recvfrom(int s, void *buf, size_t len, int flags, struct sockaddr *from, socklen_t *fromlenaddr); } + SYS_ACCEPT = 30 // { int sys_accept(int s, struct sockaddr *name, socklen_t *anamelen); } + SYS_GETPEERNAME = 31 // { int sys_getpeername(int fdes, struct sockaddr *asa, socklen_t *alen); } + SYS_GETSOCKNAME = 32 // { int sys_getsockname(int fdes, struct sockaddr *asa, socklen_t *alen); } + SYS_ACCESS = 33 // { int sys_access(const char *path, int amode); } + SYS_CHFLAGS = 34 // { int sys_chflags(const char *path, u_int flags); } + SYS_FCHFLAGS = 35 // { int sys_fchflags(int fd, u_int flags); } + SYS_SYNC = 36 // { void sys_sync(void); } + SYS_STAT = 38 // { int sys_stat(const char *path, struct stat *ub); } + SYS_GETPPID = 39 // { pid_t sys_getppid(void); } + SYS_LSTAT = 40 // { int sys_lstat(const char *path, struct stat *ub); } + SYS_DUP = 41 // { int sys_dup(int fd); } + SYS_FSTATAT = 42 // { int sys_fstatat(int fd, const char *path, struct stat *buf, int flag); } + SYS_GETEGID = 43 // { gid_t sys_getegid(void); } + SYS_PROFIL = 44 // { int sys_profil(caddr_t samples, size_t size, u_long offset, u_int scale); } + SYS_KTRACE = 45 // { int sys_ktrace(const char *fname, int ops, int facs, pid_t pid); } + SYS_SIGACTION = 46 // { int sys_sigaction(int signum, const struct sigaction *nsa, struct sigaction *osa); } + SYS_GETGID = 47 // { gid_t sys_getgid(void); } + SYS_SIGPROCMASK = 48 // { int sys_sigprocmask(int how, sigset_t mask); } + SYS_SETLOGIN = 50 // { int sys_setlogin(const char *namebuf); } + SYS_ACCT = 51 // { int sys_acct(const char *path); } + SYS_SIGPENDING = 52 // { int sys_sigpending(void); } + SYS_FSTAT = 53 // { int sys_fstat(int fd, struct stat *sb); } + SYS_IOCTL = 54 // { int sys_ioctl(int fd, u_long com, ... void *data); } + SYS_REBOOT = 55 // { int sys_reboot(int opt); } + SYS_REVOKE = 56 // { int sys_revoke(const char *path); } + SYS_SYMLINK = 57 // { int sys_symlink(const char *path, const char *link); } + SYS_READLINK = 58 // { ssize_t sys_readlink(const char *path, char *buf, size_t count); } + SYS_EXECVE = 59 // { int sys_execve(const char *path, char * const *argp, char * const *envp); } + SYS_UMASK = 60 // { mode_t sys_umask(mode_t newmask); } + SYS_CHROOT = 61 // { int sys_chroot(const char *path); } + SYS_GETFSSTAT = 62 // { int sys_getfsstat(struct statfs *buf, size_t bufsize, int flags); } + SYS_STATFS = 63 // { int sys_statfs(const char *path, struct statfs *buf); } + SYS_FSTATFS = 64 // { int sys_fstatfs(int fd, struct statfs *buf); } + SYS_FHSTATFS = 65 // { int sys_fhstatfs(const fhandle_t *fhp, struct statfs *buf); } + SYS_VFORK = 66 // { int sys_vfork(void); } + SYS_GETTIMEOFDAY = 67 // { int sys_gettimeofday(struct timeval *tp, struct timezone *tzp); } + SYS_SETTIMEOFDAY = 68 // { int sys_settimeofday(const struct timeval *tv, const struct timezone *tzp); } + SYS_SETITIMER = 69 // { int sys_setitimer(int which, const struct itimerval *itv, struct itimerval *oitv); } + SYS_GETITIMER = 70 // { int sys_getitimer(int which, struct itimerval *itv); } + SYS_SELECT = 71 // { int sys_select(int nd, fd_set *in, fd_set *ou, fd_set *ex, struct timeval *tv); } + SYS_KEVENT = 72 // { int sys_kevent(int fd, const struct kevent *changelist, int nchanges, struct kevent *eventlist, int nevents, const struct timespec *timeout); } + SYS_MUNMAP = 73 // { int sys_munmap(void *addr, size_t len); } + SYS_MPROTECT = 74 // { int sys_mprotect(void *addr, size_t len, int prot); } + SYS_MADVISE = 75 // { int sys_madvise(void *addr, size_t len, int behav); } + SYS_UTIMES = 76 // { int sys_utimes(const char *path, const struct timeval *tptr); } + SYS_FUTIMES = 77 // { int sys_futimes(int fd, const struct timeval *tptr); } + SYS_GETGROUPS = 79 // { int sys_getgroups(int gidsetsize, gid_t *gidset); } + SYS_SETGROUPS = 80 // { int sys_setgroups(int gidsetsize, const gid_t *gidset); } + SYS_GETPGRP = 81 // { int sys_getpgrp(void); } + SYS_SETPGID = 82 // { int sys_setpgid(pid_t pid, pid_t pgid); } + SYS_FUTEX = 83 // { int sys_futex(uint32_t *f, int op, int val, const struct timespec *timeout, uint32_t *g); } + SYS_UTIMENSAT = 84 // { int sys_utimensat(int fd, const char *path, const struct timespec *times, int flag); } + SYS_FUTIMENS = 85 // { int sys_futimens(int fd, const struct timespec *times); } + SYS_KBIND = 86 // { int sys_kbind(const struct __kbind *param, size_t psize, int64_t proc_cookie); } + SYS_CLOCK_GETTIME = 87 // { int sys_clock_gettime(clockid_t clock_id, struct timespec *tp); } + SYS_CLOCK_SETTIME = 88 // { int sys_clock_settime(clockid_t clock_id, const struct timespec *tp); } + SYS_CLOCK_GETRES = 89 // { int sys_clock_getres(clockid_t clock_id, struct timespec *tp); } + SYS_DUP2 = 90 // { int sys_dup2(int from, int to); } + SYS_NANOSLEEP = 91 // { int sys_nanosleep(const struct timespec *rqtp, struct timespec *rmtp); } + SYS_FCNTL = 92 // { int sys_fcntl(int fd, int cmd, ... void *arg); } + SYS_ACCEPT4 = 93 // { int sys_accept4(int s, struct sockaddr *name, socklen_t *anamelen, int flags); } + SYS___THRSLEEP = 94 // { int sys___thrsleep(const volatile void *ident, clockid_t clock_id, const struct timespec *tp, void *lock, const int *abort); } + SYS_FSYNC = 95 // { int sys_fsync(int fd); } + SYS_SETPRIORITY = 96 // { int sys_setpriority(int which, id_t who, int prio); } + SYS_SOCKET = 97 // { int sys_socket(int domain, int type, int protocol); } + SYS_CONNECT = 98 // { int sys_connect(int s, const struct sockaddr *name, socklen_t namelen); } + SYS_GETDENTS = 99 // { int sys_getdents(int fd, void *buf, size_t buflen); } + SYS_GETPRIORITY = 100 // { int sys_getpriority(int which, id_t who); } + SYS_PIPE2 = 101 // { int sys_pipe2(int *fdp, int flags); } + SYS_DUP3 = 102 // { int sys_dup3(int from, int to, int flags); } + SYS_SIGRETURN = 103 // { int sys_sigreturn(struct sigcontext *sigcntxp); } + SYS_BIND = 104 // { int sys_bind(int s, const struct sockaddr *name, socklen_t namelen); } + SYS_SETSOCKOPT = 105 // { int sys_setsockopt(int s, int level, int name, const void *val, socklen_t valsize); } + SYS_LISTEN = 106 // { int sys_listen(int s, int backlog); } + SYS_CHFLAGSAT = 107 // { int sys_chflagsat(int fd, const char *path, u_int flags, int atflags); } + SYS_PLEDGE = 108 // { int sys_pledge(const char *promises, const char *execpromises); } + SYS_PPOLL = 109 // { int sys_ppoll(struct pollfd *fds, u_int nfds, const struct timespec *ts, const sigset_t *mask); } + SYS_PSELECT = 110 // { int sys_pselect(int nd, fd_set *in, fd_set *ou, fd_set *ex, const struct timespec *ts, const sigset_t *mask); } + SYS_SIGSUSPEND = 111 // { int sys_sigsuspend(int mask); } + SYS_SENDSYSLOG = 112 // { int sys_sendsyslog(const char *buf, size_t nbyte, int flags); } + SYS_UNVEIL = 114 // { int sys_unveil(const char *path, const char *permissions); } + SYS_GETSOCKOPT = 118 // { int sys_getsockopt(int s, int level, int name, void *val, socklen_t *avalsize); } + SYS_THRKILL = 119 // { int sys_thrkill(pid_t tid, int signum, void *tcb); } + SYS_READV = 120 // { ssize_t sys_readv(int fd, const struct iovec *iovp, int iovcnt); } + SYS_WRITEV = 121 // { ssize_t sys_writev(int fd, const struct iovec *iovp, int iovcnt); } + SYS_KILL = 122 // { int sys_kill(int pid, int signum); } + SYS_FCHOWN = 123 // { int sys_fchown(int fd, uid_t uid, gid_t gid); } + SYS_FCHMOD = 124 // { int sys_fchmod(int fd, mode_t mode); } + SYS_SETREUID = 126 // { int sys_setreuid(uid_t ruid, uid_t euid); } + SYS_SETREGID = 127 // { int sys_setregid(gid_t rgid, gid_t egid); } + SYS_RENAME = 128 // { int sys_rename(const char *from, const char *to); } + SYS_FLOCK = 131 // { int sys_flock(int fd, int how); } + SYS_MKFIFO = 132 // { int sys_mkfifo(const char *path, mode_t mode); } + SYS_SENDTO = 133 // { ssize_t sys_sendto(int s, const void *buf, size_t len, int flags, const struct sockaddr *to, socklen_t tolen); } + SYS_SHUTDOWN = 134 // { int sys_shutdown(int s, int how); } + SYS_SOCKETPAIR = 135 // { int sys_socketpair(int domain, int type, int protocol, int *rsv); } + SYS_MKDIR = 136 // { int sys_mkdir(const char *path, mode_t mode); } + SYS_RMDIR = 137 // { int sys_rmdir(const char *path); } + SYS_ADJTIME = 140 // { int sys_adjtime(const struct timeval *delta, struct timeval *olddelta); } + SYS_GETLOGIN_R = 141 // { int sys_getlogin_r(char *namebuf, u_int namelen); } + SYS_SETSID = 147 // { int sys_setsid(void); } + SYS_QUOTACTL = 148 // { int sys_quotactl(const char *path, int cmd, int uid, char *arg); } + SYS_NFSSVC = 155 // { int sys_nfssvc(int flag, void *argp); } + SYS_GETFH = 161 // { int sys_getfh(const char *fname, fhandle_t *fhp); } + SYS_SYSARCH = 165 // { int sys_sysarch(int op, void *parms); } + SYS_PREAD = 173 // { ssize_t sys_pread(int fd, void *buf, size_t nbyte, int pad, off_t offset); } + SYS_PWRITE = 174 // { ssize_t sys_pwrite(int fd, const void *buf, size_t nbyte, int pad, off_t offset); } + SYS_SETGID = 181 // { int sys_setgid(gid_t gid); } + SYS_SETEGID = 182 // { int sys_setegid(gid_t egid); } + SYS_SETEUID = 183 // { int sys_seteuid(uid_t euid); } + SYS_PATHCONF = 191 // { long sys_pathconf(const char *path, int name); } + SYS_FPATHCONF = 192 // { long sys_fpathconf(int fd, int name); } + SYS_SWAPCTL = 193 // { int sys_swapctl(int cmd, const void *arg, int misc); } + SYS_GETRLIMIT = 194 // { int sys_getrlimit(int which, struct rlimit *rlp); } + SYS_SETRLIMIT = 195 // { int sys_setrlimit(int which, const struct rlimit *rlp); } + SYS_MMAP = 197 // { void *sys_mmap(void *addr, size_t len, int prot, int flags, int fd, long pad, off_t pos); } + SYS_LSEEK = 199 // { off_t sys_lseek(int fd, int pad, off_t offset, int whence); } + SYS_TRUNCATE = 200 // { int sys_truncate(const char *path, int pad, off_t length); } + SYS_FTRUNCATE = 201 // { int sys_ftruncate(int fd, int pad, off_t length); } + SYS_SYSCTL = 202 // { int sys_sysctl(const int *name, u_int namelen, void *old, size_t *oldlenp, void *new, size_t newlen); } + SYS_MLOCK = 203 // { int sys_mlock(const void *addr, size_t len); } + SYS_MUNLOCK = 204 // { int sys_munlock(const void *addr, size_t len); } + SYS_GETPGID = 207 // { pid_t sys_getpgid(pid_t pid); } + SYS_UTRACE = 209 // { int sys_utrace(const char *label, const void *addr, size_t len); } + SYS_SEMGET = 221 // { int sys_semget(key_t key, int nsems, int semflg); } + SYS_MSGGET = 225 // { int sys_msgget(key_t key, int msgflg); } + SYS_MSGSND = 226 // { int sys_msgsnd(int msqid, const void *msgp, size_t msgsz, int msgflg); } + SYS_MSGRCV = 227 // { int sys_msgrcv(int msqid, void *msgp, size_t msgsz, long msgtyp, int msgflg); } + SYS_SHMAT = 228 // { void *sys_shmat(int shmid, const void *shmaddr, int shmflg); } + SYS_SHMDT = 230 // { int sys_shmdt(const void *shmaddr); } + SYS_MINHERIT = 250 // { int sys_minherit(void *addr, size_t len, int inherit); } + SYS_POLL = 252 // { int sys_poll(struct pollfd *fds, u_int nfds, int timeout); } + SYS_ISSETUGID = 253 // { int sys_issetugid(void); } + SYS_LCHOWN = 254 // { int sys_lchown(const char *path, uid_t uid, gid_t gid); } + SYS_GETSID = 255 // { pid_t sys_getsid(pid_t pid); } + SYS_MSYNC = 256 // { int sys_msync(void *addr, size_t len, int flags); } + SYS_PIPE = 263 // { int sys_pipe(int *fdp); } + SYS_FHOPEN = 264 // { int sys_fhopen(const fhandle_t *fhp, int flags); } + SYS_PREADV = 267 // { ssize_t sys_preadv(int fd, const struct iovec *iovp, int iovcnt, int pad, off_t offset); } + SYS_PWRITEV = 268 // { ssize_t sys_pwritev(int fd, const struct iovec *iovp, int iovcnt, int pad, off_t offset); } + SYS_KQUEUE = 269 // { int sys_kqueue(void); } + SYS_MLOCKALL = 271 // { int sys_mlockall(int flags); } + SYS_MUNLOCKALL = 272 // { int sys_munlockall(void); } + SYS_GETRESUID = 281 // { int sys_getresuid(uid_t *ruid, uid_t *euid, uid_t *suid); } + SYS_SETRESUID = 282 // { int sys_setresuid(uid_t ruid, uid_t euid, uid_t suid); } + SYS_GETRESGID = 283 // { int sys_getresgid(gid_t *rgid, gid_t *egid, gid_t *sgid); } + SYS_SETRESGID = 284 // { int sys_setresgid(gid_t rgid, gid_t egid, gid_t sgid); } + SYS_MQUERY = 286 // { void *sys_mquery(void *addr, size_t len, int prot, int flags, int fd, long pad, off_t pos); } + SYS_CLOSEFROM = 287 // { int sys_closefrom(int fd); } + SYS_SIGALTSTACK = 288 // { int sys_sigaltstack(const struct sigaltstack *nss, struct sigaltstack *oss); } + SYS_SHMGET = 289 // { int sys_shmget(key_t key, size_t size, int shmflg); } + SYS_SEMOP = 290 // { int sys_semop(int semid, struct sembuf *sops, size_t nsops); } + SYS_FHSTAT = 294 // { int sys_fhstat(const fhandle_t *fhp, struct stat *sb); } + SYS___SEMCTL = 295 // { int sys___semctl(int semid, int semnum, int cmd, union semun *arg); } + SYS_SHMCTL = 296 // { int sys_shmctl(int shmid, int cmd, struct shmid_ds *buf); } + SYS_MSGCTL = 297 // { int sys_msgctl(int msqid, int cmd, struct msqid_ds *buf); } + SYS_SCHED_YIELD = 298 // { int sys_sched_yield(void); } + SYS_GETTHRID = 299 // { pid_t sys_getthrid(void); } + SYS___THRWAKEUP = 301 // { int sys___thrwakeup(const volatile void *ident, int n); } + SYS___THREXIT = 302 // { void sys___threxit(pid_t *notdead); } + SYS___THRSIGDIVERT = 303 // { int sys___thrsigdivert(sigset_t sigmask, siginfo_t *info, const struct timespec *timeout); } + SYS___GETCWD = 304 // { int sys___getcwd(char *buf, size_t len); } + SYS_ADJFREQ = 305 // { int sys_adjfreq(const int64_t *freq, int64_t *oldfreq); } + SYS_SETRTABLE = 310 // { int sys_setrtable(int rtableid); } + SYS_GETRTABLE = 311 // { int sys_getrtable(void); } + SYS_FACCESSAT = 313 // { int sys_faccessat(int fd, const char *path, int amode, int flag); } + SYS_FCHMODAT = 314 // { int sys_fchmodat(int fd, const char *path, mode_t mode, int flag); } + SYS_FCHOWNAT = 315 // { int sys_fchownat(int fd, const char *path, uid_t uid, gid_t gid, int flag); } + SYS_LINKAT = 317 // { int sys_linkat(int fd1, const char *path1, int fd2, const char *path2, int flag); } + SYS_MKDIRAT = 318 // { int sys_mkdirat(int fd, const char *path, mode_t mode); } + SYS_MKFIFOAT = 319 // { int sys_mkfifoat(int fd, const char *path, mode_t mode); } + SYS_MKNODAT = 320 // { int sys_mknodat(int fd, const char *path, mode_t mode, dev_t dev); } + SYS_OPENAT = 321 // { int sys_openat(int fd, const char *path, int flags, ... mode_t mode); } + SYS_READLINKAT = 322 // { ssize_t sys_readlinkat(int fd, const char *path, char *buf, size_t count); } + SYS_RENAMEAT = 323 // { int sys_renameat(int fromfd, const char *from, int tofd, const char *to); } + SYS_SYMLINKAT = 324 // { int sys_symlinkat(const char *path, int fd, const char *link); } + SYS_UNLINKAT = 325 // { int sys_unlinkat(int fd, const char *path, int flag); } + SYS___SET_TCB = 329 // { void sys___set_tcb(void *tcb); } + SYS___GET_TCB = 330 // { void *sys___get_tcb(void); } +) diff --git a/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go index e2a64f0..690cefc 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go @@ -151,6 +151,16 @@ type Dirent struct { _ [3]byte } +type Attrlist struct { + Bitmapcount uint16 + Reserved uint16 + Commonattr uint32 + Volattr uint32 + Dirattr uint32 + Fileattr uint32 + Forkattr uint32 +} + const ( PathMax = 0x400 ) @@ -610,6 +620,7 @@ const ( AT_REMOVEDIR = 0x80 AT_SYMLINK_FOLLOW = 0x40 AT_SYMLINK_NOFOLLOW = 0x20 + AT_EACCESS = 0x10 ) type PollFd struct { diff --git a/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go index 34aa775..5bffc10 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go @@ -151,6 +151,16 @@ type Dirent struct { _ [3]byte } +type Attrlist struct { + Bitmapcount uint16 + Reserved uint16 + Commonattr uint32 + Volattr uint32 + Dirattr uint32 + Fileattr uint32 + Forkattr uint32 +} + const ( PathMax = 0x400 ) @@ -610,6 +620,7 @@ const ( AT_REMOVEDIR = 0x80 AT_SYMLINK_FOLLOW = 0x40 AT_SYMLINK_NOFOLLOW = 0x20 + AT_EACCESS = 0x10 ) type PollFd struct { diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go index dea0c9a..29dc483 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go +++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go @@ -294,7 +294,7 @@ type PtraceLwpInfoStruct struct { Flags int32 Sigmask Sigset_t Siglist Sigset_t - Siginfo __Siginfo + Siginfo __PtraceSiginfo Tdname [20]int8 Child_pid int32 Syscall_code uint32 @@ -312,6 +312,17 @@ type __Siginfo struct { Value [4]byte _ [32]byte } +type __PtraceSiginfo struct { + Signo int32 + Errno int32 + Code int32 + Pid int32 + Uid uint32 + Status int32 + Addr uintptr + Value [4]byte + _ [32]byte +} type Sigset_t struct { Val [4]uint32 @@ -350,7 +361,7 @@ type FpExtendedPrecision struct{} type PtraceIoDesc struct { Op int32 - Offs *byte + Offs uintptr Addr *byte Len uint32 } diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go index da0ea0d..0a89b28 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go @@ -291,7 +291,7 @@ type PtraceLwpInfoStruct struct { Flags int32 Sigmask Sigset_t Siglist Sigset_t - Siginfo __Siginfo + Siginfo __PtraceSiginfo Tdname [20]int8 Child_pid int32 Syscall_code uint32 @@ -310,6 +310,18 @@ type __Siginfo struct { _ [40]byte } +type __PtraceSiginfo struct { + Signo int32 + Errno int32 + Code int32 + Pid int32 + Uid uint32 + Status int32 + Addr uintptr + Value [8]byte + _ [40]byte +} + type Sigset_t struct { Val [4]uint32 } @@ -354,7 +366,7 @@ type FpExtendedPrecision struct{} type PtraceIoDesc struct { Op int32 - Offs *byte + Offs uintptr Addr *byte Len uint64 } diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go index da8f740..c8666bb 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go +++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go @@ -293,7 +293,7 @@ type PtraceLwpInfoStruct struct { Flags int32 Sigmask Sigset_t Siglist Sigset_t - Siginfo __Siginfo + Siginfo __PtraceSiginfo Tdname [20]int8 Child_pid int32 Syscall_code uint32 @@ -312,6 +312,18 @@ type __Siginfo struct { _ [32]byte } +type __PtraceSiginfo struct { + Signo int32 + Errno int32 + Code int32 + Pid int32 + Uid uint32 + Status int32 + Addr uintptr + Value [4]byte + _ [32]byte +} + type Sigset_t struct { Val [4]uint32 } @@ -337,7 +349,7 @@ type FpExtendedPrecision struct { type PtraceIoDesc struct { Op int32 - Offs *byte + Offs uintptr Addr *byte Len uint32 } diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go index d69988e..88fb48a 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go @@ -291,7 +291,7 @@ type PtraceLwpInfoStruct struct { Flags int32 Sigmask Sigset_t Siglist Sigset_t - Siginfo __Siginfo + Siginfo __PtraceSiginfo Tdname [20]int8 Child_pid int32 Syscall_code uint32 @@ -310,6 +310,18 @@ type __Siginfo struct { _ [40]byte } +type __PtraceSiginfo struct { + Signo int32 + Errno int32 + Code int32 + Pid int32 + Uid uint32 + Status int32 + Addr uintptr + Value [8]byte + _ [40]byte +} + type Sigset_t struct { Val [4]uint32 } @@ -334,7 +346,7 @@ type FpExtendedPrecision struct{} type PtraceIoDesc struct { Op int32 - Offs *byte + Offs uintptr Addr *byte Len uint64 } diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_riscv64.go index d6fd9e8..698dc97 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_riscv64.go @@ -291,7 +291,7 @@ type PtraceLwpInfoStruct struct { Flags int32 Sigmask Sigset_t Siglist Sigset_t - Siginfo __Siginfo + Siginfo __PtraceSiginfo Tdname [20]int8 Child_pid int32 Syscall_code uint32 @@ -310,6 +310,18 @@ type __Siginfo struct { _ [40]byte } +type __PtraceSiginfo struct { + Signo int32 + Errno int32 + Code int32 + Pid int32 + Uid uint32 + Status int32 + Addr uintptr + Value [8]byte + _ [40]byte +} + type Sigset_t struct { Val [4]uint32 } @@ -335,7 +347,7 @@ type FpExtendedPrecision struct{} type PtraceIoDesc struct { Op int32 - Offs *byte + Offs uintptr Addr *byte Len uint64 } diff --git a/vendor/golang.org/x/sys/unix/ztypes_illumos_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_illumos_amd64.go deleted file mode 100644 index 4c48526..0000000 --- a/vendor/golang.org/x/sys/unix/ztypes_illumos_amd64.go +++ /dev/null @@ -1,42 +0,0 @@ -// cgo -godefs types_illumos.go | go run mkpost.go -// Code generated by the command above; see README.md. DO NOT EDIT. - -//go:build amd64 && illumos -// +build amd64,illumos - -package unix - -const ( - TUNNEWPPA = 0x540001 - TUNSETPPA = 0x540002 - - I_STR = 0x5308 - I_POP = 0x5303 - I_PUSH = 0x5302 - I_LINK = 0x530c - I_UNLINK = 0x530d - I_PLINK = 0x5316 - I_PUNLINK = 0x5317 - - IF_UNITSEL = -0x7ffb8cca -) - -type strbuf struct { - Maxlen int32 - Len int32 - Buf *int8 -} - -type Strioctl struct { - Cmd int32 - Timout int32 - Len int32 - Dp *int8 -} - -type Lifreq struct { - Name [32]int8 - Lifru1 [4]byte - Type uint32 - Lifru [336]byte -} diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux.go b/vendor/golang.org/x/sys/unix/ztypes_linux.go index 8698479..02e2462 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux.go @@ -29,6 +29,41 @@ type Itimerval struct { Value Timeval } +const ( + ADJ_OFFSET = 0x1 + ADJ_FREQUENCY = 0x2 + ADJ_MAXERROR = 0x4 + ADJ_ESTERROR = 0x8 + ADJ_STATUS = 0x10 + ADJ_TIMECONST = 0x20 + ADJ_TAI = 0x80 + ADJ_SETOFFSET = 0x100 + ADJ_MICRO = 0x1000 + ADJ_NANO = 0x2000 + ADJ_TICK = 0x4000 + ADJ_OFFSET_SINGLESHOT = 0x8001 + ADJ_OFFSET_SS_READ = 0xa001 +) + +const ( + STA_PLL = 0x1 + STA_PPSFREQ = 0x2 + STA_PPSTIME = 0x4 + STA_FLL = 0x8 + STA_INS = 0x10 + STA_DEL = 0x20 + STA_UNSYNC = 0x40 + STA_FREQHOLD = 0x80 + STA_PPSSIGNAL = 0x100 + STA_PPSJITTER = 0x200 + STA_PPSWANDER = 0x400 + STA_PPSERROR = 0x800 + STA_CLOCKERR = 0x1000 + STA_NANO = 0x2000 + STA_MODE = 0x4000 + STA_CLK = 0x8000 +) + const ( TIME_OK = 0x0 TIME_INS = 0x1 @@ -53,29 +88,30 @@ type StatxTimestamp struct { } type Statx_t struct { - Mask uint32 - Blksize uint32 - Attributes uint64 - Nlink uint32 - Uid uint32 - Gid uint32 - Mode uint16 - _ [1]uint16 - Ino uint64 - Size uint64 - Blocks uint64 - Attributes_mask uint64 - Atime StatxTimestamp - Btime StatxTimestamp - Ctime StatxTimestamp - Mtime StatxTimestamp - Rdev_major uint32 - Rdev_minor uint32 - Dev_major uint32 - Dev_minor uint32 - Mnt_id uint64 - _ uint64 - _ [12]uint64 + Mask uint32 + Blksize uint32 + Attributes uint64 + Nlink uint32 + Uid uint32 + Gid uint32 + Mode uint16 + _ [1]uint16 + Ino uint64 + Size uint64 + Blocks uint64 + Attributes_mask uint64 + Atime StatxTimestamp + Btime StatxTimestamp + Ctime StatxTimestamp + Mtime StatxTimestamp + Rdev_major uint32 + Rdev_minor uint32 + Dev_major uint32 + Dev_minor uint32 + Mnt_id uint64 + Dio_mem_align uint32 + Dio_offset_align uint32 + _ [12]uint64 } type Fsid struct { @@ -420,36 +456,60 @@ type Ucred struct { } type TCPInfo struct { - State uint8 - Ca_state uint8 - Retransmits uint8 - Probes uint8 - Backoff uint8 - Options uint8 - Rto uint32 - Ato uint32 - Snd_mss uint32 - Rcv_mss uint32 - Unacked uint32 - Sacked uint32 - Lost uint32 - Retrans uint32 - Fackets uint32 - Last_data_sent uint32 - Last_ack_sent uint32 - Last_data_recv uint32 - Last_ack_recv uint32 - Pmtu uint32 - Rcv_ssthresh uint32 - Rtt uint32 - Rttvar uint32 - Snd_ssthresh uint32 - Snd_cwnd uint32 - Advmss uint32 - Reordering uint32 - Rcv_rtt uint32 - Rcv_space uint32 - Total_retrans uint32 + State uint8 + Ca_state uint8 + Retransmits uint8 + Probes uint8 + Backoff uint8 + Options uint8 + Rto uint32 + Ato uint32 + Snd_mss uint32 + Rcv_mss uint32 + Unacked uint32 + Sacked uint32 + Lost uint32 + Retrans uint32 + Fackets uint32 + Last_data_sent uint32 + Last_ack_sent uint32 + Last_data_recv uint32 + Last_ack_recv uint32 + Pmtu uint32 + Rcv_ssthresh uint32 + Rtt uint32 + Rttvar uint32 + Snd_ssthresh uint32 + Snd_cwnd uint32 + Advmss uint32 + Reordering uint32 + Rcv_rtt uint32 + Rcv_space uint32 + Total_retrans uint32 + Pacing_rate uint64 + Max_pacing_rate uint64 + Bytes_acked uint64 + Bytes_received uint64 + Segs_out uint32 + Segs_in uint32 + Notsent_bytes uint32 + Min_rtt uint32 + Data_segs_in uint32 + Data_segs_out uint32 + Delivery_rate uint64 + Busy_time uint64 + Rwnd_limited uint64 + Sndbuf_limited uint64 + Delivered uint32 + Delivered_ce uint32 + Bytes_sent uint64 + Bytes_retrans uint64 + Dsack_dups uint32 + Reord_seen uint32 + Rcv_ooopack uint32 + Snd_wnd uint32 + Rcv_wnd uint32 + Rehash uint32 } type CanFilter struct { @@ -492,7 +552,7 @@ const ( SizeofIPv6MTUInfo = 0x20 SizeofICMPv6Filter = 0x20 SizeofUcred = 0xc - SizeofTCPInfo = 0x68 + SizeofTCPInfo = 0xf0 SizeofCanFilter = 0x8 SizeofTCPRepairOpt = 0x8 ) @@ -945,6 +1005,9 @@ type PerfEventAttr struct { Aux_watermark uint32 Sample_max_stack uint16 _ uint16 + Aux_sample_size uint32 + _ uint32 + Sig_data uint64 } type PerfEventMmapPage struct { @@ -1004,6 +1067,7 @@ const ( PerfBitCommExec = CBitFieldMaskBit24 PerfBitUseClockID = CBitFieldMaskBit25 PerfBitContextSwitch = CBitFieldMaskBit26 + PerfBitWriteBackward = CBitFieldMaskBit27 ) const ( @@ -1096,7 +1160,8 @@ const ( PERF_SAMPLE_BRANCH_NO_CYCLES_SHIFT = 0xf PERF_SAMPLE_BRANCH_TYPE_SAVE_SHIFT = 0x10 PERF_SAMPLE_BRANCH_HW_INDEX_SHIFT = 0x11 - PERF_SAMPLE_BRANCH_MAX_SHIFT = 0x12 + PERF_SAMPLE_BRANCH_PRIV_SAVE_SHIFT = 0x12 + PERF_SAMPLE_BRANCH_MAX_SHIFT = 0x13 PERF_SAMPLE_BRANCH_USER = 0x1 PERF_SAMPLE_BRANCH_KERNEL = 0x2 PERF_SAMPLE_BRANCH_HV = 0x4 @@ -1115,7 +1180,8 @@ const ( PERF_SAMPLE_BRANCH_NO_CYCLES = 0x8000 PERF_SAMPLE_BRANCH_TYPE_SAVE = 0x10000 PERF_SAMPLE_BRANCH_HW_INDEX = 0x20000 - PERF_SAMPLE_BRANCH_MAX = 0x40000 + PERF_SAMPLE_BRANCH_PRIV_SAVE = 0x40000 + PERF_SAMPLE_BRANCH_MAX = 0x80000 PERF_BR_UNKNOWN = 0x0 PERF_BR_COND = 0x1 PERF_BR_UNCOND = 0x2 @@ -1129,7 +1195,10 @@ const ( PERF_BR_COND_RET = 0xa PERF_BR_ERET = 0xb PERF_BR_IRQ = 0xc - PERF_BR_MAX = 0xd + PERF_BR_SERROR = 0xd + PERF_BR_NO_TX = 0xe + PERF_BR_EXTEND_ABI = 0xf + PERF_BR_MAX = 0x10 PERF_SAMPLE_REGS_ABI_NONE = 0x0 PERF_SAMPLE_REGS_ABI_32 = 0x1 PERF_SAMPLE_REGS_ABI_64 = 0x2 @@ -1148,7 +1217,8 @@ const ( PERF_FORMAT_TOTAL_TIME_RUNNING = 0x2 PERF_FORMAT_ID = 0x4 PERF_FORMAT_GROUP = 0x8 - PERF_FORMAT_MAX = 0x10 + PERF_FORMAT_LOST = 0x10 + PERF_FORMAT_MAX = 0x20 PERF_IOC_FLAG_GROUP = 0x1 PERF_RECORD_MMAP = 0x1 PERF_RECORD_LOST = 0x2 @@ -1194,7 +1264,7 @@ type TCPMD5Sig struct { Flags uint8 Prefixlen uint8 Keylen uint16 - _ uint32 + Ifindex int32 Key [80]uint8 } @@ -1463,6 +1533,15 @@ const ( IFLA_ALT_IFNAME = 0x35 IFLA_PERM_ADDRESS = 0x36 IFLA_PROTO_DOWN_REASON = 0x37 + IFLA_PARENT_DEV_NAME = 0x38 + IFLA_PARENT_DEV_BUS_NAME = 0x39 + IFLA_GRO_MAX_SIZE = 0x3a + IFLA_TSO_MAX_SIZE = 0x3b + IFLA_TSO_MAX_SEGS = 0x3c + IFLA_ALLMULTI = 0x3d + IFLA_DEVLINK_PORT = 0x3e + IFLA_GSO_IPV4_MAX_SIZE = 0x3f + IFLA_GRO_IPV4_MAX_SIZE = 0x40 IFLA_PROTO_DOWN_REASON_UNSPEC = 0x0 IFLA_PROTO_DOWN_REASON_MASK = 0x1 IFLA_PROTO_DOWN_REASON_VALUE = 0x2 @@ -1889,7 +1968,11 @@ const ( NFT_MSG_GETOBJ = 0x13 NFT_MSG_DELOBJ = 0x14 NFT_MSG_GETOBJ_RESET = 0x15 - NFT_MSG_MAX = 0x19 + NFT_MSG_NEWFLOWTABLE = 0x16 + NFT_MSG_GETFLOWTABLE = 0x17 + NFT_MSG_DELFLOWTABLE = 0x18 + NFT_MSG_GETRULE_RESET = 0x19 + NFT_MSG_MAX = 0x21 NFTA_LIST_UNSPEC = 0x0 NFTA_LIST_ELEM = 0x1 NFTA_HOOK_UNSPEC = 0x0 @@ -2393,9 +2476,11 @@ const ( SOF_TIMESTAMPING_OPT_STATS = 0x1000 SOF_TIMESTAMPING_OPT_PKTINFO = 0x2000 SOF_TIMESTAMPING_OPT_TX_SWHW = 0x4000 + SOF_TIMESTAMPING_BIND_PHC = 0x8000 + SOF_TIMESTAMPING_OPT_ID_TCP = 0x10000 - SOF_TIMESTAMPING_LAST = 0x8000 - SOF_TIMESTAMPING_MASK = 0xffff + SOF_TIMESTAMPING_LAST = 0x10000 + SOF_TIMESTAMPING_MASK = 0x1ffff SCM_TSTAMP_SND = 0x0 SCM_TSTAMP_SCHED = 0x1 @@ -2474,6 +2559,11 @@ const ( BPF_REG_8 = 0x8 BPF_REG_9 = 0x9 BPF_REG_10 = 0xa + BPF_CGROUP_ITER_ORDER_UNSPEC = 0x0 + BPF_CGROUP_ITER_SELF_ONLY = 0x1 + BPF_CGROUP_ITER_DESCENDANTS_PRE = 0x2 + BPF_CGROUP_ITER_DESCENDANTS_POST = 0x3 + BPF_CGROUP_ITER_ANCESTORS_UP = 0x4 BPF_MAP_CREATE = 0x0 BPF_MAP_LOOKUP_ELEM = 0x1 BPF_MAP_UPDATE_ELEM = 0x2 @@ -2485,6 +2575,7 @@ const ( BPF_PROG_ATTACH = 0x8 BPF_PROG_DETACH = 0x9 BPF_PROG_TEST_RUN = 0xa + BPF_PROG_RUN = 0xa BPF_PROG_GET_NEXT_ID = 0xb BPF_MAP_GET_NEXT_ID = 0xc BPF_PROG_GET_FD_BY_ID = 0xd @@ -2529,6 +2620,7 @@ const ( BPF_MAP_TYPE_CPUMAP = 0x10 BPF_MAP_TYPE_XSKMAP = 0x11 BPF_MAP_TYPE_SOCKHASH = 0x12 + BPF_MAP_TYPE_CGROUP_STORAGE_DEPRECATED = 0x13 BPF_MAP_TYPE_CGROUP_STORAGE = 0x13 BPF_MAP_TYPE_REUSEPORT_SOCKARRAY = 0x14 BPF_MAP_TYPE_PERCPU_CGROUP_STORAGE = 0x15 @@ -2539,6 +2631,10 @@ const ( BPF_MAP_TYPE_STRUCT_OPS = 0x1a BPF_MAP_TYPE_RINGBUF = 0x1b BPF_MAP_TYPE_INODE_STORAGE = 0x1c + BPF_MAP_TYPE_TASK_STORAGE = 0x1d + BPF_MAP_TYPE_BLOOM_FILTER = 0x1e + BPF_MAP_TYPE_USER_RINGBUF = 0x1f + BPF_MAP_TYPE_CGRP_STORAGE = 0x20 BPF_PROG_TYPE_UNSPEC = 0x0 BPF_PROG_TYPE_SOCKET_FILTER = 0x1 BPF_PROG_TYPE_KPROBE = 0x2 @@ -2570,6 +2666,7 @@ const ( BPF_PROG_TYPE_EXT = 0x1c BPF_PROG_TYPE_LSM = 0x1d BPF_PROG_TYPE_SK_LOOKUP = 0x1e + BPF_PROG_TYPE_SYSCALL = 0x1f BPF_CGROUP_INET_INGRESS = 0x0 BPF_CGROUP_INET_EGRESS = 0x1 BPF_CGROUP_INET_SOCK_CREATE = 0x2 @@ -2608,6 +2705,12 @@ const ( BPF_XDP_CPUMAP = 0x23 BPF_SK_LOOKUP = 0x24 BPF_XDP = 0x25 + BPF_SK_SKB_VERDICT = 0x26 + BPF_SK_REUSEPORT_SELECT = 0x27 + BPF_SK_REUSEPORT_SELECT_OR_MIGRATE = 0x28 + BPF_PERF_EVENT = 0x29 + BPF_TRACE_KPROBE_MULTI = 0x2a + BPF_LSM_CGROUP = 0x2b BPF_LINK_TYPE_UNSPEC = 0x0 BPF_LINK_TYPE_RAW_TRACEPOINT = 0x1 BPF_LINK_TYPE_TRACING = 0x2 @@ -2615,6 +2718,9 @@ const ( BPF_LINK_TYPE_ITER = 0x4 BPF_LINK_TYPE_NETNS = 0x5 BPF_LINK_TYPE_XDP = 0x6 + BPF_LINK_TYPE_PERF_EVENT = 0x7 + BPF_LINK_TYPE_KPROBE_MULTI = 0x8 + BPF_LINK_TYPE_STRUCT_OPS = 0x9 BPF_ANY = 0x0 BPF_NOEXIST = 0x1 BPF_EXIST = 0x2 @@ -2652,6 +2758,7 @@ const ( BPF_F_ZERO_CSUM_TX = 0x2 BPF_F_DONT_FRAGMENT = 0x4 BPF_F_SEQ_NUMBER = 0x8 + BPF_F_TUNINFO_FLAGS = 0x10 BPF_F_INDEX_MASK = 0xffffffff BPF_F_CURRENT_CPU = 0xffffffff BPF_F_CTXLEN_MASK = 0xfffff00000000 @@ -2666,6 +2773,7 @@ const ( BPF_F_ADJ_ROOM_ENCAP_L4_GRE = 0x8 BPF_F_ADJ_ROOM_ENCAP_L4_UDP = 0x10 BPF_F_ADJ_ROOM_NO_CSUM_RESET = 0x20 + BPF_F_ADJ_ROOM_ENCAP_L2_ETH = 0x40 BPF_ADJ_ROOM_ENCAP_L2_MASK = 0xff BPF_ADJ_ROOM_ENCAP_L2_SHIFT = 0x38 BPF_F_SYSCTL_BASE_NAME = 0x1 @@ -2690,10 +2798,16 @@ const ( BPF_LWT_ENCAP_SEG6 = 0x0 BPF_LWT_ENCAP_SEG6_INLINE = 0x1 BPF_LWT_ENCAP_IP = 0x2 + BPF_F_BPRM_SECUREEXEC = 0x1 + BPF_F_BROADCAST = 0x8 + BPF_F_EXCLUDE_INGRESS = 0x10 + BPF_SKB_TSTAMP_UNSPEC = 0x0 + BPF_SKB_TSTAMP_DELIVERY_MONO = 0x1 BPF_OK = 0x0 BPF_DROP = 0x2 BPF_REDIRECT = 0x7 BPF_LWT_REROUTE = 0x80 + BPF_FLOW_DISSECTOR_CONTINUE = 0x81 BPF_SOCK_OPS_RTO_CB_FLAG = 0x1 BPF_SOCK_OPS_RETRANS_CB_FLAG = 0x2 BPF_SOCK_OPS_STATE_CB_FLAG = 0x4 @@ -2757,6 +2871,10 @@ const ( BPF_FIB_LKUP_RET_UNSUPP_LWT = 0x6 BPF_FIB_LKUP_RET_NO_NEIGH = 0x7 BPF_FIB_LKUP_RET_FRAG_NEEDED = 0x8 + BPF_MTU_CHK_SEGS = 0x1 + BPF_MTU_CHK_RET_SUCCESS = 0x0 + BPF_MTU_CHK_RET_FRAG_NEEDED = 0x1 + BPF_MTU_CHK_RET_SEGS_TOOBIG = 0x2 BPF_FD_TYPE_RAW_TRACEPOINT = 0x0 BPF_FD_TYPE_TRACEPOINT = 0x1 BPF_FD_TYPE_KPROBE = 0x2 @@ -2766,6 +2884,19 @@ const ( BPF_FLOW_DISSECTOR_F_PARSE_1ST_FRAG = 0x1 BPF_FLOW_DISSECTOR_F_STOP_AT_FLOW_LABEL = 0x2 BPF_FLOW_DISSECTOR_F_STOP_AT_ENCAP = 0x4 + BPF_CORE_FIELD_BYTE_OFFSET = 0x0 + BPF_CORE_FIELD_BYTE_SIZE = 0x1 + BPF_CORE_FIELD_EXISTS = 0x2 + BPF_CORE_FIELD_SIGNED = 0x3 + BPF_CORE_FIELD_LSHIFT_U64 = 0x4 + BPF_CORE_FIELD_RSHIFT_U64 = 0x5 + BPF_CORE_TYPE_ID_LOCAL = 0x6 + BPF_CORE_TYPE_ID_TARGET = 0x7 + BPF_CORE_TYPE_EXISTS = 0x8 + BPF_CORE_TYPE_SIZE = 0x9 + BPF_CORE_ENUMVAL_EXISTS = 0xa + BPF_CORE_ENUMVAL_VALUE = 0xb + BPF_CORE_TYPE_MATCHES = 0xc ) const ( @@ -2971,7 +3102,16 @@ const ( DEVLINK_CMD_TRAP_POLICER_NEW = 0x47 DEVLINK_CMD_TRAP_POLICER_DEL = 0x48 DEVLINK_CMD_HEALTH_REPORTER_TEST = 0x49 - DEVLINK_CMD_MAX = 0x51 + DEVLINK_CMD_RATE_GET = 0x4a + DEVLINK_CMD_RATE_SET = 0x4b + DEVLINK_CMD_RATE_NEW = 0x4c + DEVLINK_CMD_RATE_DEL = 0x4d + DEVLINK_CMD_LINECARD_GET = 0x4e + DEVLINK_CMD_LINECARD_SET = 0x4f + DEVLINK_CMD_LINECARD_NEW = 0x50 + DEVLINK_CMD_LINECARD_DEL = 0x51 + DEVLINK_CMD_SELFTESTS_GET = 0x52 + DEVLINK_CMD_MAX = 0x53 DEVLINK_PORT_TYPE_NOTSET = 0x0 DEVLINK_PORT_TYPE_AUTO = 0x1 DEVLINK_PORT_TYPE_ETH = 0x2 @@ -3200,7 +3340,13 @@ const ( DEVLINK_ATTR_RATE_NODE_NAME = 0xa8 DEVLINK_ATTR_RATE_PARENT_NODE_NAME = 0xa9 DEVLINK_ATTR_REGION_MAX_SNAPSHOTS = 0xaa - DEVLINK_ATTR_MAX = 0xae + DEVLINK_ATTR_LINECARD_INDEX = 0xab + DEVLINK_ATTR_LINECARD_STATE = 0xac + DEVLINK_ATTR_LINECARD_TYPE = 0xad + DEVLINK_ATTR_LINECARD_SUPPORTED_TYPES = 0xae + DEVLINK_ATTR_NESTED_DEVLINK = 0xaf + DEVLINK_ATTR_SELFTESTS = 0xb0 + DEVLINK_ATTR_MAX = 0xb3 DEVLINK_DPIPE_FIELD_MAPPING_TYPE_NONE = 0x0 DEVLINK_DPIPE_FIELD_MAPPING_TYPE_IFINDEX = 0x1 DEVLINK_DPIPE_MATCH_TYPE_FIELD_EXACT = 0x0 @@ -3216,7 +3362,8 @@ const ( DEVLINK_PORT_FUNCTION_ATTR_HW_ADDR = 0x1 DEVLINK_PORT_FN_ATTR_STATE = 0x2 DEVLINK_PORT_FN_ATTR_OPSTATE = 0x3 - DEVLINK_PORT_FUNCTION_ATTR_MAX = 0x3 + DEVLINK_PORT_FN_ATTR_CAPS = 0x4 + DEVLINK_PORT_FUNCTION_ATTR_MAX = 0x4 ) type FsverityDigest struct { @@ -3309,7 +3456,8 @@ const ( LWTUNNEL_ENCAP_SEG6_LOCAL = 0x7 LWTUNNEL_ENCAP_RPL = 0x8 LWTUNNEL_ENCAP_IOAM6 = 0x9 - LWTUNNEL_ENCAP_MAX = 0x9 + LWTUNNEL_ENCAP_XFRM = 0xa + LWTUNNEL_ENCAP_MAX = 0xa MPLS_IPTUNNEL_UNSPEC = 0x0 MPLS_IPTUNNEL_DST = 0x1 @@ -3504,7 +3652,10 @@ const ( ETHTOOL_MSG_PHC_VCLOCKS_GET = 0x21 ETHTOOL_MSG_MODULE_GET = 0x22 ETHTOOL_MSG_MODULE_SET = 0x23 - ETHTOOL_MSG_USER_MAX = 0x23 + ETHTOOL_MSG_PSE_GET = 0x24 + ETHTOOL_MSG_PSE_SET = 0x25 + ETHTOOL_MSG_RSS_GET = 0x26 + ETHTOOL_MSG_USER_MAX = 0x2b ETHTOOL_MSG_KERNEL_NONE = 0x0 ETHTOOL_MSG_STRSET_GET_REPLY = 0x1 ETHTOOL_MSG_LINKINFO_GET_REPLY = 0x2 @@ -3542,7 +3693,9 @@ const ( ETHTOOL_MSG_PHC_VCLOCKS_GET_REPLY = 0x22 ETHTOOL_MSG_MODULE_GET_REPLY = 0x23 ETHTOOL_MSG_MODULE_NTF = 0x24 - ETHTOOL_MSG_KERNEL_MAX = 0x24 + ETHTOOL_MSG_PSE_GET_REPLY = 0x25 + ETHTOOL_MSG_RSS_GET_REPLY = 0x26 + ETHTOOL_MSG_KERNEL_MAX = 0x2b ETHTOOL_A_HEADER_UNSPEC = 0x0 ETHTOOL_A_HEADER_DEV_INDEX = 0x1 ETHTOOL_A_HEADER_DEV_NAME = 0x2 @@ -3601,7 +3754,8 @@ const ( ETHTOOL_A_LINKMODES_MASTER_SLAVE_CFG = 0x7 ETHTOOL_A_LINKMODES_MASTER_SLAVE_STATE = 0x8 ETHTOOL_A_LINKMODES_LANES = 0x9 - ETHTOOL_A_LINKMODES_MAX = 0x9 + ETHTOOL_A_LINKMODES_RATE_MATCHING = 0xa + ETHTOOL_A_LINKMODES_MAX = 0xa ETHTOOL_A_LINKSTATE_UNSPEC = 0x0 ETHTOOL_A_LINKSTATE_HEADER = 0x1 ETHTOOL_A_LINKSTATE_LINK = 0x2 @@ -3609,7 +3763,8 @@ const ( ETHTOOL_A_LINKSTATE_SQI_MAX = 0x4 ETHTOOL_A_LINKSTATE_EXT_STATE = 0x5 ETHTOOL_A_LINKSTATE_EXT_SUBSTATE = 0x6 - ETHTOOL_A_LINKSTATE_MAX = 0x6 + ETHTOOL_A_LINKSTATE_EXT_DOWN_CNT = 0x7 + ETHTOOL_A_LINKSTATE_MAX = 0x7 ETHTOOL_A_DEBUG_UNSPEC = 0x0 ETHTOOL_A_DEBUG_HEADER = 0x1 ETHTOOL_A_DEBUG_MSGMASK = 0x2 @@ -3644,7 +3799,7 @@ const ( ETHTOOL_A_RINGS_TCP_DATA_SPLIT = 0xb ETHTOOL_A_RINGS_CQE_SIZE = 0xc ETHTOOL_A_RINGS_TX_PUSH = 0xd - ETHTOOL_A_RINGS_MAX = 0xd + ETHTOOL_A_RINGS_MAX = 0x10 ETHTOOL_A_CHANNELS_UNSPEC = 0x0 ETHTOOL_A_CHANNELS_HEADER = 0x1 ETHTOOL_A_CHANNELS_RX_MAX = 0x2 @@ -3682,14 +3837,14 @@ const ( ETHTOOL_A_COALESCE_RATE_SAMPLE_INTERVAL = 0x17 ETHTOOL_A_COALESCE_USE_CQE_MODE_TX = 0x18 ETHTOOL_A_COALESCE_USE_CQE_MODE_RX = 0x19 - ETHTOOL_A_COALESCE_MAX = 0x19 + ETHTOOL_A_COALESCE_MAX = 0x1c ETHTOOL_A_PAUSE_UNSPEC = 0x0 ETHTOOL_A_PAUSE_HEADER = 0x1 ETHTOOL_A_PAUSE_AUTONEG = 0x2 ETHTOOL_A_PAUSE_RX = 0x3 ETHTOOL_A_PAUSE_TX = 0x4 ETHTOOL_A_PAUSE_STATS = 0x5 - ETHTOOL_A_PAUSE_MAX = 0x5 + ETHTOOL_A_PAUSE_MAX = 0x6 ETHTOOL_A_PAUSE_STAT_UNSPEC = 0x0 ETHTOOL_A_PAUSE_STAT_PAD = 0x1 ETHTOOL_A_PAUSE_STAT_TX_FRAMES = 0x2 @@ -4193,6 +4348,9 @@ const ( NL80211_ACL_POLICY_DENY_UNLESS_LISTED = 0x1 NL80211_AC_VI = 0x1 NL80211_AC_VO = 0x0 + NL80211_AP_SETTINGS_EXTERNAL_AUTH_SUPPORT = 0x1 + NL80211_AP_SETTINGS_SA_QUERY_OFFLOAD_SUPPORT = 0x2 + NL80211_AP_SME_SA_QUERY_OFFLOAD = 0x1 NL80211_ATTR_4ADDR = 0x53 NL80211_ATTR_ACK = 0x5c NL80211_ATTR_ACK_SIGNAL = 0x107 @@ -4201,6 +4359,7 @@ const ( NL80211_ATTR_AIRTIME_WEIGHT = 0x112 NL80211_ATTR_AKM_SUITES = 0x4c NL80211_ATTR_AP_ISOLATE = 0x60 + NL80211_ATTR_AP_SETTINGS_FLAGS = 0x135 NL80211_ATTR_AUTH_DATA = 0x9c NL80211_ATTR_AUTH_TYPE = 0x35 NL80211_ATTR_BANDS = 0xef @@ -4232,6 +4391,9 @@ const ( NL80211_ATTR_COALESCE_RULE_DELAY = 0x1 NL80211_ATTR_COALESCE_RULE_MAX = 0x3 NL80211_ATTR_COALESCE_RULE_PKT_PATTERN = 0x3 + NL80211_ATTR_COLOR_CHANGE_COLOR = 0x130 + NL80211_ATTR_COLOR_CHANGE_COUNT = 0x12f + NL80211_ATTR_COLOR_CHANGE_ELEMS = 0x131 NL80211_ATTR_CONN_FAILED_REASON = 0x9b NL80211_ATTR_CONTROL_PORT = 0x44 NL80211_ATTR_CONTROL_PORT_ETHERTYPE = 0x66 @@ -4258,6 +4420,7 @@ const ( NL80211_ATTR_DEVICE_AP_SME = 0x8d NL80211_ATTR_DFS_CAC_TIME = 0x7 NL80211_ATTR_DFS_REGION = 0x92 + NL80211_ATTR_DISABLE_EHT = 0x137 NL80211_ATTR_DISABLE_HE = 0x12d NL80211_ATTR_DISABLE_HT = 0x93 NL80211_ATTR_DISABLE_VHT = 0xaf @@ -4265,6 +4428,8 @@ const ( NL80211_ATTR_DONT_WAIT_FOR_ACK = 0x8e NL80211_ATTR_DTIM_PERIOD = 0xd NL80211_ATTR_DURATION = 0x57 + NL80211_ATTR_EHT_CAPABILITY = 0x136 + NL80211_ATTR_EML_CAPABILITY = 0x13d NL80211_ATTR_EXT_CAPA = 0xa9 NL80211_ATTR_EXT_CAPA_MASK = 0xaa NL80211_ATTR_EXTERNAL_AUTH_ACTION = 0x104 @@ -4329,10 +4494,11 @@ const ( NL80211_ATTR_MAC_HINT = 0xc8 NL80211_ATTR_MAC_MASK = 0xd7 NL80211_ATTR_MAX_AP_ASSOC_STA = 0xca - NL80211_ATTR_MAX = 0x137 + NL80211_ATTR_MAX = 0x145 NL80211_ATTR_MAX_CRIT_PROT_DURATION = 0xb4 NL80211_ATTR_MAX_CSA_COUNTERS = 0xce NL80211_ATTR_MAX_MATCH_SETS = 0x85 + NL80211_ATTR_MAX_NUM_AKM_SUITES = 0x13c NL80211_ATTR_MAX_NUM_PMKIDS = 0x56 NL80211_ATTR_MAX_NUM_SCAN_SSIDS = 0x2b NL80211_ATTR_MAX_NUM_SCHED_SCAN_PLANS = 0xde @@ -4342,6 +4508,8 @@ const ( NL80211_ATTR_MAX_SCAN_PLAN_INTERVAL = 0xdf NL80211_ATTR_MAX_SCAN_PLAN_ITERATIONS = 0xe0 NL80211_ATTR_MAX_SCHED_SCAN_IE_LEN = 0x7c + NL80211_ATTR_MBSSID_CONFIG = 0x132 + NL80211_ATTR_MBSSID_ELEMS = 0x133 NL80211_ATTR_MCAST_RATE = 0x6b NL80211_ATTR_MDID = 0xb1 NL80211_ATTR_MEASUREMENT_DURATION = 0xeb @@ -4351,6 +4519,11 @@ const ( NL80211_ATTR_MESH_PEER_AID = 0xed NL80211_ATTR_MESH_SETUP = 0x70 NL80211_ATTR_MGMT_SUBTYPE = 0x29 + NL80211_ATTR_MLD_ADDR = 0x13a + NL80211_ATTR_MLD_CAPA_AND_OPS = 0x13e + NL80211_ATTR_MLO_LINK_ID = 0x139 + NL80211_ATTR_MLO_LINKS = 0x138 + NL80211_ATTR_MLO_SUPPORT = 0x13b NL80211_ATTR_MNTR_FLAGS = 0x17 NL80211_ATTR_MPATH_INFO = 0x1b NL80211_ATTR_MPATH_NEXT_HOP = 0x1a @@ -4363,6 +4536,7 @@ const ( NL80211_ATTR_NETNS_FD = 0xdb NL80211_ATTR_NOACK_MAP = 0x95 NL80211_ATTR_NSS = 0x106 + NL80211_ATTR_OBSS_COLOR_BITMAP = 0x12e NL80211_ATTR_OFFCHANNEL_TX_OK = 0x6c NL80211_ATTR_OPER_CLASS = 0xd6 NL80211_ATTR_OPMODE_NOTIF = 0xc2 @@ -4389,6 +4563,7 @@ const ( NL80211_ATTR_PROTOCOL_FEATURES = 0xad NL80211_ATTR_PS_STATE = 0x5d NL80211_ATTR_QOS_MAP = 0xc7 + NL80211_ATTR_RADAR_BACKGROUND = 0x134 NL80211_ATTR_RADAR_EVENT = 0xa8 NL80211_ATTR_REASON_CODE = 0x36 NL80211_ATTR_RECEIVE_MULTICAST = 0x121 @@ -4404,6 +4579,7 @@ const ( NL80211_ATTR_RESP_IE = 0x4e NL80211_ATTR_ROAM_SUPPORT = 0x83 NL80211_ATTR_RX_FRAME_TYPES = 0x64 + NL80211_ATTR_RX_HW_TIMESTAMP = 0x140 NL80211_ATTR_RXMGMT_FLAGS = 0xbc NL80211_ATTR_RX_SIGNAL_DBM = 0x97 NL80211_ATTR_S1G_CAPABILITY = 0x128 @@ -4461,6 +4637,7 @@ const ( NL80211_ATTR_SUPPORT_MESH_AUTH = 0x73 NL80211_ATTR_SURVEY_INFO = 0x54 NL80211_ATTR_SURVEY_RADIO_STATS = 0xda + NL80211_ATTR_TD_BITMAP = 0x141 NL80211_ATTR_TDLS_ACTION = 0x88 NL80211_ATTR_TDLS_DIALOG_TOKEN = 0x89 NL80211_ATTR_TDLS_EXTERNAL_SETUP = 0x8c @@ -4476,6 +4653,7 @@ const ( NL80211_ATTR_TSID = 0xd2 NL80211_ATTR_TWT_RESPONDER = 0x116 NL80211_ATTR_TX_FRAME_TYPES = 0x63 + NL80211_ATTR_TX_HW_TIMESTAMP = 0x13f NL80211_ATTR_TX_NO_CCK_RATE = 0x87 NL80211_ATTR_TXQ_LIMIT = 0x10a NL80211_ATTR_TXQ_MEMORY_LIMIT = 0x10b @@ -4545,10 +4723,14 @@ const ( NL80211_BAND_ATTR_HT_CAPA = 0x4 NL80211_BAND_ATTR_HT_MCS_SET = 0x3 NL80211_BAND_ATTR_IFTYPE_DATA = 0x9 - NL80211_BAND_ATTR_MAX = 0xb + NL80211_BAND_ATTR_MAX = 0xd NL80211_BAND_ATTR_RATES = 0x2 NL80211_BAND_ATTR_VHT_CAPA = 0x8 NL80211_BAND_ATTR_VHT_MCS_SET = 0x7 + NL80211_BAND_IFTYPE_ATTR_EHT_CAP_MAC = 0x8 + NL80211_BAND_IFTYPE_ATTR_EHT_CAP_MCS_SET = 0xa + NL80211_BAND_IFTYPE_ATTR_EHT_CAP_PHY = 0x9 + NL80211_BAND_IFTYPE_ATTR_EHT_CAP_PPE = 0xb NL80211_BAND_IFTYPE_ATTR_HE_6GHZ_CAPA = 0x6 NL80211_BAND_IFTYPE_ATTR_HE_CAP_MAC = 0x2 NL80211_BAND_IFTYPE_ATTR_HE_CAP_MCS_SET = 0x4 @@ -4556,6 +4738,8 @@ const ( NL80211_BAND_IFTYPE_ATTR_HE_CAP_PPE = 0x5 NL80211_BAND_IFTYPE_ATTR_IFTYPES = 0x1 NL80211_BAND_IFTYPE_ATTR_MAX = 0xb + NL80211_BAND_IFTYPE_ATTR_VENDOR_ELEMS = 0x7 + NL80211_BAND_LC = 0x5 NL80211_BAND_S1GHZ = 0x4 NL80211_BITRATE_ATTR_2GHZ_SHORTPREAMBLE = 0x2 NL80211_BITRATE_ATTR_MAX = 0x2 @@ -4576,7 +4760,9 @@ const ( NL80211_BSS_FREQUENCY_OFFSET = 0x14 NL80211_BSS_INFORMATION_ELEMENTS = 0x6 NL80211_BSS_LAST_SEEN_BOOTTIME = 0xf - NL80211_BSS_MAX = 0x14 + NL80211_BSS_MAX = 0x16 + NL80211_BSS_MLD_ADDR = 0x16 + NL80211_BSS_MLO_LINK_ID = 0x15 NL80211_BSS_PAD = 0x10 NL80211_BSS_PARENT_BSSID = 0x12 NL80211_BSS_PARENT_TSF = 0x11 @@ -4604,6 +4790,7 @@ const ( NL80211_CHAN_WIDTH_20 = 0x1 NL80211_CHAN_WIDTH_20_NOHT = 0x0 NL80211_CHAN_WIDTH_2 = 0x9 + NL80211_CHAN_WIDTH_320 = 0xd NL80211_CHAN_WIDTH_40 = 0x2 NL80211_CHAN_WIDTH_4 = 0xa NL80211_CHAN_WIDTH_5 = 0x6 @@ -4613,8 +4800,11 @@ const ( NL80211_CMD_ABORT_SCAN = 0x72 NL80211_CMD_ACTION = 0x3b NL80211_CMD_ACTION_TX_STATUS = 0x3c + NL80211_CMD_ADD_LINK = 0x94 + NL80211_CMD_ADD_LINK_STA = 0x96 NL80211_CMD_ADD_NAN_FUNCTION = 0x75 NL80211_CMD_ADD_TX_TS = 0x69 + NL80211_CMD_ASSOC_COMEBACK = 0x93 NL80211_CMD_ASSOCIATE = 0x26 NL80211_CMD_AUTHENTICATE = 0x25 NL80211_CMD_CANCEL_REMAIN_ON_CHANNEL = 0x38 @@ -4622,6 +4812,10 @@ const ( NL80211_CMD_CHANNEL_SWITCH = 0x66 NL80211_CMD_CH_SWITCH_NOTIFY = 0x58 NL80211_CMD_CH_SWITCH_STARTED_NOTIFY = 0x6e + NL80211_CMD_COLOR_CHANGE_ABORTED = 0x90 + NL80211_CMD_COLOR_CHANGE_COMPLETED = 0x91 + NL80211_CMD_COLOR_CHANGE_REQUEST = 0x8e + NL80211_CMD_COLOR_CHANGE_STARTED = 0x8f NL80211_CMD_CONNECT = 0x2e NL80211_CMD_CONN_FAILED = 0x5b NL80211_CMD_CONTROL_PORT_FRAME = 0x81 @@ -4670,8 +4864,9 @@ const ( NL80211_CMD_LEAVE_IBSS = 0x2c NL80211_CMD_LEAVE_MESH = 0x45 NL80211_CMD_LEAVE_OCB = 0x6d - NL80211_CMD_MAX = 0x93 + NL80211_CMD_MAX = 0x99 NL80211_CMD_MICHAEL_MIC_FAILURE = 0x29 + NL80211_CMD_MODIFY_LINK_STA = 0x97 NL80211_CMD_NAN_MATCH = 0x78 NL80211_CMD_NEW_BEACON = 0xf NL80211_CMD_NEW_INTERFACE = 0x7 @@ -4684,6 +4879,7 @@ const ( NL80211_CMD_NEW_WIPHY = 0x3 NL80211_CMD_NOTIFY_CQM = 0x40 NL80211_CMD_NOTIFY_RADAR = 0x86 + NL80211_CMD_OBSS_COLOR_COLLISION = 0x8d NL80211_CMD_PEER_MEASUREMENT_COMPLETE = 0x85 NL80211_CMD_PEER_MEASUREMENT_RESULT = 0x84 NL80211_CMD_PEER_MEASUREMENT_START = 0x83 @@ -4699,6 +4895,8 @@ const ( NL80211_CMD_REGISTER_FRAME = 0x3a NL80211_CMD_RELOAD_REGDB = 0x7e NL80211_CMD_REMAIN_ON_CHANNEL = 0x37 + NL80211_CMD_REMOVE_LINK = 0x95 + NL80211_CMD_REMOVE_LINK_STA = 0x98 NL80211_CMD_REQ_SET_REG = 0x1b NL80211_CMD_ROAM = 0x2f NL80211_CMD_SCAN_ABORTED = 0x23 @@ -4709,6 +4907,7 @@ const ( NL80211_CMD_SET_CHANNEL = 0x41 NL80211_CMD_SET_COALESCE = 0x65 NL80211_CMD_SET_CQM = 0x3f + NL80211_CMD_SET_FILS_AAD = 0x92 NL80211_CMD_SET_INTERFACE = 0x6 NL80211_CMD_SET_KEY = 0xa NL80211_CMD_SET_MAC_ACL = 0x5d @@ -4783,6 +4982,8 @@ const ( NL80211_EDMG_BW_CONFIG_MIN = 0x4 NL80211_EDMG_CHANNELS_MAX = 0x3c NL80211_EDMG_CHANNELS_MIN = 0x1 + NL80211_EHT_MAX_CAPABILITY_LEN = 0x33 + NL80211_EHT_MIN_CAPABILITY_LEN = 0xd NL80211_EXTERNAL_AUTH_ABORT = 0x1 NL80211_EXTERNAL_AUTH_START = 0x0 NL80211_EXT_FEATURE_4WAY_HANDSHAKE_AP_PSK = 0x32 @@ -4799,6 +5000,7 @@ const ( NL80211_EXT_FEATURE_BEACON_RATE_HT = 0x7 NL80211_EXT_FEATURE_BEACON_RATE_LEGACY = 0x6 NL80211_EXT_FEATURE_BEACON_RATE_VHT = 0x8 + NL80211_EXT_FEATURE_BSS_COLOR = 0x3a NL80211_EXT_FEATURE_BSS_PARENT_TSF = 0x4 NL80211_EXT_FEATURE_CAN_REPLACE_PTK0 = 0x1f NL80211_EXT_FEATURE_CONTROL_PORT_NO_PREAUTH = 0x2a @@ -4810,6 +5012,7 @@ const ( NL80211_EXT_FEATURE_DFS_OFFLOAD = 0x19 NL80211_EXT_FEATURE_ENABLE_FTM_RESPONDER = 0x20 NL80211_EXT_FEATURE_EXT_KEY_ID = 0x24 + NL80211_EXT_FEATURE_FILS_CRYPTO_OFFLOAD = 0x3b NL80211_EXT_FEATURE_FILS_DISCOVERY = 0x34 NL80211_EXT_FEATURE_FILS_MAX_CHANNEL_TIME = 0x11 NL80211_EXT_FEATURE_FILS_SK_OFFLOAD = 0xe @@ -4825,8 +5028,10 @@ const ( NL80211_EXT_FEATURE_OCE_PROBE_REQ_DEFERRAL_SUPPRESSION = 0x14 NL80211_EXT_FEATURE_OCE_PROBE_REQ_HIGH_TX_RATE = 0x13 NL80211_EXT_FEATURE_OPERATING_CHANNEL_VALIDATION = 0x31 + NL80211_EXT_FEATURE_POWERED_ADDR_CHANGE = 0x3d NL80211_EXT_FEATURE_PROTECTED_TWT = 0x2b NL80211_EXT_FEATURE_PROT_RANGE_NEGO_AND_MEASURE = 0x39 + NL80211_EXT_FEATURE_RADAR_BACKGROUND = 0x3c NL80211_EXT_FEATURE_RRM = 0x1 NL80211_EXT_FEATURE_SAE_OFFLOAD_AP = 0x33 NL80211_EXT_FEATURE_SAE_OFFLOAD = 0x26 @@ -4898,7 +5103,9 @@ const ( NL80211_FREQUENCY_ATTR_NO_10MHZ = 0x11 NL80211_FREQUENCY_ATTR_NO_160MHZ = 0xc NL80211_FREQUENCY_ATTR_NO_20MHZ = 0x10 + NL80211_FREQUENCY_ATTR_NO_320MHZ = 0x1a NL80211_FREQUENCY_ATTR_NO_80MHZ = 0xb + NL80211_FREQUENCY_ATTR_NO_EHT = 0x1b NL80211_FREQUENCY_ATTR_NO_HE = 0x13 NL80211_FREQUENCY_ATTR_NO_HT40_MINUS = 0x9 NL80211_FREQUENCY_ATTR_NO_HT40_PLUS = 0xa @@ -4998,6 +5205,12 @@ const ( NL80211_MAX_SUPP_HT_RATES = 0x4d NL80211_MAX_SUPP_RATES = 0x20 NL80211_MAX_SUPP_REG_RULES = 0x80 + NL80211_MBSSID_CONFIG_ATTR_EMA = 0x5 + NL80211_MBSSID_CONFIG_ATTR_INDEX = 0x3 + NL80211_MBSSID_CONFIG_ATTR_MAX = 0x5 + NL80211_MBSSID_CONFIG_ATTR_MAX_EMA_PROFILE_PERIODICITY = 0x2 + NL80211_MBSSID_CONFIG_ATTR_MAX_INTERFACES = 0x1 + NL80211_MBSSID_CONFIG_ATTR_TX_IFINDEX = 0x4 NL80211_MESHCONF_ATTR_MAX = 0x1f NL80211_MESHCONF_AUTO_OPEN_PLINKS = 0x7 NL80211_MESHCONF_AWAKE_WINDOW = 0x1b @@ -5160,6 +5373,7 @@ const ( NL80211_PMSR_FTM_FAILURE_UNSPECIFIED = 0x0 NL80211_PMSR_FTM_FAILURE_WRONG_CHANNEL = 0x3 NL80211_PMSR_FTM_REQ_ATTR_ASAP = 0x1 + NL80211_PMSR_FTM_REQ_ATTR_BSS_COLOR = 0xd NL80211_PMSR_FTM_REQ_ATTR_BURST_DURATION = 0x5 NL80211_PMSR_FTM_REQ_ATTR_BURST_PERIOD = 0x4 NL80211_PMSR_FTM_REQ_ATTR_FTMS_PER_BURST = 0x6 @@ -5236,12 +5450,36 @@ const ( NL80211_RADAR_PRE_CAC_EXPIRED = 0x4 NL80211_RATE_INFO_10_MHZ_WIDTH = 0xb NL80211_RATE_INFO_160_MHZ_WIDTH = 0xa + NL80211_RATE_INFO_320_MHZ_WIDTH = 0x12 NL80211_RATE_INFO_40_MHZ_WIDTH = 0x3 NL80211_RATE_INFO_5_MHZ_WIDTH = 0xc NL80211_RATE_INFO_80_MHZ_WIDTH = 0x8 NL80211_RATE_INFO_80P80_MHZ_WIDTH = 0x9 NL80211_RATE_INFO_BITRATE32 = 0x5 NL80211_RATE_INFO_BITRATE = 0x1 + NL80211_RATE_INFO_EHT_GI_0_8 = 0x0 + NL80211_RATE_INFO_EHT_GI_1_6 = 0x1 + NL80211_RATE_INFO_EHT_GI_3_2 = 0x2 + NL80211_RATE_INFO_EHT_GI = 0x15 + NL80211_RATE_INFO_EHT_MCS = 0x13 + NL80211_RATE_INFO_EHT_NSS = 0x14 + NL80211_RATE_INFO_EHT_RU_ALLOC_106 = 0x3 + NL80211_RATE_INFO_EHT_RU_ALLOC_106P26 = 0x4 + NL80211_RATE_INFO_EHT_RU_ALLOC_242 = 0x5 + NL80211_RATE_INFO_EHT_RU_ALLOC_26 = 0x0 + NL80211_RATE_INFO_EHT_RU_ALLOC_2x996 = 0xb + NL80211_RATE_INFO_EHT_RU_ALLOC_2x996P484 = 0xc + NL80211_RATE_INFO_EHT_RU_ALLOC_3x996 = 0xd + NL80211_RATE_INFO_EHT_RU_ALLOC_3x996P484 = 0xe + NL80211_RATE_INFO_EHT_RU_ALLOC_484 = 0x6 + NL80211_RATE_INFO_EHT_RU_ALLOC_484P242 = 0x7 + NL80211_RATE_INFO_EHT_RU_ALLOC_4x996 = 0xf + NL80211_RATE_INFO_EHT_RU_ALLOC_52 = 0x1 + NL80211_RATE_INFO_EHT_RU_ALLOC_52P26 = 0x2 + NL80211_RATE_INFO_EHT_RU_ALLOC_996 = 0x8 + NL80211_RATE_INFO_EHT_RU_ALLOC_996P484 = 0x9 + NL80211_RATE_INFO_EHT_RU_ALLOC_996P484P242 = 0xa + NL80211_RATE_INFO_EHT_RU_ALLOC = 0x16 NL80211_RATE_INFO_HE_1XLTF = 0x0 NL80211_RATE_INFO_HE_2XLTF = 0x1 NL80211_RATE_INFO_HE_4XLTF = 0x2 @@ -5284,6 +5522,7 @@ const ( NL80211_RRF_GO_CONCURRENT = 0x1000 NL80211_RRF_IR_CONCURRENT = 0x1000 NL80211_RRF_NO_160MHZ = 0x10000 + NL80211_RRF_NO_320MHZ = 0x40000 NL80211_RRF_NO_80MHZ = 0x8000 NL80211_RRF_NO_CCK = 0x2 NL80211_RRF_NO_HE = 0x20000 @@ -5599,3 +5838,28 @@ const ( AUDIT_NLGRP_NONE = 0x0 AUDIT_NLGRP_READLOG = 0x1 ) + +const ( + TUN_F_CSUM = 0x1 + TUN_F_TSO4 = 0x2 + TUN_F_TSO6 = 0x4 + TUN_F_TSO_ECN = 0x8 + TUN_F_UFO = 0x10 + TUN_F_USO4 = 0x20 + TUN_F_USO6 = 0x40 +) + +const ( + VIRTIO_NET_HDR_F_NEEDS_CSUM = 0x1 + VIRTIO_NET_HDR_F_DATA_VALID = 0x2 + VIRTIO_NET_HDR_F_RSC_INFO = 0x4 +) + +const ( + VIRTIO_NET_HDR_GSO_NONE = 0x0 + VIRTIO_NET_HDR_GSO_TCPV4 = 0x1 + VIRTIO_NET_HDR_GSO_UDP = 0x3 + VIRTIO_NET_HDR_GSO_TCPV6 = 0x4 + VIRTIO_NET_HDR_GSO_UDP_L4 = 0x5 + VIRTIO_NET_HDR_GSO_ECN = 0x80 +) diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go b/vendor/golang.org/x/sys/unix/ztypes_linux_386.go index 7551af4..6d8acbc 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_386.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include -m32 linux/types.go | go run mkpost.go +// cgo -godefs -objdir=/tmp/386/cgo -- -Wall -Werror -static -I/tmp/386/include -m32 linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && linux @@ -254,6 +254,12 @@ type Sigset_t struct { const _C__NSIG = 0x41 +const ( + SIG_BLOCK = 0x0 + SIG_UNBLOCK = 0x1 + SIG_SETMASK = 0x2 +) + type Siginfo struct { Signo int32 Errno int32 @@ -331,6 +337,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 @@ -408,7 +416,7 @@ const ( type SockaddrStorage struct { Family uint16 - _ [122]int8 + Data [122]byte _ uint32 } diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go index 3e738ac..59293c6 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include -m64 linux/types.go | go run mkpost.go +// cgo -godefs -objdir=/tmp/amd64/cgo -- -Wall -Werror -static -I/tmp/amd64/include -m64 linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && linux @@ -269,6 +269,12 @@ type Sigset_t struct { const _C__NSIG = 0x41 +const ( + SIG_BLOCK = 0x0 + SIG_UNBLOCK = 0x1 + SIG_SETMASK = 0x2 +) + type Siginfo struct { Signo int32 Errno int32 @@ -344,6 +350,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 @@ -421,7 +429,7 @@ const ( type SockaddrStorage struct { Family uint16 - _ [118]int8 + Data [118]byte _ uint64 } diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go b/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go index 6183eef..40cfa38 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go +// cgo -godefs -objdir=/tmp/arm/cgo -- -Wall -Werror -static -I/tmp/arm/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && linux @@ -245,6 +245,12 @@ type Sigset_t struct { const _C__NSIG = 0x41 +const ( + SIG_BLOCK = 0x0 + SIG_UNBLOCK = 0x1 + SIG_SETMASK = 0x2 +) + type Siginfo struct { Signo int32 Errno int32 @@ -322,6 +328,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 @@ -399,7 +407,7 @@ const ( type SockaddrStorage struct { Family uint16 - _ [122]uint8 + Data [122]byte _ uint32 } diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go index 968cecb..055bc42 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include -fsigned-char linux/types.go | go run mkpost.go +// cgo -godefs -objdir=/tmp/arm64/cgo -- -Wall -Werror -static -I/tmp/arm64/include -fsigned-char linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && linux @@ -248,6 +248,12 @@ type Sigset_t struct { const _C__NSIG = 0x41 +const ( + SIG_BLOCK = 0x0 + SIG_UNBLOCK = 0x1 + SIG_SETMASK = 0x2 +) + type Siginfo struct { Signo int32 Errno int32 @@ -323,6 +329,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 @@ -400,7 +408,7 @@ const ( type SockaddrStorage struct { Family uint16 - _ [118]int8 + Data [118]byte _ uint64 } diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go index 8fe4c52..f28affb 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go +// cgo -godefs -objdir=/tmp/loong64/cgo -- -Wall -Werror -static -I/tmp/loong64/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build loong64 && linux @@ -249,6 +249,12 @@ type Sigset_t struct { const _C__NSIG = 0x41 +const ( + SIG_BLOCK = 0x0 + SIG_UNBLOCK = 0x1 + SIG_SETMASK = 0x2 +) + type Siginfo struct { Signo int32 Errno int32 @@ -324,6 +330,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 @@ -401,7 +409,7 @@ const ( type SockaddrStorage struct { Family uint16 - _ [118]int8 + Data [118]byte _ uint64 } diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go index 11426a3..9d71e7c 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go +// cgo -godefs -objdir=/tmp/mips/cgo -- -Wall -Werror -static -I/tmp/mips/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips && linux @@ -250,6 +250,12 @@ type Sigset_t struct { const _C__NSIG = 0x80 +const ( + SIG_BLOCK = 0x1 + SIG_UNBLOCK = 0x2 + SIG_SETMASK = 0x3 +) + type Siginfo struct { Signo int32 Code int32 @@ -327,6 +333,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 @@ -404,7 +412,7 @@ const ( type SockaddrStorage struct { Family uint16 - _ [122]int8 + Data [122]byte _ uint32 } diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go index ad1c3b3..fd5ccd3 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go +// cgo -godefs -objdir=/tmp/mips64/cgo -- -Wall -Werror -static -I/tmp/mips64/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64 && linux @@ -251,6 +251,12 @@ type Sigset_t struct { const _C__NSIG = 0x80 +const ( + SIG_BLOCK = 0x1 + SIG_UNBLOCK = 0x2 + SIG_SETMASK = 0x3 +) + type Siginfo struct { Signo int32 Code int32 @@ -326,6 +332,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 @@ -403,7 +411,7 @@ const ( type SockaddrStorage struct { Family uint16 - _ [118]int8 + Data [118]byte _ uint64 } diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go index 15fd84e..7704de7 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go +// cgo -godefs -objdir=/tmp/mips64le/cgo -- -Wall -Werror -static -I/tmp/mips64le/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64le && linux @@ -251,6 +251,12 @@ type Sigset_t struct { const _C__NSIG = 0x80 +const ( + SIG_BLOCK = 0x1 + SIG_UNBLOCK = 0x2 + SIG_SETMASK = 0x3 +) + type Siginfo struct { Signo int32 Code int32 @@ -326,6 +332,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 @@ -403,7 +411,7 @@ const ( type SockaddrStorage struct { Family uint16 - _ [118]int8 + Data [118]byte _ uint64 } diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go index 49c4982..df00b87 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go +// cgo -godefs -objdir=/tmp/mipsle/cgo -- -Wall -Werror -static -I/tmp/mipsle/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mipsle && linux @@ -250,6 +250,12 @@ type Sigset_t struct { const _C__NSIG = 0x80 +const ( + SIG_BLOCK = 0x1 + SIG_UNBLOCK = 0x2 + SIG_SETMASK = 0x3 +) + type Siginfo struct { Signo int32 Code int32 @@ -327,6 +333,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 @@ -404,7 +412,7 @@ const ( type SockaddrStorage struct { Family uint16 - _ [122]int8 + Data [122]byte _ uint32 } diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go index cd36d0d..0942840 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go +// cgo -godefs -objdir=/tmp/ppc/cgo -- -Wall -Werror -static -I/tmp/ppc/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc && linux @@ -257,6 +257,12 @@ type Sigset_t struct { const _C__NSIG = 0x41 +const ( + SIG_BLOCK = 0x0 + SIG_UNBLOCK = 0x1 + SIG_SETMASK = 0x2 +) + type Siginfo struct { Signo int32 Errno int32 @@ -334,6 +340,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 @@ -411,7 +419,7 @@ const ( type SockaddrStorage struct { Family uint16 - _ [122]uint8 + Data [122]byte _ uint32 } diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go index 8c6fce0..0348743 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go +// cgo -godefs -objdir=/tmp/ppc64/cgo -- -Wall -Werror -static -I/tmp/ppc64/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64 && linux @@ -258,6 +258,12 @@ type Sigset_t struct { const _C__NSIG = 0x41 +const ( + SIG_BLOCK = 0x0 + SIG_UNBLOCK = 0x1 + SIG_SETMASK = 0x2 +) + type Siginfo struct { Signo int32 Errno int32 @@ -333,6 +339,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 @@ -410,7 +418,7 @@ const ( type SockaddrStorage struct { Family uint16 - _ [118]uint8 + Data [118]byte _ uint64 } diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go index 20910f2..bad0670 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go +// cgo -godefs -objdir=/tmp/ppc64le/cgo -- -Wall -Werror -static -I/tmp/ppc64le/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64le && linux @@ -258,6 +258,12 @@ type Sigset_t struct { const _C__NSIG = 0x41 +const ( + SIG_BLOCK = 0x0 + SIG_UNBLOCK = 0x1 + SIG_SETMASK = 0x2 +) + type Siginfo struct { Signo int32 Errno int32 @@ -333,6 +339,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 @@ -410,7 +418,7 @@ const ( type SockaddrStorage struct { Family uint16 - _ [118]uint8 + Data [118]byte _ uint64 } diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go index 71b7b33..9ea54b7 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go +// cgo -godefs -objdir=/tmp/riscv64/cgo -- -Wall -Werror -static -I/tmp/riscv64/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && linux @@ -276,6 +276,12 @@ type Sigset_t struct { const _C__NSIG = 0x41 +const ( + SIG_BLOCK = 0x0 + SIG_UNBLOCK = 0x1 + SIG_SETMASK = 0x2 +) + type Siginfo struct { Signo int32 Errno int32 @@ -351,6 +357,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 @@ -428,7 +436,7 @@ const ( type SockaddrStorage struct { Family uint16 - _ [118]uint8 + Data [118]byte _ uint64 } diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go b/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go index 71184cc..aa268d0 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include -fsigned-char linux/types.go | go run mkpost.go +// cgo -godefs -objdir=/tmp/s390x/cgo -- -Wall -Werror -static -I/tmp/s390x/include -fsigned-char linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build s390x && linux @@ -271,6 +271,12 @@ type Sigset_t struct { const _C__NSIG = 0x41 +const ( + SIG_BLOCK = 0x0 + SIG_UNBLOCK = 0x1 + SIG_SETMASK = 0x2 +) + type Siginfo struct { Signo int32 Errno int32 @@ -346,6 +352,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 @@ -423,7 +431,7 @@ const ( type SockaddrStorage struct { Family uint16 - _ [118]int8 + Data [118]byte _ uint64 } diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go index 0615628..444045b 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go +// cgo -godefs -objdir=/tmp/sparc64/cgo -- -Wall -Werror -static -I/tmp/sparc64/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build sparc64 && linux @@ -253,6 +253,12 @@ type Sigset_t struct { const _C__NSIG = 0x41 +const ( + SIG_BLOCK = 0x1 + SIG_UNBLOCK = 0x2 + SIG_SETMASK = 0x4 +) + type Siginfo struct { Signo int32 Errno int32 @@ -328,6 +334,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 @@ -405,7 +413,7 @@ const ( type SockaddrStorage struct { Family uint16 - _ [118]int8 + Data [118]byte _ uint64 } diff --git a/vendor/golang.org/x/sys/unix/ztypes_netbsd_386.go b/vendor/golang.org/x/sys/unix/ztypes_netbsd_386.go index 2fd2060..9bc4c8f 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_netbsd_386.go +++ b/vendor/golang.org/x/sys/unix/ztypes_netbsd_386.go @@ -491,6 +491,90 @@ type Utsname struct { Machine [256]byte } +const SizeofUvmexp = 0x278 + +type Uvmexp struct { + Pagesize int64 + Pagemask int64 + Pageshift int64 + Npages int64 + Free int64 + Active int64 + Inactive int64 + Paging int64 + Wired int64 + Zeropages int64 + Reserve_pagedaemon int64 + Reserve_kernel int64 + Freemin int64 + Freetarg int64 + Inactarg int64 + Wiredmax int64 + Nswapdev int64 + Swpages int64 + Swpginuse int64 + Swpgonly int64 + Nswget int64 + Unused1 int64 + Cpuhit int64 + Cpumiss int64 + Faults int64 + Traps int64 + Intrs int64 + Swtch int64 + Softs int64 + Syscalls int64 + Pageins int64 + Swapins int64 + Swapouts int64 + Pgswapin int64 + Pgswapout int64 + Forks int64 + Forks_ppwait int64 + Forks_sharevm int64 + Pga_zerohit int64 + Pga_zeromiss int64 + Zeroaborts int64 + Fltnoram int64 + Fltnoanon int64 + Fltpgwait int64 + Fltpgrele int64 + Fltrelck int64 + Fltrelckok int64 + Fltanget int64 + Fltanretry int64 + Fltamcopy int64 + Fltnamap int64 + Fltnomap int64 + Fltlget int64 + Fltget int64 + Flt_anon int64 + Flt_acow int64 + Flt_obj int64 + Flt_prcopy int64 + Flt_przero int64 + Pdwoke int64 + Pdrevs int64 + Unused4 int64 + Pdfreed int64 + Pdscans int64 + Pdanscan int64 + Pdobscan int64 + Pdreact int64 + Pdbusy int64 + Pdpageouts int64 + Pdpending int64 + Pddeact int64 + Anonpages int64 + Filepages int64 + Execpages int64 + Colorhit int64 + Colormiss int64 + Ncolors int64 + Bootpages int64 + Poolpages int64 +} + const SizeofClockinfo = 0x14 type Clockinfo struct { diff --git a/vendor/golang.org/x/sys/unix/ztypes_netbsd_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_netbsd_amd64.go index 6a5a1a8..bb05f65 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_netbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_netbsd_amd64.go @@ -499,6 +499,90 @@ type Utsname struct { Machine [256]byte } +const SizeofUvmexp = 0x278 + +type Uvmexp struct { + Pagesize int64 + Pagemask int64 + Pageshift int64 + Npages int64 + Free int64 + Active int64 + Inactive int64 + Paging int64 + Wired int64 + Zeropages int64 + Reserve_pagedaemon int64 + Reserve_kernel int64 + Freemin int64 + Freetarg int64 + Inactarg int64 + Wiredmax int64 + Nswapdev int64 + Swpages int64 + Swpginuse int64 + Swpgonly int64 + Nswget int64 + Unused1 int64 + Cpuhit int64 + Cpumiss int64 + Faults int64 + Traps int64 + Intrs int64 + Swtch int64 + Softs int64 + Syscalls int64 + Pageins int64 + Swapins int64 + Swapouts int64 + Pgswapin int64 + Pgswapout int64 + Forks int64 + Forks_ppwait int64 + Forks_sharevm int64 + Pga_zerohit int64 + Pga_zeromiss int64 + Zeroaborts int64 + Fltnoram int64 + Fltnoanon int64 + Fltpgwait int64 + Fltpgrele int64 + Fltrelck int64 + Fltrelckok int64 + Fltanget int64 + Fltanretry int64 + Fltamcopy int64 + Fltnamap int64 + Fltnomap int64 + Fltlget int64 + Fltget int64 + Flt_anon int64 + Flt_acow int64 + Flt_obj int64 + Flt_prcopy int64 + Flt_przero int64 + Pdwoke int64 + Pdrevs int64 + Unused4 int64 + Pdfreed int64 + Pdscans int64 + Pdanscan int64 + Pdobscan int64 + Pdreact int64 + Pdbusy int64 + Pdpageouts int64 + Pdpending int64 + Pddeact int64 + Anonpages int64 + Filepages int64 + Execpages int64 + Colorhit int64 + Colormiss int64 + Ncolors int64 + Bootpages int64 + Poolpages int64 +} + const SizeofClockinfo = 0x14 type Clockinfo struct { diff --git a/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm.go b/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm.go index 84cc8d0..db40e3a 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm.go @@ -496,6 +496,90 @@ type Utsname struct { Machine [256]byte } +const SizeofUvmexp = 0x278 + +type Uvmexp struct { + Pagesize int64 + Pagemask int64 + Pageshift int64 + Npages int64 + Free int64 + Active int64 + Inactive int64 + Paging int64 + Wired int64 + Zeropages int64 + Reserve_pagedaemon int64 + Reserve_kernel int64 + Freemin int64 + Freetarg int64 + Inactarg int64 + Wiredmax int64 + Nswapdev int64 + Swpages int64 + Swpginuse int64 + Swpgonly int64 + Nswget int64 + Unused1 int64 + Cpuhit int64 + Cpumiss int64 + Faults int64 + Traps int64 + Intrs int64 + Swtch int64 + Softs int64 + Syscalls int64 + Pageins int64 + Swapins int64 + Swapouts int64 + Pgswapin int64 + Pgswapout int64 + Forks int64 + Forks_ppwait int64 + Forks_sharevm int64 + Pga_zerohit int64 + Pga_zeromiss int64 + Zeroaborts int64 + Fltnoram int64 + Fltnoanon int64 + Fltpgwait int64 + Fltpgrele int64 + Fltrelck int64 + Fltrelckok int64 + Fltanget int64 + Fltanretry int64 + Fltamcopy int64 + Fltnamap int64 + Fltnomap int64 + Fltlget int64 + Fltget int64 + Flt_anon int64 + Flt_acow int64 + Flt_obj int64 + Flt_prcopy int64 + Flt_przero int64 + Pdwoke int64 + Pdrevs int64 + Unused4 int64 + Pdfreed int64 + Pdscans int64 + Pdanscan int64 + Pdobscan int64 + Pdreact int64 + Pdbusy int64 + Pdpageouts int64 + Pdpending int64 + Pddeact int64 + Anonpages int64 + Filepages int64 + Execpages int64 + Colorhit int64 + Colormiss int64 + Ncolors int64 + Bootpages int64 + Poolpages int64 +} + const SizeofClockinfo = 0x14 type Clockinfo struct { diff --git a/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm64.go index c844e70..1112115 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm64.go @@ -499,6 +499,90 @@ type Utsname struct { Machine [256]byte } +const SizeofUvmexp = 0x278 + +type Uvmexp struct { + Pagesize int64 + Pagemask int64 + Pageshift int64 + Npages int64 + Free int64 + Active int64 + Inactive int64 + Paging int64 + Wired int64 + Zeropages int64 + Reserve_pagedaemon int64 + Reserve_kernel int64 + Freemin int64 + Freetarg int64 + Inactarg int64 + Wiredmax int64 + Nswapdev int64 + Swpages int64 + Swpginuse int64 + Swpgonly int64 + Nswget int64 + Unused1 int64 + Cpuhit int64 + Cpumiss int64 + Faults int64 + Traps int64 + Intrs int64 + Swtch int64 + Softs int64 + Syscalls int64 + Pageins int64 + Swapins int64 + Swapouts int64 + Pgswapin int64 + Pgswapout int64 + Forks int64 + Forks_ppwait int64 + Forks_sharevm int64 + Pga_zerohit int64 + Pga_zeromiss int64 + Zeroaborts int64 + Fltnoram int64 + Fltnoanon int64 + Fltpgwait int64 + Fltpgrele int64 + Fltrelck int64 + Fltrelckok int64 + Fltanget int64 + Fltanretry int64 + Fltamcopy int64 + Fltnamap int64 + Fltnomap int64 + Fltlget int64 + Fltget int64 + Flt_anon int64 + Flt_acow int64 + Flt_obj int64 + Flt_prcopy int64 + Flt_przero int64 + Pdwoke int64 + Pdrevs int64 + Unused4 int64 + Pdfreed int64 + Pdscans int64 + Pdanscan int64 + Pdobscan int64 + Pdreact int64 + Pdbusy int64 + Pdpageouts int64 + Pdpending int64 + Pddeact int64 + Anonpages int64 + Filepages int64 + Execpages int64 + Colorhit int64 + Colormiss int64 + Ncolors int64 + Bootpages int64 + Poolpages int64 +} + const SizeofClockinfo = 0x14 type Clockinfo struct { diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go index 2ed718c..26eba23 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go @@ -58,22 +58,22 @@ type Rlimit struct { type _Gid_t uint32 type Stat_t struct { - Mode uint32 - Dev int32 - Ino uint64 - Nlink uint32 - Uid uint32 - Gid uint32 - Rdev int32 - Atim Timespec - Mtim Timespec - Ctim Timespec - Size int64 - Blocks int64 - Blksize uint32 - Flags uint32 - Gen uint32 - X__st_birthtim Timespec + Mode uint32 + Dev int32 + Ino uint64 + Nlink uint32 + Uid uint32 + Gid uint32 + Rdev int32 + Atim Timespec + Mtim Timespec + Ctim Timespec + Size int64 + Blocks int64 + Blksize int32 + Flags uint32 + Gen uint32 + _ Timespec } type Statfs_t struct { @@ -98,7 +98,7 @@ type Statfs_t struct { F_mntonname [90]byte F_mntfromname [90]byte F_mntfromspec [90]byte - Pad_cgo_0 [2]byte + _ [2]byte Mount_info [160]byte } @@ -111,13 +111,13 @@ type Flock_t struct { } type Dirent struct { - Fileno uint64 - Off int64 - Reclen uint16 - Type uint8 - Namlen uint8 - X__d_padding [4]uint8 - Name [256]int8 + Fileno uint64 + Off int64 + Reclen uint16 + Type uint8 + Namlen uint8 + _ [4]uint8 + Name [256]int8 } type Fsid struct { @@ -262,8 +262,8 @@ type FdSet struct { } const ( - SizeofIfMsghdr = 0xec - SizeofIfData = 0xd4 + SizeofIfMsghdr = 0xa0 + SizeofIfData = 0x88 SizeofIfaMsghdr = 0x18 SizeofIfAnnounceMsghdr = 0x1a SizeofRtMsghdr = 0x60 @@ -292,7 +292,7 @@ type IfData struct { Link_state uint8 Mtu uint32 Metric uint32 - Pad uint32 + Rdomain uint32 Baudrate uint64 Ipackets uint64 Ierrors uint64 @@ -304,10 +304,10 @@ type IfData struct { Imcasts uint64 Omcasts uint64 Iqdrops uint64 + Oqdrops uint64 Noproto uint64 Capabilities uint32 Lastchange Timeval - Mclpool [7]Mclpool } type IfaMsghdr struct { @@ -368,20 +368,12 @@ type RtMetrics struct { Pad uint32 } -type Mclpool struct { - Grown int32 - Alive uint16 - Hwm uint16 - Cwm uint16 - Lwm uint16 -} - const ( SizeofBpfVersion = 0x4 SizeofBpfStat = 0x8 SizeofBpfProgram = 0x8 SizeofBpfInsn = 0x8 - SizeofBpfHdr = 0x14 + SizeofBpfHdr = 0x18 ) type BpfVersion struct { @@ -407,11 +399,14 @@ type BpfInsn struct { } type BpfHdr struct { - Tstamp BpfTimeval - Caplen uint32 - Datalen uint32 - Hdrlen uint16 - Pad_cgo_0 [2]byte + Tstamp BpfTimeval + Caplen uint32 + Datalen uint32 + Hdrlen uint16 + Ifidx uint16 + Flowid uint16 + Flags uint8 + Drops uint8 } type BpfTimeval struct { @@ -488,7 +483,7 @@ type Uvmexp struct { Zeropages int32 Reserve_pagedaemon int32 Reserve_kernel int32 - Anonpages int32 + Unused01 int32 Vnodepages int32 Vtextpages int32 Freemin int32 @@ -507,8 +502,8 @@ type Uvmexp struct { Swpgonly int32 Nswget int32 Nanon int32 - Nanonneeded int32 - Nfreeanon int32 + Unused05 int32 + Unused06 int32 Faults int32 Traps int32 Intrs int32 @@ -516,8 +511,8 @@ type Uvmexp struct { Softs int32 Syscalls int32 Pageins int32 - Obsolete_swapins int32 - Obsolete_swapouts int32 + Unused07 int32 + Unused08 int32 Pgswapin int32 Pgswapout int32 Forks int32 @@ -525,7 +520,7 @@ type Uvmexp struct { Forks_sharevm int32 Pga_zerohit int32 Pga_zeromiss int32 - Zeroaborts int32 + Unused09 int32 Fltnoram int32 Fltnoanon int32 Fltnoamap int32 @@ -557,9 +552,9 @@ type Uvmexp struct { Pdpageouts int32 Pdpending int32 Pddeact int32 - Pdreanon int32 - Pdrevnode int32 - Pdrevtext int32 + Unused11 int32 + Unused12 int32 + Unused13 int32 Fpswtch int32 Kmapent int32 } diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go index b4fb97e..5a54798 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go @@ -73,7 +73,6 @@ type Stat_t struct { Blksize int32 Flags uint32 Gen uint32 - _ [4]byte _ Timespec } @@ -81,7 +80,6 @@ type Statfs_t struct { F_flags uint32 F_bsize uint32 F_iosize uint32 - _ [4]byte F_blocks uint64 F_bfree uint64 F_bavail int64 @@ -200,10 +198,8 @@ type IPv6Mreq struct { type Msghdr struct { Name *byte Namelen uint32 - _ [4]byte Iov *Iovec Iovlen uint32 - _ [4]byte Control *byte Controllen uint32 Flags int32 @@ -311,7 +307,6 @@ type IfData struct { Oqdrops uint64 Noproto uint64 Capabilities uint32 - _ [4]byte Lastchange Timeval } @@ -373,14 +368,12 @@ type RtMetrics struct { Pad uint32 } -type Mclpool struct{} - const ( SizeofBpfVersion = 0x4 SizeofBpfStat = 0x8 SizeofBpfProgram = 0x10 SizeofBpfInsn = 0x8 - SizeofBpfHdr = 0x14 + SizeofBpfHdr = 0x18 ) type BpfVersion struct { @@ -395,7 +388,6 @@ type BpfStat struct { type BpfProgram struct { Len uint32 - _ [4]byte Insns *BpfInsn } @@ -411,7 +403,10 @@ type BpfHdr struct { Caplen uint32 Datalen uint32 Hdrlen uint16 - _ [2]byte + Ifidx uint16 + Flowid uint16 + Flags uint8 + Drops uint8 } type BpfTimeval struct { @@ -488,7 +483,7 @@ type Uvmexp struct { Zeropages int32 Reserve_pagedaemon int32 Reserve_kernel int32 - Anonpages int32 + Unused01 int32 Vnodepages int32 Vtextpages int32 Freemin int32 @@ -507,8 +502,8 @@ type Uvmexp struct { Swpgonly int32 Nswget int32 Nanon int32 - Nanonneeded int32 - Nfreeanon int32 + Unused05 int32 + Unused06 int32 Faults int32 Traps int32 Intrs int32 @@ -516,8 +511,8 @@ type Uvmexp struct { Softs int32 Syscalls int32 Pageins int32 - Obsolete_swapins int32 - Obsolete_swapouts int32 + Unused07 int32 + Unused08 int32 Pgswapin int32 Pgswapout int32 Forks int32 @@ -525,7 +520,7 @@ type Uvmexp struct { Forks_sharevm int32 Pga_zerohit int32 Pga_zeromiss int32 - Zeroaborts int32 + Unused09 int32 Fltnoram int32 Fltnoanon int32 Fltnoamap int32 @@ -557,9 +552,9 @@ type Uvmexp struct { Pdpageouts int32 Pdpending int32 Pddeact int32 - Pdreanon int32 - Pdrevnode int32 - Pdrevtext int32 + Unused11 int32 + Unused12 int32 + Unused13 int32 Fpswtch int32 Kmapent int32 } diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go index 2c46750..be58c4e 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go @@ -375,14 +375,12 @@ type RtMetrics struct { Pad uint32 } -type Mclpool struct{} - const ( SizeofBpfVersion = 0x4 SizeofBpfStat = 0x8 SizeofBpfProgram = 0x8 SizeofBpfInsn = 0x8 - SizeofBpfHdr = 0x14 + SizeofBpfHdr = 0x18 ) type BpfVersion struct { @@ -412,7 +410,10 @@ type BpfHdr struct { Caplen uint32 Datalen uint32 Hdrlen uint16 - _ [2]byte + Ifidx uint16 + Flowid uint16 + Flags uint8 + Drops uint8 } type BpfTimeval struct { diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go index ddee045..5233826 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go @@ -368,14 +368,12 @@ type RtMetrics struct { Pad uint32 } -type Mclpool struct{} - const ( SizeofBpfVersion = 0x4 SizeofBpfStat = 0x8 SizeofBpfProgram = 0x10 SizeofBpfInsn = 0x8 - SizeofBpfHdr = 0x14 + SizeofBpfHdr = 0x18 ) type BpfVersion struct { @@ -405,7 +403,10 @@ type BpfHdr struct { Caplen uint32 Datalen uint32 Hdrlen uint16 - _ [2]byte + Ifidx uint16 + Flowid uint16 + Flags uint8 + Drops uint8 } type BpfTimeval struct { diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_mips64.go index eb13d4e..605cfdb 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_mips64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_mips64.go @@ -368,14 +368,12 @@ type RtMetrics struct { Pad uint32 } -type Mclpool struct{} - const ( SizeofBpfVersion = 0x4 SizeofBpfStat = 0x8 SizeofBpfProgram = 0x10 SizeofBpfInsn = 0x8 - SizeofBpfHdr = 0x14 + SizeofBpfHdr = 0x18 ) type BpfVersion struct { @@ -405,7 +403,10 @@ type BpfHdr struct { Caplen uint32 Datalen uint32 Hdrlen uint16 - _ [2]byte + Ifidx uint16 + Flowid uint16 + Flags uint8 + Drops uint8 } type BpfTimeval struct { diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_ppc64.go new file mode 100644 index 0000000..d6724c0 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_ppc64.go @@ -0,0 +1,571 @@ +// cgo -godefs -- -fsigned-char types_openbsd.go | go run mkpost.go +// Code generated by the command above; see README.md. DO NOT EDIT. + +//go:build ppc64 && openbsd +// +build ppc64,openbsd + +package unix + +const ( + SizeofPtr = 0x8 + SizeofShort = 0x2 + SizeofInt = 0x4 + SizeofLong = 0x8 + SizeofLongLong = 0x8 +) + +type ( + _C_short int16 + _C_int int32 + _C_long int64 + _C_long_long int64 +) + +type Timespec struct { + Sec int64 + Nsec int64 +} + +type Timeval struct { + Sec int64 + Usec int64 +} + +type Rusage struct { + Utime Timeval + Stime Timeval + Maxrss int64 + Ixrss int64 + Idrss int64 + Isrss int64 + Minflt int64 + Majflt int64 + Nswap int64 + Inblock int64 + Oublock int64 + Msgsnd int64 + Msgrcv int64 + Nsignals int64 + Nvcsw int64 + Nivcsw int64 +} + +type Rlimit struct { + Cur uint64 + Max uint64 +} + +type _Gid_t uint32 + +type Stat_t struct { + Mode uint32 + Dev int32 + Ino uint64 + Nlink uint32 + Uid uint32 + Gid uint32 + Rdev int32 + Atim Timespec + Mtim Timespec + Ctim Timespec + Size int64 + Blocks int64 + Blksize int32 + Flags uint32 + Gen uint32 + _ Timespec +} + +type Statfs_t struct { + F_flags uint32 + F_bsize uint32 + F_iosize uint32 + F_blocks uint64 + F_bfree uint64 + F_bavail int64 + F_files uint64 + F_ffree uint64 + F_favail int64 + F_syncwrites uint64 + F_syncreads uint64 + F_asyncwrites uint64 + F_asyncreads uint64 + F_fsid Fsid + F_namemax uint32 + F_owner uint32 + F_ctime uint64 + F_fstypename [16]byte + F_mntonname [90]byte + F_mntfromname [90]byte + F_mntfromspec [90]byte + _ [2]byte + Mount_info [160]byte +} + +type Flock_t struct { + Start int64 + Len int64 + Pid int32 + Type int16 + Whence int16 +} + +type Dirent struct { + Fileno uint64 + Off int64 + Reclen uint16 + Type uint8 + Namlen uint8 + _ [4]uint8 + Name [256]int8 +} + +type Fsid struct { + Val [2]int32 +} + +const ( + PathMax = 0x400 +) + +type RawSockaddrInet4 struct { + Len uint8 + Family uint8 + Port uint16 + Addr [4]byte /* in_addr */ + Zero [8]int8 +} + +type RawSockaddrInet6 struct { + Len uint8 + Family uint8 + Port uint16 + Flowinfo uint32 + Addr [16]byte /* in6_addr */ + Scope_id uint32 +} + +type RawSockaddrUnix struct { + Len uint8 + Family uint8 + Path [104]int8 +} + +type RawSockaddrDatalink struct { + Len uint8 + Family uint8 + Index uint16 + Type uint8 + Nlen uint8 + Alen uint8 + Slen uint8 + Data [24]int8 +} + +type RawSockaddr struct { + Len uint8 + Family uint8 + Data [14]int8 +} + +type RawSockaddrAny struct { + Addr RawSockaddr + Pad [92]int8 +} + +type _Socklen uint32 + +type Linger struct { + Onoff int32 + Linger int32 +} + +type Iovec struct { + Base *byte + Len uint64 +} + +type IPMreq struct { + Multiaddr [4]byte /* in_addr */ + Interface [4]byte /* in_addr */ +} + +type IPv6Mreq struct { + Multiaddr [16]byte /* in6_addr */ + Interface uint32 +} + +type Msghdr struct { + Name *byte + Namelen uint32 + Iov *Iovec + Iovlen uint32 + Control *byte + Controllen uint32 + Flags int32 +} + +type Cmsghdr struct { + Len uint32 + Level int32 + Type int32 +} + +type Inet6Pktinfo struct { + Addr [16]byte /* in6_addr */ + Ifindex uint32 +} + +type IPv6MTUInfo struct { + Addr RawSockaddrInet6 + Mtu uint32 +} + +type ICMPv6Filter struct { + Filt [8]uint32 +} + +const ( + SizeofSockaddrInet4 = 0x10 + SizeofSockaddrInet6 = 0x1c + SizeofSockaddrAny = 0x6c + SizeofSockaddrUnix = 0x6a + SizeofSockaddrDatalink = 0x20 + SizeofLinger = 0x8 + SizeofIovec = 0x10 + SizeofIPMreq = 0x8 + SizeofIPv6Mreq = 0x14 + SizeofMsghdr = 0x30 + SizeofCmsghdr = 0xc + SizeofInet6Pktinfo = 0x14 + SizeofIPv6MTUInfo = 0x20 + SizeofICMPv6Filter = 0x20 +) + +const ( + PTRACE_TRACEME = 0x0 + PTRACE_CONT = 0x7 + PTRACE_KILL = 0x8 +) + +type Kevent_t struct { + Ident uint64 + Filter int16 + Flags uint16 + Fflags uint32 + Data int64 + Udata *byte +} + +type FdSet struct { + Bits [32]uint32 +} + +const ( + SizeofIfMsghdr = 0xa8 + SizeofIfData = 0x90 + SizeofIfaMsghdr = 0x18 + SizeofIfAnnounceMsghdr = 0x1a + SizeofRtMsghdr = 0x60 + SizeofRtMetrics = 0x38 +) + +type IfMsghdr struct { + Msglen uint16 + Version uint8 + Type uint8 + Hdrlen uint16 + Index uint16 + Tableid uint16 + Pad1 uint8 + Pad2 uint8 + Addrs int32 + Flags int32 + Xflags int32 + Data IfData +} + +type IfData struct { + Type uint8 + Addrlen uint8 + Hdrlen uint8 + Link_state uint8 + Mtu uint32 + Metric uint32 + Rdomain uint32 + Baudrate uint64 + Ipackets uint64 + Ierrors uint64 + Opackets uint64 + Oerrors uint64 + Collisions uint64 + Ibytes uint64 + Obytes uint64 + Imcasts uint64 + Omcasts uint64 + Iqdrops uint64 + Oqdrops uint64 + Noproto uint64 + Capabilities uint32 + Lastchange Timeval +} + +type IfaMsghdr struct { + Msglen uint16 + Version uint8 + Type uint8 + Hdrlen uint16 + Index uint16 + Tableid uint16 + Pad1 uint8 + Pad2 uint8 + Addrs int32 + Flags int32 + Metric int32 +} + +type IfAnnounceMsghdr struct { + Msglen uint16 + Version uint8 + Type uint8 + Hdrlen uint16 + Index uint16 + What uint16 + Name [16]int8 +} + +type RtMsghdr struct { + Msglen uint16 + Version uint8 + Type uint8 + Hdrlen uint16 + Index uint16 + Tableid uint16 + Priority uint8 + Mpls uint8 + Addrs int32 + Flags int32 + Fmask int32 + Pid int32 + Seq int32 + Errno int32 + Inits uint32 + Rmx RtMetrics +} + +type RtMetrics struct { + Pksent uint64 + Expire int64 + Locks uint32 + Mtu uint32 + Refcnt uint32 + Hopcount uint32 + Recvpipe uint32 + Sendpipe uint32 + Ssthresh uint32 + Rtt uint32 + Rttvar uint32 + Pad uint32 +} + +type Mclpool struct{} + +const ( + SizeofBpfVersion = 0x4 + SizeofBpfStat = 0x8 + SizeofBpfProgram = 0x10 + SizeofBpfInsn = 0x8 + SizeofBpfHdr = 0x18 +) + +type BpfVersion struct { + Major uint16 + Minor uint16 +} + +type BpfStat struct { + Recv uint32 + Drop uint32 +} + +type BpfProgram struct { + Len uint32 + Insns *BpfInsn +} + +type BpfInsn struct { + Code uint16 + Jt uint8 + Jf uint8 + K uint32 +} + +type BpfHdr struct { + Tstamp BpfTimeval + Caplen uint32 + Datalen uint32 + Hdrlen uint16 + Ifidx uint16 + Flowid uint16 + Flags uint8 + Drops uint8 +} + +type BpfTimeval struct { + Sec uint32 + Usec uint32 +} + +type Termios struct { + Iflag uint32 + Oflag uint32 + Cflag uint32 + Lflag uint32 + Cc [20]uint8 + Ispeed int32 + Ospeed int32 +} + +type Winsize struct { + Row uint16 + Col uint16 + Xpixel uint16 + Ypixel uint16 +} + +const ( + AT_FDCWD = -0x64 + AT_EACCESS = 0x1 + AT_SYMLINK_NOFOLLOW = 0x2 + AT_SYMLINK_FOLLOW = 0x4 + AT_REMOVEDIR = 0x8 +) + +type PollFd struct { + Fd int32 + Events int16 + Revents int16 +} + +const ( + POLLERR = 0x8 + POLLHUP = 0x10 + POLLIN = 0x1 + POLLNVAL = 0x20 + POLLOUT = 0x4 + POLLPRI = 0x2 + POLLRDBAND = 0x80 + POLLRDNORM = 0x40 + POLLWRBAND = 0x100 + POLLWRNORM = 0x4 +) + +type Sigset_t uint32 + +type Utsname struct { + Sysname [256]byte + Nodename [256]byte + Release [256]byte + Version [256]byte + Machine [256]byte +} + +const SizeofUvmexp = 0x158 + +type Uvmexp struct { + Pagesize int32 + Pagemask int32 + Pageshift int32 + Npages int32 + Free int32 + Active int32 + Inactive int32 + Paging int32 + Wired int32 + Zeropages int32 + Reserve_pagedaemon int32 + Reserve_kernel int32 + Unused01 int32 + Vnodepages int32 + Vtextpages int32 + Freemin int32 + Freetarg int32 + Inactarg int32 + Wiredmax int32 + Anonmin int32 + Vtextmin int32 + Vnodemin int32 + Anonminpct int32 + Vtextminpct int32 + Vnodeminpct int32 + Nswapdev int32 + Swpages int32 + Swpginuse int32 + Swpgonly int32 + Nswget int32 + Nanon int32 + Unused05 int32 + Unused06 int32 + Faults int32 + Traps int32 + Intrs int32 + Swtch int32 + Softs int32 + Syscalls int32 + Pageins int32 + Unused07 int32 + Unused08 int32 + Pgswapin int32 + Pgswapout int32 + Forks int32 + Forks_ppwait int32 + Forks_sharevm int32 + Pga_zerohit int32 + Pga_zeromiss int32 + Unused09 int32 + Fltnoram int32 + Fltnoanon int32 + Fltnoamap int32 + Fltpgwait int32 + Fltpgrele int32 + Fltrelck int32 + Fltrelckok int32 + Fltanget int32 + Fltanretry int32 + Fltamcopy int32 + Fltnamap int32 + Fltnomap int32 + Fltlget int32 + Fltget int32 + Flt_anon int32 + Flt_acow int32 + Flt_obj int32 + Flt_prcopy int32 + Flt_przero int32 + Pdwoke int32 + Pdrevs int32 + Pdswout int32 + Pdfreed int32 + Pdscans int32 + Pdanscan int32 + Pdobscan int32 + Pdreact int32 + Pdbusy int32 + Pdpageouts int32 + Pdpending int32 + Pddeact int32 + Unused11 int32 + Unused12 int32 + Unused13 int32 + Fpswtch int32 + Kmapent int32 +} + +const SizeofClockinfo = 0x10 + +type Clockinfo struct { + Hz int32 + Tick int32 + Stathz int32 + Profhz int32 +} diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_riscv64.go new file mode 100644 index 0000000..ddfd27a --- /dev/null +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_riscv64.go @@ -0,0 +1,571 @@ +// cgo -godefs -- -fsigned-char types_openbsd.go | go run mkpost.go +// Code generated by the command above; see README.md. DO NOT EDIT. + +//go:build riscv64 && openbsd +// +build riscv64,openbsd + +package unix + +const ( + SizeofPtr = 0x8 + SizeofShort = 0x2 + SizeofInt = 0x4 + SizeofLong = 0x8 + SizeofLongLong = 0x8 +) + +type ( + _C_short int16 + _C_int int32 + _C_long int64 + _C_long_long int64 +) + +type Timespec struct { + Sec int64 + Nsec int64 +} + +type Timeval struct { + Sec int64 + Usec int64 +} + +type Rusage struct { + Utime Timeval + Stime Timeval + Maxrss int64 + Ixrss int64 + Idrss int64 + Isrss int64 + Minflt int64 + Majflt int64 + Nswap int64 + Inblock int64 + Oublock int64 + Msgsnd int64 + Msgrcv int64 + Nsignals int64 + Nvcsw int64 + Nivcsw int64 +} + +type Rlimit struct { + Cur uint64 + Max uint64 +} + +type _Gid_t uint32 + +type Stat_t struct { + Mode uint32 + Dev int32 + Ino uint64 + Nlink uint32 + Uid uint32 + Gid uint32 + Rdev int32 + Atim Timespec + Mtim Timespec + Ctim Timespec + Size int64 + Blocks int64 + Blksize int32 + Flags uint32 + Gen uint32 + _ Timespec +} + +type Statfs_t struct { + F_flags uint32 + F_bsize uint32 + F_iosize uint32 + F_blocks uint64 + F_bfree uint64 + F_bavail int64 + F_files uint64 + F_ffree uint64 + F_favail int64 + F_syncwrites uint64 + F_syncreads uint64 + F_asyncwrites uint64 + F_asyncreads uint64 + F_fsid Fsid + F_namemax uint32 + F_owner uint32 + F_ctime uint64 + F_fstypename [16]byte + F_mntonname [90]byte + F_mntfromname [90]byte + F_mntfromspec [90]byte + _ [2]byte + Mount_info [160]byte +} + +type Flock_t struct { + Start int64 + Len int64 + Pid int32 + Type int16 + Whence int16 +} + +type Dirent struct { + Fileno uint64 + Off int64 + Reclen uint16 + Type uint8 + Namlen uint8 + _ [4]uint8 + Name [256]int8 +} + +type Fsid struct { + Val [2]int32 +} + +const ( + PathMax = 0x400 +) + +type RawSockaddrInet4 struct { + Len uint8 + Family uint8 + Port uint16 + Addr [4]byte /* in_addr */ + Zero [8]int8 +} + +type RawSockaddrInet6 struct { + Len uint8 + Family uint8 + Port uint16 + Flowinfo uint32 + Addr [16]byte /* in6_addr */ + Scope_id uint32 +} + +type RawSockaddrUnix struct { + Len uint8 + Family uint8 + Path [104]int8 +} + +type RawSockaddrDatalink struct { + Len uint8 + Family uint8 + Index uint16 + Type uint8 + Nlen uint8 + Alen uint8 + Slen uint8 + Data [24]int8 +} + +type RawSockaddr struct { + Len uint8 + Family uint8 + Data [14]int8 +} + +type RawSockaddrAny struct { + Addr RawSockaddr + Pad [92]int8 +} + +type _Socklen uint32 + +type Linger struct { + Onoff int32 + Linger int32 +} + +type Iovec struct { + Base *byte + Len uint64 +} + +type IPMreq struct { + Multiaddr [4]byte /* in_addr */ + Interface [4]byte /* in_addr */ +} + +type IPv6Mreq struct { + Multiaddr [16]byte /* in6_addr */ + Interface uint32 +} + +type Msghdr struct { + Name *byte + Namelen uint32 + Iov *Iovec + Iovlen uint32 + Control *byte + Controllen uint32 + Flags int32 +} + +type Cmsghdr struct { + Len uint32 + Level int32 + Type int32 +} + +type Inet6Pktinfo struct { + Addr [16]byte /* in6_addr */ + Ifindex uint32 +} + +type IPv6MTUInfo struct { + Addr RawSockaddrInet6 + Mtu uint32 +} + +type ICMPv6Filter struct { + Filt [8]uint32 +} + +const ( + SizeofSockaddrInet4 = 0x10 + SizeofSockaddrInet6 = 0x1c + SizeofSockaddrAny = 0x6c + SizeofSockaddrUnix = 0x6a + SizeofSockaddrDatalink = 0x20 + SizeofLinger = 0x8 + SizeofIovec = 0x10 + SizeofIPMreq = 0x8 + SizeofIPv6Mreq = 0x14 + SizeofMsghdr = 0x30 + SizeofCmsghdr = 0xc + SizeofInet6Pktinfo = 0x14 + SizeofIPv6MTUInfo = 0x20 + SizeofICMPv6Filter = 0x20 +) + +const ( + PTRACE_TRACEME = 0x0 + PTRACE_CONT = 0x7 + PTRACE_KILL = 0x8 +) + +type Kevent_t struct { + Ident uint64 + Filter int16 + Flags uint16 + Fflags uint32 + Data int64 + Udata *byte +} + +type FdSet struct { + Bits [32]uint32 +} + +const ( + SizeofIfMsghdr = 0xa8 + SizeofIfData = 0x90 + SizeofIfaMsghdr = 0x18 + SizeofIfAnnounceMsghdr = 0x1a + SizeofRtMsghdr = 0x60 + SizeofRtMetrics = 0x38 +) + +type IfMsghdr struct { + Msglen uint16 + Version uint8 + Type uint8 + Hdrlen uint16 + Index uint16 + Tableid uint16 + Pad1 uint8 + Pad2 uint8 + Addrs int32 + Flags int32 + Xflags int32 + Data IfData +} + +type IfData struct { + Type uint8 + Addrlen uint8 + Hdrlen uint8 + Link_state uint8 + Mtu uint32 + Metric uint32 + Rdomain uint32 + Baudrate uint64 + Ipackets uint64 + Ierrors uint64 + Opackets uint64 + Oerrors uint64 + Collisions uint64 + Ibytes uint64 + Obytes uint64 + Imcasts uint64 + Omcasts uint64 + Iqdrops uint64 + Oqdrops uint64 + Noproto uint64 + Capabilities uint32 + Lastchange Timeval +} + +type IfaMsghdr struct { + Msglen uint16 + Version uint8 + Type uint8 + Hdrlen uint16 + Index uint16 + Tableid uint16 + Pad1 uint8 + Pad2 uint8 + Addrs int32 + Flags int32 + Metric int32 +} + +type IfAnnounceMsghdr struct { + Msglen uint16 + Version uint8 + Type uint8 + Hdrlen uint16 + Index uint16 + What uint16 + Name [16]int8 +} + +type RtMsghdr struct { + Msglen uint16 + Version uint8 + Type uint8 + Hdrlen uint16 + Index uint16 + Tableid uint16 + Priority uint8 + Mpls uint8 + Addrs int32 + Flags int32 + Fmask int32 + Pid int32 + Seq int32 + Errno int32 + Inits uint32 + Rmx RtMetrics +} + +type RtMetrics struct { + Pksent uint64 + Expire int64 + Locks uint32 + Mtu uint32 + Refcnt uint32 + Hopcount uint32 + Recvpipe uint32 + Sendpipe uint32 + Ssthresh uint32 + Rtt uint32 + Rttvar uint32 + Pad uint32 +} + +type Mclpool struct{} + +const ( + SizeofBpfVersion = 0x4 + SizeofBpfStat = 0x8 + SizeofBpfProgram = 0x10 + SizeofBpfInsn = 0x8 + SizeofBpfHdr = 0x18 +) + +type BpfVersion struct { + Major uint16 + Minor uint16 +} + +type BpfStat struct { + Recv uint32 + Drop uint32 +} + +type BpfProgram struct { + Len uint32 + Insns *BpfInsn +} + +type BpfInsn struct { + Code uint16 + Jt uint8 + Jf uint8 + K uint32 +} + +type BpfHdr struct { + Tstamp BpfTimeval + Caplen uint32 + Datalen uint32 + Hdrlen uint16 + Ifidx uint16 + Flowid uint16 + Flags uint8 + Drops uint8 +} + +type BpfTimeval struct { + Sec uint32 + Usec uint32 +} + +type Termios struct { + Iflag uint32 + Oflag uint32 + Cflag uint32 + Lflag uint32 + Cc [20]uint8 + Ispeed int32 + Ospeed int32 +} + +type Winsize struct { + Row uint16 + Col uint16 + Xpixel uint16 + Ypixel uint16 +} + +const ( + AT_FDCWD = -0x64 + AT_EACCESS = 0x1 + AT_SYMLINK_NOFOLLOW = 0x2 + AT_SYMLINK_FOLLOW = 0x4 + AT_REMOVEDIR = 0x8 +) + +type PollFd struct { + Fd int32 + Events int16 + Revents int16 +} + +const ( + POLLERR = 0x8 + POLLHUP = 0x10 + POLLIN = 0x1 + POLLNVAL = 0x20 + POLLOUT = 0x4 + POLLPRI = 0x2 + POLLRDBAND = 0x80 + POLLRDNORM = 0x40 + POLLWRBAND = 0x100 + POLLWRNORM = 0x4 +) + +type Sigset_t uint32 + +type Utsname struct { + Sysname [256]byte + Nodename [256]byte + Release [256]byte + Version [256]byte + Machine [256]byte +} + +const SizeofUvmexp = 0x158 + +type Uvmexp struct { + Pagesize int32 + Pagemask int32 + Pageshift int32 + Npages int32 + Free int32 + Active int32 + Inactive int32 + Paging int32 + Wired int32 + Zeropages int32 + Reserve_pagedaemon int32 + Reserve_kernel int32 + Unused01 int32 + Vnodepages int32 + Vtextpages int32 + Freemin int32 + Freetarg int32 + Inactarg int32 + Wiredmax int32 + Anonmin int32 + Vtextmin int32 + Vnodemin int32 + Anonminpct int32 + Vtextminpct int32 + Vnodeminpct int32 + Nswapdev int32 + Swpages int32 + Swpginuse int32 + Swpgonly int32 + Nswget int32 + Nanon int32 + Unused05 int32 + Unused06 int32 + Faults int32 + Traps int32 + Intrs int32 + Swtch int32 + Softs int32 + Syscalls int32 + Pageins int32 + Unused07 int32 + Unused08 int32 + Pgswapin int32 + Pgswapout int32 + Forks int32 + Forks_ppwait int32 + Forks_sharevm int32 + Pga_zerohit int32 + Pga_zeromiss int32 + Unused09 int32 + Fltnoram int32 + Fltnoanon int32 + Fltnoamap int32 + Fltpgwait int32 + Fltpgrele int32 + Fltrelck int32 + Fltrelckok int32 + Fltanget int32 + Fltanretry int32 + Fltamcopy int32 + Fltnamap int32 + Fltnomap int32 + Fltlget int32 + Fltget int32 + Flt_anon int32 + Flt_acow int32 + Flt_obj int32 + Flt_prcopy int32 + Flt_przero int32 + Pdwoke int32 + Pdrevs int32 + Pdswout int32 + Pdfreed int32 + Pdscans int32 + Pdanscan int32 + Pdobscan int32 + Pdreact int32 + Pdbusy int32 + Pdpageouts int32 + Pdpending int32 + Pddeact int32 + Unused11 int32 + Unused12 int32 + Unused13 int32 + Fpswtch int32 + Kmapent int32 +} + +const SizeofClockinfo = 0x10 + +type Clockinfo struct { + Hz int32 + Tick int32 + Stathz int32 + Profhz int32 +} diff --git a/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go index c1a9b83..0400747 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go @@ -480,3 +480,38 @@ const ( MOUNTEDOVER = 0x40000000 FILE_EXCEPTION = 0x60000070 ) + +const ( + TUNNEWPPA = 0x540001 + TUNSETPPA = 0x540002 + + I_STR = 0x5308 + I_POP = 0x5303 + I_PUSH = 0x5302 + I_LINK = 0x530c + I_UNLINK = 0x530d + I_PLINK = 0x5316 + I_PUNLINK = 0x5317 + + IF_UNITSEL = -0x7ffb8cca +) + +type strbuf struct { + Maxlen int32 + Len int32 + Buf *int8 +} + +type Strioctl struct { + Cmd int32 + Timout int32 + Len int32 + Dp *int8 +} + +type Lifreq struct { + Name [32]int8 + Lifru1 [4]byte + Type uint32 + Lifru [336]byte +} diff --git a/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go b/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go index 4ab638c..aec1efc 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go @@ -339,7 +339,7 @@ type Statfs_t struct { Flags uint64 } -type Dirent struct { +type direntLE struct { Reclen uint16 Namlen uint16 Ino uint32 @@ -347,6 +347,15 @@ type Dirent struct { Name [256]byte } +type Dirent struct { + Ino uint64 + Off int64 + Reclen uint16 + Type uint8 + Name [256]uint8 + _ [5]byte +} + type FdSet struct { Bits [64]int32 } diff --git a/vendor/golang.org/x/sys/windows/env_windows.go b/vendor/golang.org/x/sys/windows/env_windows.go index 92ac05f..b8ad192 100644 --- a/vendor/golang.org/x/sys/windows/env_windows.go +++ b/vendor/golang.org/x/sys/windows/env_windows.go @@ -37,14 +37,14 @@ func (token Token) Environ(inheritExisting bool) (env []string, err error) { return nil, err } defer DestroyEnvironmentBlock(block) - blockp := uintptr(unsafe.Pointer(block)) + blockp := unsafe.Pointer(block) for { - entry := UTF16PtrToString((*uint16)(unsafe.Pointer(blockp))) + entry := UTF16PtrToString((*uint16)(blockp)) if len(entry) == 0 { break } env = append(env, entry) - blockp += 2 * (uintptr(len(entry)) + 1) + blockp = unsafe.Add(blockp, 2*(len(entry)+1)) } return env, nil } diff --git a/vendor/golang.org/x/sys/windows/exec_windows.go b/vendor/golang.org/x/sys/windows/exec_windows.go index 75980fd..a52e033 100644 --- a/vendor/golang.org/x/sys/windows/exec_windows.go +++ b/vendor/golang.org/x/sys/windows/exec_windows.go @@ -95,12 +95,17 @@ func ComposeCommandLine(args []string) string { // DecomposeCommandLine breaks apart its argument command line into unescaped parts using CommandLineToArgv, // as gathered from GetCommandLine, QUERY_SERVICE_CONFIG's BinaryPathName argument, or elsewhere that // command lines are passed around. +// DecomposeCommandLine returns error if commandLine contains NUL. func DecomposeCommandLine(commandLine string) ([]string, error) { if len(commandLine) == 0 { return []string{}, nil } + utf16CommandLine, err := UTF16FromString(commandLine) + if err != nil { + return nil, errorspkg.New("string with NUL passed to DecomposeCommandLine") + } var argc int32 - argv, err := CommandLineToArgv(StringToUTF16Ptr(commandLine), &argc) + argv, err := CommandLineToArgv(&utf16CommandLine[0], &argc) if err != nil { return nil, err } diff --git a/vendor/golang.org/x/sys/windows/service.go b/vendor/golang.org/x/sys/windows/service.go index f8deca8..c44a1b9 100644 --- a/vendor/golang.org/x/sys/windows/service.go +++ b/vendor/golang.org/x/sys/windows/service.go @@ -141,6 +141,12 @@ const ( SERVICE_DYNAMIC_INFORMATION_LEVEL_START_REASON = 1 ) +type ENUM_SERVICE_STATUS struct { + ServiceName *uint16 + DisplayName *uint16 + ServiceStatus SERVICE_STATUS +} + type SERVICE_STATUS struct { ServiceType uint32 CurrentState uint32 @@ -212,6 +218,10 @@ type SERVICE_FAILURE_ACTIONS struct { Actions *SC_ACTION } +type SERVICE_FAILURE_ACTIONS_FLAG struct { + FailureActionsOnNonCrashFailures int32 +} + type SC_ACTION struct { Type uint32 Delay uint32 @@ -245,3 +255,4 @@ type QUERY_SERVICE_LOCK_STATUS struct { //sys UnsubscribeServiceChangeNotifications(subscription uintptr) = sechost.UnsubscribeServiceChangeNotifications? //sys RegisterServiceCtrlHandlerEx(serviceName *uint16, handlerProc uintptr, context uintptr) (handle Handle, err error) = advapi32.RegisterServiceCtrlHandlerExW //sys QueryServiceDynamicInformation(service Handle, infoLevel uint32, dynamicInfo unsafe.Pointer) (err error) = advapi32.QueryServiceDynamicInformation? +//sys EnumDependentServices(service Handle, activityState uint32, services *ENUM_SERVICE_STATUS, buffSize uint32, bytesNeeded *uint32, servicesReturned *uint32) (err error) = advapi32.EnumDependentServicesW diff --git a/vendor/golang.org/x/sys/windows/setupapi_windows.go b/vendor/golang.org/x/sys/windows/setupapi_windows.go index 14027da..f812648 100644 --- a/vendor/golang.org/x/sys/windows/setupapi_windows.go +++ b/vendor/golang.org/x/sys/windows/setupapi_windows.go @@ -296,7 +296,7 @@ const ( // Flag to indicate that the sorting from the INF file should be used. DI_INF_IS_SORTED DI_FLAGS = 0x00008000 - // Flag to indicate that only the the INF specified by SP_DEVINSTALL_PARAMS.DriverPath should be searched. + // Flag to indicate that only the INF specified by SP_DEVINSTALL_PARAMS.DriverPath should be searched. DI_ENUMSINGLEINF DI_FLAGS = 0x00010000 // Flag that prevents ConfigMgr from removing/re-enumerating devices during device diff --git a/vendor/golang.org/x/sys/windows/syscall.go b/vendor/golang.org/x/sys/windows/syscall.go index 72074d5..8732cdb 100644 --- a/vendor/golang.org/x/sys/windows/syscall.go +++ b/vendor/golang.org/x/sys/windows/syscall.go @@ -30,8 +30,6 @@ import ( "strings" "syscall" "unsafe" - - "golang.org/x/sys/internal/unsafeheader" ) // ByteSliceFromString returns a NUL-terminated slice of bytes @@ -83,13 +81,7 @@ func BytePtrToString(p *byte) string { ptr = unsafe.Pointer(uintptr(ptr) + 1) } - var s []byte - h := (*unsafeheader.Slice)(unsafe.Pointer(&s)) - h.Data = unsafe.Pointer(p) - h.Len = n - h.Cap = n - - return string(s) + return string(unsafe.Slice(p, n)) } // Single-word zero for use when we need a valid pointer to 0 bytes. diff --git a/vendor/golang.org/x/sys/windows/syscall_windows.go b/vendor/golang.org/x/sys/windows/syscall_windows.go index be3ec2b..9645900 100644 --- a/vendor/golang.org/x/sys/windows/syscall_windows.go +++ b/vendor/golang.org/x/sys/windows/syscall_windows.go @@ -10,7 +10,6 @@ import ( errorspkg "errors" "fmt" "runtime" - "strings" "sync" "syscall" "time" @@ -87,22 +86,13 @@ func StringToUTF16(s string) []uint16 { // s, with a terminating NUL added. If s contains a NUL byte at any // location, it returns (nil, syscall.EINVAL). func UTF16FromString(s string) ([]uint16, error) { - if strings.IndexByte(s, 0) != -1 { - return nil, syscall.EINVAL - } - return utf16.Encode([]rune(s + "\x00")), nil + return syscall.UTF16FromString(s) } // UTF16ToString returns the UTF-8 encoding of the UTF-16 sequence s, // with a terminating NUL and any bytes after the NUL removed. func UTF16ToString(s []uint16) string { - for i, v := range s { - if v == 0 { - s = s[:i] - break - } - } - return string(utf16.Decode(s)) + return syscall.UTF16ToString(s) } // StringToUTF16Ptr is deprecated. Use UTF16PtrFromString instead. @@ -138,13 +128,7 @@ func UTF16PtrToString(p *uint16) string { ptr = unsafe.Pointer(uintptr(ptr) + unsafe.Sizeof(*p)) } - var s []uint16 - h := (*unsafeheader.Slice)(unsafe.Pointer(&s)) - h.Data = unsafe.Pointer(p) - h.Len = n - h.Cap = n - - return string(utf16.Decode(s)) + return string(utf16.Decode(unsafe.Slice(p, n))) } func Getpagesize() int { return 4096 } @@ -364,6 +348,16 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys SetCommTimeouts(handle Handle, timeouts *CommTimeouts) (err error) //sys GetActiveProcessorCount(groupNumber uint16) (ret uint32) //sys GetMaximumProcessorCount(groupNumber uint16) (ret uint32) +//sys EnumWindows(enumFunc uintptr, param unsafe.Pointer) (err error) = user32.EnumWindows +//sys EnumChildWindows(hwnd HWND, enumFunc uintptr, param unsafe.Pointer) = user32.EnumChildWindows +//sys GetClassName(hwnd HWND, className *uint16, maxCount int32) (copied int32, err error) = user32.GetClassNameW +//sys GetDesktopWindow() (hwnd HWND) = user32.GetDesktopWindow +//sys GetForegroundWindow() (hwnd HWND) = user32.GetForegroundWindow +//sys IsWindow(hwnd HWND) (isWindow bool) = user32.IsWindow +//sys IsWindowUnicode(hwnd HWND) (isUnicode bool) = user32.IsWindowUnicode +//sys IsWindowVisible(hwnd HWND) (isVisible bool) = user32.IsWindowVisible +//sys GetGUIThreadInfo(thread uint32, info *GUIThreadInfo) (err error) = user32.GetGUIThreadInfo +//sys GetLargePageMinimum() (size uintptr) // Volume Management Functions //sys DefineDosDevice(flags uint32, deviceName *uint16, targetPath *uint16) (err error) = DefineDosDeviceW @@ -411,12 +405,13 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys VerQueryValue(block unsafe.Pointer, subBlock string, pointerToBufferPointer unsafe.Pointer, bufSize *uint32) (err error) = version.VerQueryValueW // Process Status API (PSAPI) -//sys EnumProcesses(processIds []uint32, bytesReturned *uint32) (err error) = psapi.EnumProcesses +//sys enumProcesses(processIds *uint32, nSize uint32, bytesReturned *uint32) (err error) = psapi.EnumProcesses //sys EnumProcessModules(process Handle, module *Handle, cb uint32, cbNeeded *uint32) (err error) = psapi.EnumProcessModules //sys EnumProcessModulesEx(process Handle, module *Handle, cb uint32, cbNeeded *uint32, filterFlag uint32) (err error) = psapi.EnumProcessModulesEx //sys GetModuleInformation(process Handle, module Handle, modinfo *ModuleInfo, cb uint32) (err error) = psapi.GetModuleInformation //sys GetModuleFileNameEx(process Handle, module Handle, filename *uint16, size uint32) (err error) = psapi.GetModuleFileNameExW //sys GetModuleBaseName(process Handle, module Handle, baseName *uint16, size uint32) (err error) = psapi.GetModuleBaseNameW +//sys QueryWorkingSetEx(process Handle, pv uintptr, cb uint32) (err error) = psapi.QueryWorkingSetEx // NT Native APIs //sys rtlNtStatusToDosErrorNoTeb(ntstatus NTStatus) (ret syscall.Errno) = ntdll.RtlNtStatusToDosErrorNoTeb @@ -438,6 +433,10 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys RtlAddFunctionTable(functionTable *RUNTIME_FUNCTION, entryCount uint32, baseAddress uintptr) (ret bool) = ntdll.RtlAddFunctionTable //sys RtlDeleteFunctionTable(functionTable *RUNTIME_FUNCTION) (ret bool) = ntdll.RtlDeleteFunctionTable +// Desktop Window Manager API (Dwmapi) +//sys DwmGetWindowAttribute(hwnd HWND, attribute uint32, value unsafe.Pointer, size uint32) (ret error) = dwmapi.DwmGetWindowAttribute +//sys DwmSetWindowAttribute(hwnd HWND, attribute uint32, value unsafe.Pointer, size uint32) (ret error) = dwmapi.DwmSetWindowAttribute + // syscall interface implementation for other packages // GetCurrentProcess returns the handle for the current process. @@ -747,7 +746,7 @@ func Utimes(path string, tv []Timeval) (err error) { if e != nil { return e } - defer Close(h) + defer CloseHandle(h) a := NsecToFiletime(tv[0].Nanoseconds()) w := NsecToFiletime(tv[1].Nanoseconds()) return SetFileTime(h, nil, &a, &w) @@ -767,7 +766,7 @@ func UtimesNano(path string, ts []Timespec) (err error) { if e != nil { return e } - defer Close(h) + defer CloseHandle(h) a := NsecToFiletime(TimespecToNsec(ts[0])) w := NsecToFiletime(TimespecToNsec(ts[1])) return SetFileTime(h, nil, &a, &w) @@ -825,6 +824,9 @@ const socket_error = uintptr(^uint32(0)) //sys WSAStartup(verreq uint32, data *WSAData) (sockerr error) = ws2_32.WSAStartup //sys WSACleanup() (err error) [failretval==socket_error] = ws2_32.WSACleanup //sys WSAIoctl(s Handle, iocc uint32, inbuf *byte, cbif uint32, outbuf *byte, cbob uint32, cbbr *uint32, overlapped *Overlapped, completionRoutine uintptr) (err error) [failretval==socket_error] = ws2_32.WSAIoctl +//sys WSALookupServiceBegin(querySet *WSAQUERYSET, flags uint32, handle *Handle) (err error) [failretval==socket_error] = ws2_32.WSALookupServiceBeginW +//sys WSALookupServiceNext(handle Handle, flags uint32, size *int32, querySet *WSAQUERYSET) (err error) [failretval==socket_error] = ws2_32.WSALookupServiceNextW +//sys WSALookupServiceEnd(handle Handle) (err error) [failretval==socket_error] = ws2_32.WSALookupServiceEnd //sys socket(af int32, typ int32, protocol int32) (handle Handle, err error) [failretval==InvalidHandle] = ws2_32.socket //sys sendto(s Handle, buf []byte, flags int32, to unsafe.Pointer, tolen int32) (err error) [failretval==socket_error] = ws2_32.sendto //sys recvfrom(s Handle, buf []byte, flags int32, from *RawSockaddrAny, fromlen *int32) (n int32, err error) [failretval==-1] = ws2_32.recvfrom @@ -971,6 +973,32 @@ func (sa *SockaddrUnix) sockaddr() (unsafe.Pointer, int32, error) { return unsafe.Pointer(&sa.raw), sl, nil } +type RawSockaddrBth struct { + AddressFamily [2]byte + BtAddr [8]byte + ServiceClassId [16]byte + Port [4]byte +} + +type SockaddrBth struct { + BtAddr uint64 + ServiceClassId GUID + Port uint32 + + raw RawSockaddrBth +} + +func (sa *SockaddrBth) sockaddr() (unsafe.Pointer, int32, error) { + family := AF_BTH + sa.raw = RawSockaddrBth{ + AddressFamily: *(*[2]byte)(unsafe.Pointer(&family)), + BtAddr: *(*[8]byte)(unsafe.Pointer(&sa.BtAddr)), + Port: *(*[4]byte)(unsafe.Pointer(&sa.Port)), + ServiceClassId: *(*[16]byte)(unsafe.Pointer(&sa.ServiceClassId)), + } + return unsafe.Pointer(&sa.raw), int32(unsafe.Sizeof(sa.raw)), nil +} + func (rsa *RawSockaddrAny) Sockaddr() (Sockaddr, error) { switch rsa.Addr.Family { case AF_UNIX: @@ -994,8 +1022,7 @@ func (rsa *RawSockaddrAny) Sockaddr() (Sockaddr, error) { for n < len(pp.Path) && pp.Path[n] != 0 { n++ } - bytes := (*[len(pp.Path)]byte)(unsafe.Pointer(&pp.Path[0]))[0:n] - sa.Name = string(bytes) + sa.Name = string(unsafe.Slice((*byte)(unsafe.Pointer(&pp.Path[0])), n)) return sa, nil case AF_INET: @@ -1081,9 +1108,13 @@ func Shutdown(fd Handle, how int) (err error) { } func WSASendto(s Handle, bufs *WSABuf, bufcnt uint32, sent *uint32, flags uint32, to Sockaddr, overlapped *Overlapped, croutine *byte) (err error) { - rsa, l, err := to.sockaddr() - if err != nil { - return err + var rsa unsafe.Pointer + var l int32 + if to != nil { + rsa, l, err = to.sockaddr() + if err != nil { + return err + } } return WSASendTo(s, bufs, bufcnt, sent, flags, (*RawSockaddrAny)(unsafe.Pointer(rsa)), l, overlapped, croutine) } @@ -1323,6 +1354,17 @@ func SetsockoptIPv6Mreq(fd Handle, level, opt int, mreq *IPv6Mreq) (err error) { return syscall.EWINDOWS } +func EnumProcesses(processIds []uint32, bytesReturned *uint32) error { + // EnumProcesses syscall expects the size parameter to be in bytes, but the code generated with mksyscall uses + // the length of the processIds slice instead. Hence, this wrapper function is added to fix the discrepancy. + var p *uint32 + if len(processIds) > 0 { + p = &processIds[0] + } + size := uint32(len(processIds) * 4) + return enumProcesses(p, size, bytesReturned) +} + func Getpid() (pid int) { return int(GetCurrentProcessId()) } func FindFirstFile(name *uint16, data *Win32finddata) (handle Handle, err error) { @@ -1707,3 +1749,71 @@ func LoadResourceData(module, resInfo Handle) (data []byte, err error) { h.Cap = int(size) return } + +// PSAPI_WORKING_SET_EX_BLOCK contains extended working set information for a page. +type PSAPI_WORKING_SET_EX_BLOCK uint64 + +// Valid returns the validity of this page. +// If this bit is 1, the subsequent members are valid; otherwise they should be ignored. +func (b PSAPI_WORKING_SET_EX_BLOCK) Valid() bool { + return (b & 1) == 1 +} + +// ShareCount is the number of processes that share this page. The maximum value of this member is 7. +func (b PSAPI_WORKING_SET_EX_BLOCK) ShareCount() uint64 { + return b.intField(1, 3) +} + +// Win32Protection is the memory protection attributes of the page. For a list of values, see +// https://docs.microsoft.com/en-us/windows/win32/memory/memory-protection-constants +func (b PSAPI_WORKING_SET_EX_BLOCK) Win32Protection() uint64 { + return b.intField(4, 11) +} + +// Shared returns the shared status of this page. +// If this bit is 1, the page can be shared. +func (b PSAPI_WORKING_SET_EX_BLOCK) Shared() bool { + return (b & (1 << 15)) == 1 +} + +// Node is the NUMA node. The maximum value of this member is 63. +func (b PSAPI_WORKING_SET_EX_BLOCK) Node() uint64 { + return b.intField(16, 6) +} + +// Locked returns the locked status of this page. +// If this bit is 1, the virtual page is locked in physical memory. +func (b PSAPI_WORKING_SET_EX_BLOCK) Locked() bool { + return (b & (1 << 22)) == 1 +} + +// LargePage returns the large page status of this page. +// If this bit is 1, the page is a large page. +func (b PSAPI_WORKING_SET_EX_BLOCK) LargePage() bool { + return (b & (1 << 23)) == 1 +} + +// Bad returns the bad status of this page. +// If this bit is 1, the page is has been reported as bad. +func (b PSAPI_WORKING_SET_EX_BLOCK) Bad() bool { + return (b & (1 << 31)) == 1 +} + +// intField extracts an integer field in the PSAPI_WORKING_SET_EX_BLOCK union. +func (b PSAPI_WORKING_SET_EX_BLOCK) intField(start, length int) uint64 { + var mask PSAPI_WORKING_SET_EX_BLOCK + for pos := start; pos < start+length; pos++ { + mask |= (1 << pos) + } + + masked := b & mask + return uint64(masked >> start) +} + +// PSAPI_WORKING_SET_EX_INFORMATION contains extended working set information for a process. +type PSAPI_WORKING_SET_EX_INFORMATION struct { + // The virtual address. + VirtualAddress Pointer + // A PSAPI_WORKING_SET_EX_BLOCK union that indicates the attributes of the page at VirtualAddress. + VirtualAttributes PSAPI_WORKING_SET_EX_BLOCK +} diff --git a/vendor/golang.org/x/sys/windows/types_windows.go b/vendor/golang.org/x/sys/windows/types_windows.go index f9eaca5..88e62a6 100644 --- a/vendor/golang.org/x/sys/windows/types_windows.go +++ b/vendor/golang.org/x/sys/windows/types_windows.go @@ -1243,6 +1243,51 @@ const ( DnsSectionAdditional = 0x0003 ) +const ( + // flags of WSALookupService + LUP_DEEP = 0x0001 + LUP_CONTAINERS = 0x0002 + LUP_NOCONTAINERS = 0x0004 + LUP_NEAREST = 0x0008 + LUP_RETURN_NAME = 0x0010 + LUP_RETURN_TYPE = 0x0020 + LUP_RETURN_VERSION = 0x0040 + LUP_RETURN_COMMENT = 0x0080 + LUP_RETURN_ADDR = 0x0100 + LUP_RETURN_BLOB = 0x0200 + LUP_RETURN_ALIASES = 0x0400 + LUP_RETURN_QUERY_STRING = 0x0800 + LUP_RETURN_ALL = 0x0FF0 + LUP_RES_SERVICE = 0x8000 + + LUP_FLUSHCACHE = 0x1000 + LUP_FLUSHPREVIOUS = 0x2000 + + LUP_NON_AUTHORITATIVE = 0x4000 + LUP_SECURE = 0x8000 + LUP_RETURN_PREFERRED_NAMES = 0x10000 + LUP_DNS_ONLY = 0x20000 + + LUP_ADDRCONFIG = 0x100000 + LUP_DUAL_ADDR = 0x200000 + LUP_FILESERVER = 0x400000 + LUP_DISABLE_IDN_ENCODING = 0x00800000 + LUP_API_ANSI = 0x01000000 + + LUP_RESOLUTION_HANDLE = 0x80000000 +) + +const ( + // values of WSAQUERYSET's namespace + NS_ALL = 0 + NS_DNS = 12 + NS_NLA = 15 + NS_BTH = 16 + NS_EMAIL = 37 + NS_PNRPNAME = 38 + NS_PNRPCLOUD = 39 +) + type DNSSRVData struct { Target *uint16 Priority uint16 @@ -2175,19 +2220,23 @@ type JOBOBJECT_BASIC_UI_RESTRICTIONS struct { } const ( - // JobObjectInformationClass + // JobObjectInformationClass for QueryInformationJobObject and SetInformationJobObject JobObjectAssociateCompletionPortInformation = 7 + JobObjectBasicAccountingInformation = 1 + JobObjectBasicAndIoAccountingInformation = 8 JobObjectBasicLimitInformation = 2 + JobObjectBasicProcessIdList = 3 JobObjectBasicUIRestrictions = 4 JobObjectCpuRateControlInformation = 15 JobObjectEndOfJobTimeInformation = 6 JobObjectExtendedLimitInformation = 9 JobObjectGroupInformation = 11 JobObjectGroupInformationEx = 14 - JobObjectLimitViolationInformation2 = 35 + JobObjectLimitViolationInformation = 13 + JobObjectLimitViolationInformation2 = 34 JobObjectNetRateControlInformation = 32 JobObjectNotificationLimitInformation = 12 - JobObjectNotificationLimitInformation2 = 34 + JobObjectNotificationLimitInformation2 = 33 JobObjectSecurityLimitInformation = 5 ) @@ -3213,3 +3262,88 @@ type ModuleInfo struct { } const ALL_PROCESSOR_GROUPS = 0xFFFF + +type Rect struct { + Left int32 + Top int32 + Right int32 + Bottom int32 +} + +type GUIThreadInfo struct { + Size uint32 + Flags uint32 + Active HWND + Focus HWND + Capture HWND + MenuOwner HWND + MoveSize HWND + CaretHandle HWND + CaretRect Rect +} + +const ( + DWMWA_NCRENDERING_ENABLED = 1 + DWMWA_NCRENDERING_POLICY = 2 + DWMWA_TRANSITIONS_FORCEDISABLED = 3 + DWMWA_ALLOW_NCPAINT = 4 + DWMWA_CAPTION_BUTTON_BOUNDS = 5 + DWMWA_NONCLIENT_RTL_LAYOUT = 6 + DWMWA_FORCE_ICONIC_REPRESENTATION = 7 + DWMWA_FLIP3D_POLICY = 8 + DWMWA_EXTENDED_FRAME_BOUNDS = 9 + DWMWA_HAS_ICONIC_BITMAP = 10 + DWMWA_DISALLOW_PEEK = 11 + DWMWA_EXCLUDED_FROM_PEEK = 12 + DWMWA_CLOAK = 13 + DWMWA_CLOAKED = 14 + DWMWA_FREEZE_REPRESENTATION = 15 + DWMWA_PASSIVE_UPDATE_MODE = 16 + DWMWA_USE_HOSTBACKDROPBRUSH = 17 + DWMWA_USE_IMMERSIVE_DARK_MODE = 20 + DWMWA_WINDOW_CORNER_PREFERENCE = 33 + DWMWA_BORDER_COLOR = 34 + DWMWA_CAPTION_COLOR = 35 + DWMWA_TEXT_COLOR = 36 + DWMWA_VISIBLE_FRAME_BORDER_THICKNESS = 37 +) + +type WSAQUERYSET struct { + Size uint32 + ServiceInstanceName *uint16 + ServiceClassId *GUID + Version *WSAVersion + Comment *uint16 + NameSpace uint32 + NSProviderId *GUID + Context *uint16 + NumberOfProtocols uint32 + AfpProtocols *AFProtocols + QueryString *uint16 + NumberOfCsAddrs uint32 + SaBuffer *CSAddrInfo + OutputFlags uint32 + Blob *BLOB +} + +type WSAVersion struct { + Version uint32 + EnumerationOfComparison int32 +} + +type AFProtocols struct { + AddressFamily int32 + Protocol int32 +} + +type CSAddrInfo struct { + LocalAddr SocketAddress + RemoteAddr SocketAddress + SocketType int32 + Protocol int32 +} + +type BLOB struct { + Size uint32 + BlobData *byte +} diff --git a/vendor/golang.org/x/sys/windows/zsyscall_windows.go b/vendor/golang.org/x/sys/windows/zsyscall_windows.go index 678262c..566dd3e 100644 --- a/vendor/golang.org/x/sys/windows/zsyscall_windows.go +++ b/vendor/golang.org/x/sys/windows/zsyscall_windows.go @@ -40,6 +40,7 @@ var ( modadvapi32 = NewLazySystemDLL("advapi32.dll") modcrypt32 = NewLazySystemDLL("crypt32.dll") moddnsapi = NewLazySystemDLL("dnsapi.dll") + moddwmapi = NewLazySystemDLL("dwmapi.dll") modiphlpapi = NewLazySystemDLL("iphlpapi.dll") modkernel32 = NewLazySystemDLL("kernel32.dll") modmswsock = NewLazySystemDLL("mswsock.dll") @@ -85,6 +86,7 @@ var ( procDeleteService = modadvapi32.NewProc("DeleteService") procDeregisterEventSource = modadvapi32.NewProc("DeregisterEventSource") procDuplicateTokenEx = modadvapi32.NewProc("DuplicateTokenEx") + procEnumDependentServicesW = modadvapi32.NewProc("EnumDependentServicesW") procEnumServicesStatusExW = modadvapi32.NewProc("EnumServicesStatusExW") procEqualSid = modadvapi32.NewProc("EqualSid") procFreeSid = modadvapi32.NewProc("FreeSid") @@ -175,6 +177,8 @@ var ( procDnsNameCompare_W = moddnsapi.NewProc("DnsNameCompare_W") procDnsQuery_W = moddnsapi.NewProc("DnsQuery_W") procDnsRecordListFree = moddnsapi.NewProc("DnsRecordListFree") + procDwmGetWindowAttribute = moddwmapi.NewProc("DwmGetWindowAttribute") + procDwmSetWindowAttribute = moddwmapi.NewProc("DwmSetWindowAttribute") procGetAdaptersAddresses = modiphlpapi.NewProc("GetAdaptersAddresses") procGetAdaptersInfo = modiphlpapi.NewProc("GetAdaptersInfo") procGetBestInterfaceEx = modiphlpapi.NewProc("GetBestInterfaceEx") @@ -249,6 +253,7 @@ var ( procGetFileType = modkernel32.NewProc("GetFileType") procGetFinalPathNameByHandleW = modkernel32.NewProc("GetFinalPathNameByHandleW") procGetFullPathNameW = modkernel32.NewProc("GetFullPathNameW") + procGetLargePageMinimum = modkernel32.NewProc("GetLargePageMinimum") procGetLastError = modkernel32.NewProc("GetLastError") procGetLogicalDriveStringsW = modkernel32.NewProc("GetLogicalDriveStringsW") procGetLogicalDrives = modkernel32.NewProc("GetLogicalDrives") @@ -408,6 +413,7 @@ var ( procGetModuleBaseNameW = modpsapi.NewProc("GetModuleBaseNameW") procGetModuleFileNameExW = modpsapi.NewProc("GetModuleFileNameExW") procGetModuleInformation = modpsapi.NewProc("GetModuleInformation") + procQueryWorkingSetEx = modpsapi.NewProc("QueryWorkingSetEx") procSubscribeServiceChangeNotifications = modsechost.NewProc("SubscribeServiceChangeNotifications") procUnsubscribeServiceChangeNotifications = modsechost.NewProc("UnsubscribeServiceChangeNotifications") procGetUserNameExW = modsecur32.NewProc("GetUserNameExW") @@ -443,9 +449,18 @@ var ( procCommandLineToArgvW = modshell32.NewProc("CommandLineToArgvW") procSHGetKnownFolderPath = modshell32.NewProc("SHGetKnownFolderPath") procShellExecuteW = modshell32.NewProc("ShellExecuteW") + procEnumChildWindows = moduser32.NewProc("EnumChildWindows") + procEnumWindows = moduser32.NewProc("EnumWindows") procExitWindowsEx = moduser32.NewProc("ExitWindowsEx") + procGetClassNameW = moduser32.NewProc("GetClassNameW") + procGetDesktopWindow = moduser32.NewProc("GetDesktopWindow") + procGetForegroundWindow = moduser32.NewProc("GetForegroundWindow") + procGetGUIThreadInfo = moduser32.NewProc("GetGUIThreadInfo") procGetShellWindow = moduser32.NewProc("GetShellWindow") procGetWindowThreadProcessId = moduser32.NewProc("GetWindowThreadProcessId") + procIsWindow = moduser32.NewProc("IsWindow") + procIsWindowUnicode = moduser32.NewProc("IsWindowUnicode") + procIsWindowVisible = moduser32.NewProc("IsWindowVisible") procMessageBoxW = moduser32.NewProc("MessageBoxW") procCreateEnvironmentBlock = moduserenv.NewProc("CreateEnvironmentBlock") procDestroyEnvironmentBlock = moduserenv.NewProc("DestroyEnvironmentBlock") @@ -460,6 +475,9 @@ var ( procWSAEnumProtocolsW = modws2_32.NewProc("WSAEnumProtocolsW") procWSAGetOverlappedResult = modws2_32.NewProc("WSAGetOverlappedResult") procWSAIoctl = modws2_32.NewProc("WSAIoctl") + procWSALookupServiceBeginW = modws2_32.NewProc("WSALookupServiceBeginW") + procWSALookupServiceEnd = modws2_32.NewProc("WSALookupServiceEnd") + procWSALookupServiceNextW = modws2_32.NewProc("WSALookupServiceNextW") procWSARecv = modws2_32.NewProc("WSARecv") procWSARecvFrom = modws2_32.NewProc("WSARecvFrom") procWSASend = modws2_32.NewProc("WSASend") @@ -717,6 +735,14 @@ func DuplicateTokenEx(existingToken Token, desiredAccess uint32, tokenAttributes return } +func EnumDependentServices(service Handle, activityState uint32, services *ENUM_SERVICE_STATUS, buffSize uint32, bytesNeeded *uint32, servicesReturned *uint32) (err error) { + r1, _, e1 := syscall.Syscall6(procEnumDependentServicesW.Addr(), 6, uintptr(service), uintptr(activityState), uintptr(unsafe.Pointer(services)), uintptr(buffSize), uintptr(unsafe.Pointer(bytesNeeded)), uintptr(unsafe.Pointer(servicesReturned))) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + func EnumServicesStatusEx(mgr Handle, infoLevel uint32, serviceType uint32, serviceState uint32, services *byte, bufSize uint32, bytesNeeded *uint32, servicesReturned *uint32, resumeHandle *uint32, groupName *uint16) (err error) { r1, _, e1 := syscall.Syscall12(procEnumServicesStatusExW.Addr(), 10, uintptr(mgr), uintptr(infoLevel), uintptr(serviceType), uintptr(serviceState), uintptr(unsafe.Pointer(services)), uintptr(bufSize), uintptr(unsafe.Pointer(bytesNeeded)), uintptr(unsafe.Pointer(servicesReturned)), uintptr(unsafe.Pointer(resumeHandle)), uintptr(unsafe.Pointer(groupName)), 0, 0) if r1 == 0 { @@ -1524,6 +1550,22 @@ func DnsRecordListFree(rl *DNSRecord, freetype uint32) { return } +func DwmGetWindowAttribute(hwnd HWND, attribute uint32, value unsafe.Pointer, size uint32) (ret error) { + r0, _, _ := syscall.Syscall6(procDwmGetWindowAttribute.Addr(), 4, uintptr(hwnd), uintptr(attribute), uintptr(value), uintptr(size), 0, 0) + if r0 != 0 { + ret = syscall.Errno(r0) + } + return +} + +func DwmSetWindowAttribute(hwnd HWND, attribute uint32, value unsafe.Pointer, size uint32) (ret error) { + r0, _, _ := syscall.Syscall6(procDwmSetWindowAttribute.Addr(), 4, uintptr(hwnd), uintptr(attribute), uintptr(value), uintptr(size), 0, 0) + if r0 != 0 { + ret = syscall.Errno(r0) + } + return +} + func GetAdaptersAddresses(family uint32, flags uint32, reserved uintptr, adapterAddresses *IpAdapterAddresses, sizePointer *uint32) (errcode error) { r0, _, _ := syscall.Syscall6(procGetAdaptersAddresses.Addr(), 5, uintptr(family), uintptr(flags), uintptr(reserved), uintptr(unsafe.Pointer(adapterAddresses)), uintptr(unsafe.Pointer(sizePointer)), 0) if r0 != 0 { @@ -2151,6 +2193,12 @@ func GetFullPathName(path *uint16, buflen uint32, buf *uint16, fname **uint16) ( return } +func GetLargePageMinimum() (size uintptr) { + r0, _, _ := syscall.Syscall(procGetLargePageMinimum.Addr(), 0, 0, 0, 0) + size = uintptr(r0) + return +} + func GetLastError() (lasterr error) { r0, _, _ := syscall.Syscall(procGetLastError.Addr(), 0, 0, 0, 0) if r0 != 0 { @@ -3468,12 +3516,8 @@ func EnumProcessModulesEx(process Handle, module *Handle, cb uint32, cbNeeded *u return } -func EnumProcesses(processIds []uint32, bytesReturned *uint32) (err error) { - var _p0 *uint32 - if len(processIds) > 0 { - _p0 = &processIds[0] - } - r1, _, e1 := syscall.Syscall(procEnumProcesses.Addr(), 3, uintptr(unsafe.Pointer(_p0)), uintptr(len(processIds)), uintptr(unsafe.Pointer(bytesReturned))) +func enumProcesses(processIds *uint32, nSize uint32, bytesReturned *uint32) (err error) { + r1, _, e1 := syscall.Syscall(procEnumProcesses.Addr(), 3, uintptr(unsafe.Pointer(processIds)), uintptr(nSize), uintptr(unsafe.Pointer(bytesReturned))) if r1 == 0 { err = errnoErr(e1) } @@ -3504,6 +3548,14 @@ func GetModuleInformation(process Handle, module Handle, modinfo *ModuleInfo, cb return } +func QueryWorkingSetEx(process Handle, pv uintptr, cb uint32) (err error) { + r1, _, e1 := syscall.Syscall(procQueryWorkingSetEx.Addr(), 3, uintptr(process), uintptr(pv), uintptr(cb)) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + func SubscribeServiceChangeNotifications(service Handle, eventType uint32, callback uintptr, callbackCtx uintptr, subscription *uintptr) (ret error) { ret = procSubscribeServiceChangeNotifications.Find() if ret != nil { @@ -3793,6 +3845,19 @@ func ShellExecute(hwnd Handle, verb *uint16, file *uint16, args *uint16, cwd *ui return } +func EnumChildWindows(hwnd HWND, enumFunc uintptr, param unsafe.Pointer) { + syscall.Syscall(procEnumChildWindows.Addr(), 3, uintptr(hwnd), uintptr(enumFunc), uintptr(param)) + return +} + +func EnumWindows(enumFunc uintptr, param unsafe.Pointer) (err error) { + r1, _, e1 := syscall.Syscall(procEnumWindows.Addr(), 2, uintptr(enumFunc), uintptr(param), 0) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + func ExitWindowsEx(flags uint32, reason uint32) (err error) { r1, _, e1 := syscall.Syscall(procExitWindowsEx.Addr(), 2, uintptr(flags), uintptr(reason), 0) if r1 == 0 { @@ -3801,6 +3866,35 @@ func ExitWindowsEx(flags uint32, reason uint32) (err error) { return } +func GetClassName(hwnd HWND, className *uint16, maxCount int32) (copied int32, err error) { + r0, _, e1 := syscall.Syscall(procGetClassNameW.Addr(), 3, uintptr(hwnd), uintptr(unsafe.Pointer(className)), uintptr(maxCount)) + copied = int32(r0) + if copied == 0 { + err = errnoErr(e1) + } + return +} + +func GetDesktopWindow() (hwnd HWND) { + r0, _, _ := syscall.Syscall(procGetDesktopWindow.Addr(), 0, 0, 0, 0) + hwnd = HWND(r0) + return +} + +func GetForegroundWindow() (hwnd HWND) { + r0, _, _ := syscall.Syscall(procGetForegroundWindow.Addr(), 0, 0, 0, 0) + hwnd = HWND(r0) + return +} + +func GetGUIThreadInfo(thread uint32, info *GUIThreadInfo) (err error) { + r1, _, e1 := syscall.Syscall(procGetGUIThreadInfo.Addr(), 2, uintptr(thread), uintptr(unsafe.Pointer(info)), 0) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + func GetShellWindow() (shellWindow HWND) { r0, _, _ := syscall.Syscall(procGetShellWindow.Addr(), 0, 0, 0, 0) shellWindow = HWND(r0) @@ -3816,6 +3910,24 @@ func GetWindowThreadProcessId(hwnd HWND, pid *uint32) (tid uint32, err error) { return } +func IsWindow(hwnd HWND) (isWindow bool) { + r0, _, _ := syscall.Syscall(procIsWindow.Addr(), 1, uintptr(hwnd), 0, 0) + isWindow = r0 != 0 + return +} + +func IsWindowUnicode(hwnd HWND) (isUnicode bool) { + r0, _, _ := syscall.Syscall(procIsWindowUnicode.Addr(), 1, uintptr(hwnd), 0, 0) + isUnicode = r0 != 0 + return +} + +func IsWindowVisible(hwnd HWND) (isVisible bool) { + r0, _, _ := syscall.Syscall(procIsWindowVisible.Addr(), 1, uintptr(hwnd), 0, 0) + isVisible = r0 != 0 + return +} + func MessageBox(hwnd HWND, text *uint16, caption *uint16, boxtype uint32) (ret int32, err error) { r0, _, e1 := syscall.Syscall6(procMessageBoxW.Addr(), 4, uintptr(hwnd), uintptr(unsafe.Pointer(text)), uintptr(unsafe.Pointer(caption)), uintptr(boxtype), 0, 0) ret = int32(r0) @@ -3963,6 +4075,30 @@ func WSAIoctl(s Handle, iocc uint32, inbuf *byte, cbif uint32, outbuf *byte, cbo return } +func WSALookupServiceBegin(querySet *WSAQUERYSET, flags uint32, handle *Handle) (err error) { + r1, _, e1 := syscall.Syscall(procWSALookupServiceBeginW.Addr(), 3, uintptr(unsafe.Pointer(querySet)), uintptr(flags), uintptr(unsafe.Pointer(handle))) + if r1 == socket_error { + err = errnoErr(e1) + } + return +} + +func WSALookupServiceEnd(handle Handle) (err error) { + r1, _, e1 := syscall.Syscall(procWSALookupServiceEnd.Addr(), 1, uintptr(handle), 0, 0) + if r1 == socket_error { + err = errnoErr(e1) + } + return +} + +func WSALookupServiceNext(handle Handle, flags uint32, size *int32, querySet *WSAQUERYSET) (err error) { + r1, _, e1 := syscall.Syscall6(procWSALookupServiceNextW.Addr(), 4, uintptr(handle), uintptr(flags), uintptr(unsafe.Pointer(size)), uintptr(unsafe.Pointer(querySet)), 0, 0) + if r1 == socket_error { + err = errnoErr(e1) + } + return +} + func WSARecv(s Handle, bufs *WSABuf, bufcnt uint32, recvd *uint32, flags *uint32, overlapped *Overlapped, croutine *byte) (err error) { r1, _, e1 := syscall.Syscall9(procWSARecv.Addr(), 7, uintptr(s), uintptr(unsafe.Pointer(bufs)), uintptr(bufcnt), uintptr(unsafe.Pointer(recvd)), uintptr(unsafe.Pointer(flags)), uintptr(unsafe.Pointer(overlapped)), uintptr(unsafe.Pointer(croutine)), 0, 0) if r1 == socket_error { diff --git a/vendor/golang.org/x/text/AUTHORS b/vendor/golang.org/x/text/AUTHORS deleted file mode 100644 index 15167cd..0000000 --- a/vendor/golang.org/x/text/AUTHORS +++ /dev/null @@ -1,3 +0,0 @@ -# This source code refers to The Go Authors for copyright purposes. -# The master list of authors is in the main Go distribution, -# visible at http://tip.golang.org/AUTHORS. diff --git a/vendor/golang.org/x/text/CONTRIBUTORS b/vendor/golang.org/x/text/CONTRIBUTORS deleted file mode 100644 index 1c4577e..0000000 --- a/vendor/golang.org/x/text/CONTRIBUTORS +++ /dev/null @@ -1,3 +0,0 @@ -# This source code was written by the Go contributors. -# The master list of contributors is in the main Go distribution, -# visible at http://tip.golang.org/CONTRIBUTORS. diff --git a/vendor/golang.org/x/text/internal/language/compact/language.go b/vendor/golang.org/x/text/internal/language/compact/language.go index 83816a7..8c1b666 100644 --- a/vendor/golang.org/x/text/internal/language/compact/language.go +++ b/vendor/golang.org/x/text/internal/language/compact/language.go @@ -118,7 +118,7 @@ func (t Tag) Parent() Tag { return Tag{language: lang, locale: lang} } -// returns token t and the rest of the string. +// nextToken returns token t and the rest of the string. func nextToken(s string) (t, tail string) { p := strings.Index(s[1:], "-") if p == -1 { diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go index fe7ad9e..a09ed19 100644 --- a/vendor/golang.org/x/text/internal/language/compact/tables.go +++ b/vendor/golang.org/x/text/internal/language/compact/tables.go @@ -790,226 +790,226 @@ const ( var coreTags = []language.CompactCoreInfo{ // 773 elements // Entry 0 - 1F - 0x00000000, 0x01600000, 0x016000d2, 0x01600161, - 0x01c00000, 0x01c00052, 0x02100000, 0x02100080, - 0x02700000, 0x0270006f, 0x03a00000, 0x03a00001, - 0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067, - 0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097, - 0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac, - 0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9, - 0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108, + 0x00000000, 0x01600000, 0x016000d3, 0x01600162, + 0x01c00000, 0x01c00052, 0x02100000, 0x02100081, + 0x02700000, 0x02700070, 0x03a00000, 0x03a00001, + 0x03a00023, 0x03a00039, 0x03a00063, 0x03a00068, + 0x03a0006c, 0x03a0006d, 0x03a0006e, 0x03a00098, + 0x03a0009c, 0x03a000a2, 0x03a000a9, 0x03a000ad, + 0x03a000b1, 0x03a000ba, 0x03a000bb, 0x03a000ca, + 0x03a000e2, 0x03a000ee, 0x03a000f4, 0x03a00109, // Entry 20 - 3F - 0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c, - 0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000, - 0x04300000, 0x04300099, 0x04400000, 0x0440012f, - 0x04800000, 0x0480006e, 0x05800000, 0x05820000, - 0x05820032, 0x0585a000, 0x0585a032, 0x05e00000, + 0x03a0010c, 0x03a00116, 0x03a00118, 0x03a0011d, + 0x03a00121, 0x03a00129, 0x03a0015f, 0x04000000, + 0x04300000, 0x0430009a, 0x04400000, 0x04400130, + 0x04800000, 0x0480006f, 0x05800000, 0x05820000, + 0x05820032, 0x0585b000, 0x0585b032, 0x05e00000, 0x05e00052, 0x07100000, 0x07100047, 0x07500000, - 0x07500162, 0x07900000, 0x0790012f, 0x07e00000, - 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3, + 0x07500163, 0x07900000, 0x07900130, 0x07e00000, + 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c4, // Entry 40 - 5F - 0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000, - 0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078, - 0x0b500000, 0x0b500099, 0x0b700000, 0x0b720000, - 0x0b720033, 0x0b75a000, 0x0b75a033, 0x0d700000, - 0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e, - 0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000, - 0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000, - 0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c, + 0x0a500000, 0x0a500035, 0x0a50009a, 0x0a900000, + 0x0a900053, 0x0a90009a, 0x0b200000, 0x0b200079, + 0x0b500000, 0x0b50009a, 0x0b700000, 0x0b720000, + 0x0b720033, 0x0b75b000, 0x0b75b033, 0x0d700000, + 0x0d700022, 0x0d70006f, 0x0d700079, 0x0d70009f, + 0x0db00000, 0x0db00035, 0x0db0009a, 0x0dc00000, + 0x0dc00107, 0x0df00000, 0x0df00132, 0x0e500000, + 0x0e500136, 0x0e900000, 0x0e90009c, 0x0e90009d, // Entry 60 - 7F - 0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106, - 0x10000000, 0x1000007b, 0x10100000, 0x10100063, - 0x10100082, 0x10800000, 0x108000a4, 0x10d00000, - 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060, - 0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000, - 0x117000d4, 0x11f00000, 0x11f00060, 0x12400000, - 0x12400052, 0x12800000, 0x12b00000, 0x12b00114, - 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4, + 0x0fa00000, 0x0fa0005f, 0x0fe00000, 0x0fe00107, + 0x10000000, 0x1000007c, 0x10100000, 0x10100064, + 0x10100083, 0x10800000, 0x108000a5, 0x10d00000, + 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00061, + 0x10d0009f, 0x10d000b3, 0x10d000b8, 0x11700000, + 0x117000d5, 0x11f00000, 0x11f00061, 0x12400000, + 0x12400052, 0x12800000, 0x12b00000, 0x12b00115, + 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a5, // Entry 80 - 9F - 0x13000000, 0x13000080, 0x13000122, 0x13600000, - 0x1360005d, 0x13600087, 0x13900000, 0x13900001, + 0x13000000, 0x13000081, 0x13000123, 0x13600000, + 0x1360005e, 0x13600088, 0x13900000, 0x13900001, 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, - 0x13900050, 0x13900052, 0x1390005c, 0x1390005d, - 0x13900060, 0x13900061, 0x13900063, 0x13900064, + 0x13900050, 0x13900052, 0x1390005d, 0x1390005e, + 0x13900061, 0x13900062, 0x13900064, 0x13900065, // Entry A0 - BF - 0x1390006d, 0x13900072, 0x13900073, 0x13900074, - 0x13900075, 0x1390007b, 0x1390007c, 0x1390007f, - 0x13900080, 0x13900081, 0x13900083, 0x1390008a, - 0x1390008c, 0x1390008d, 0x13900096, 0x13900097, - 0x13900098, 0x13900099, 0x1390009a, 0x1390009f, - 0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9, - 0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5, - 0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7, + 0x1390006e, 0x13900073, 0x13900074, 0x13900075, + 0x13900076, 0x1390007c, 0x1390007d, 0x13900080, + 0x13900081, 0x13900082, 0x13900084, 0x1390008b, + 0x1390008d, 0x1390008e, 0x13900097, 0x13900098, + 0x13900099, 0x1390009a, 0x1390009b, 0x139000a0, + 0x139000a1, 0x139000a5, 0x139000a8, 0x139000aa, + 0x139000ae, 0x139000b2, 0x139000b5, 0x139000b6, + 0x139000c0, 0x139000c1, 0x139000c7, 0x139000c8, // Entry C0 - DF - 0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce, - 0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6, - 0x139000d9, 0x139000dd, 0x139000df, 0x139000e0, - 0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb, - 0x139000ec, 0x139000f0, 0x13900107, 0x13900109, - 0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d, - 0x1390010e, 0x1390010f, 0x13900112, 0x13900117, - 0x1390011b, 0x1390011d, 0x1390011f, 0x13900125, + 0x139000cb, 0x139000cc, 0x139000cd, 0x139000cf, + 0x139000d1, 0x139000d3, 0x139000d6, 0x139000d7, + 0x139000da, 0x139000de, 0x139000e0, 0x139000e1, + 0x139000e7, 0x139000e8, 0x139000e9, 0x139000ec, + 0x139000ed, 0x139000f1, 0x13900108, 0x1390010a, + 0x1390010b, 0x1390010c, 0x1390010d, 0x1390010e, + 0x1390010f, 0x13900110, 0x13900113, 0x13900118, + 0x1390011c, 0x1390011e, 0x13900120, 0x13900126, // Entry E0 - FF - 0x13900129, 0x1390012c, 0x1390012d, 0x1390012f, - 0x13900131, 0x13900133, 0x13900135, 0x13900139, - 0x1390013c, 0x1390013d, 0x1390013f, 0x13900142, - 0x13900161, 0x13900162, 0x13900164, 0x13c00000, + 0x1390012a, 0x1390012d, 0x1390012e, 0x13900130, + 0x13900132, 0x13900134, 0x13900136, 0x1390013a, + 0x1390013d, 0x1390013e, 0x13900140, 0x13900143, + 0x13900162, 0x13900163, 0x13900165, 0x13c00000, 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, - 0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065, - 0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086, + 0x13e00054, 0x13e00057, 0x13e0005a, 0x13e00066, + 0x13e00069, 0x13e0006a, 0x13e0006f, 0x13e00087, // Entry 100 - 11F - 0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf, - 0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7, - 0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135, - 0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a, - 0x14500000, 0x1450006e, 0x14600000, 0x14600052, - 0x14800000, 0x14800024, 0x1480009c, 0x14e00000, - 0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114, - 0x15100000, 0x15100072, 0x15300000, 0x153000e7, + 0x13e0008a, 0x13e00090, 0x13e00095, 0x13e000d0, + 0x13e000d9, 0x13e000e3, 0x13e000e5, 0x13e000e8, + 0x13e000ed, 0x13e000f2, 0x13e0011b, 0x13e00136, + 0x13e00137, 0x13e0013c, 0x14000000, 0x1400006b, + 0x14500000, 0x1450006f, 0x14600000, 0x14600052, + 0x14800000, 0x14800024, 0x1480009d, 0x14e00000, + 0x14e00052, 0x14e00085, 0x14e000ca, 0x14e00115, + 0x15100000, 0x15100073, 0x15300000, 0x153000e8, // Entry 120 - 13F - 0x15800000, 0x15800063, 0x15800076, 0x15e00000, + 0x15800000, 0x15800064, 0x15800077, 0x15e00000, 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, - 0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a, - 0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086, - 0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba, - 0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3, + 0x15e00063, 0x15e00068, 0x15e00079, 0x15e0007b, + 0x15e0007f, 0x15e00085, 0x15e00086, 0x15e00087, + 0x15e00092, 0x15e000a9, 0x15e000b8, 0x15e000bb, + 0x15e000bc, 0x15e000bf, 0x15e000c0, 0x15e000c4, // Entry 140 - 15F - 0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3, - 0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102, - 0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c, - 0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f, - 0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e, - 0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096, - 0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e, - 0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2, + 0x15e000c9, 0x15e000ca, 0x15e000cd, 0x15e000d4, + 0x15e000d5, 0x15e000e6, 0x15e000eb, 0x15e00103, + 0x15e00108, 0x15e0010b, 0x15e00115, 0x15e0011d, + 0x15e00121, 0x15e00123, 0x15e00129, 0x15e00140, + 0x15e00141, 0x15e00160, 0x16900000, 0x1690009f, + 0x16d00000, 0x16d000da, 0x16e00000, 0x16e00097, + 0x17e00000, 0x17e0007c, 0x19000000, 0x1900006f, + 0x1a300000, 0x1a30004e, 0x1a300079, 0x1a3000b3, // Entry 160 - 17F - 0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000, - 0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000, - 0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000, - 0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000, - 0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090, - 0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092, - 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095, - 0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053, + 0x1a400000, 0x1a40009a, 0x1a900000, 0x1ab00000, + 0x1ab000a5, 0x1ac00000, 0x1ac00099, 0x1b400000, + 0x1b400081, 0x1b4000d5, 0x1b4000d7, 0x1b800000, + 0x1b800136, 0x1bc00000, 0x1bc00098, 0x1be00000, + 0x1be0009a, 0x1d100000, 0x1d100033, 0x1d100091, + 0x1d200000, 0x1d200061, 0x1d500000, 0x1d500093, + 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100096, + 0x1e700000, 0x1e7000d7, 0x1ea00000, 0x1ea00053, // Entry 180 - 19F - 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d, - 0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113, - 0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000, - 0x200000a2, 0x20300000, 0x20700000, 0x20700052, - 0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000, - 0x20f00000, 0x21000000, 0x2100007d, 0x21200000, - 0x21200067, 0x21600000, 0x21700000, 0x217000a4, - 0x21f00000, 0x22300000, 0x2230012f, 0x22700000, + 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009e, + 0x1f900000, 0x1f90004e, 0x1f90009f, 0x1f900114, + 0x1f900139, 0x1fa00000, 0x1fb00000, 0x20000000, + 0x200000a3, 0x20300000, 0x20700000, 0x20700052, + 0x20800000, 0x20a00000, 0x20a00130, 0x20e00000, + 0x20f00000, 0x21000000, 0x2100007e, 0x21200000, + 0x21200068, 0x21600000, 0x21700000, 0x217000a5, + 0x21f00000, 0x22300000, 0x22300130, 0x22700000, // Entry 1A0 - 1BF - 0x2270005a, 0x23400000, 0x234000c3, 0x23900000, - 0x239000a4, 0x24200000, 0x242000ae, 0x24400000, - 0x24400052, 0x24500000, 0x24500082, 0x24600000, - 0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000, - 0x25100099, 0x25400000, 0x254000aa, 0x254000ab, - 0x25600000, 0x25600099, 0x26a00000, 0x26a00099, - 0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052, - 0x26e00000, 0x26e00060, 0x27400000, 0x28100000, + 0x2270005b, 0x23400000, 0x234000c4, 0x23900000, + 0x239000a5, 0x24200000, 0x242000af, 0x24400000, + 0x24400052, 0x24500000, 0x24500083, 0x24600000, + 0x246000a5, 0x24a00000, 0x24a000a7, 0x25100000, + 0x2510009a, 0x25400000, 0x254000ab, 0x254000ac, + 0x25600000, 0x2560009a, 0x26a00000, 0x26a0009a, + 0x26b00000, 0x26b00130, 0x26d00000, 0x26d00052, + 0x26e00000, 0x26e00061, 0x27400000, 0x28100000, // Entry 1C0 - 1DF - 0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000, - 0x2910012f, 0x29500000, 0x295000b7, 0x2a300000, - 0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000, + 0x2810007c, 0x28a00000, 0x28a000a6, 0x29100000, + 0x29100130, 0x29500000, 0x295000b8, 0x2a300000, + 0x2a300132, 0x2af00000, 0x2af00136, 0x2b500000, 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, - 0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b, - 0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000, - 0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000, - 0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000, + 0x2b800000, 0x2b8000b0, 0x2bf00000, 0x2bf0009c, + 0x2bf0009d, 0x2c000000, 0x2c0000b7, 0x2c200000, + 0x2c20004b, 0x2c400000, 0x2c4000a5, 0x2c500000, + 0x2c5000a5, 0x2c700000, 0x2c7000b9, 0x2d100000, // Entry 1E0 - 1FF - 0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4, - 0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf, - 0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052, - 0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099, - 0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000, - 0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0, - 0x31f0010d, 0x32000000, 0x320000cb, 0x32500000, - 0x32500052, 0x33100000, 0x331000c4, 0x33a00000, + 0x2d1000a5, 0x2d100130, 0x2e900000, 0x2e9000a5, + 0x2ed00000, 0x2ed000cd, 0x2f100000, 0x2f1000c0, + 0x2f200000, 0x2f2000d2, 0x2f400000, 0x2f400052, + 0x2ff00000, 0x2ff000c3, 0x30400000, 0x3040009a, + 0x30b00000, 0x30b000c6, 0x31000000, 0x31b00000, + 0x31b0009a, 0x31f00000, 0x31f0003e, 0x31f000d1, + 0x31f0010e, 0x32000000, 0x320000cc, 0x32500000, + 0x32500052, 0x33100000, 0x331000c5, 0x33a00000, // Entry 200 - 21F - 0x33a0009c, 0x34100000, 0x34500000, 0x345000d2, - 0x34700000, 0x347000da, 0x34700110, 0x34e00000, - 0x34e00164, 0x35000000, 0x35000060, 0x350000d9, - 0x35100000, 0x35100099, 0x351000db, 0x36700000, - 0x36700030, 0x36700036, 0x36700040, 0x3670005b, - 0x367000d9, 0x36700116, 0x3670011b, 0x36800000, - 0x36800052, 0x36a00000, 0x36a000da, 0x36c00000, + 0x33a0009d, 0x34100000, 0x34500000, 0x345000d3, + 0x34700000, 0x347000db, 0x34700111, 0x34e00000, + 0x34e00165, 0x35000000, 0x35000061, 0x350000da, + 0x35100000, 0x3510009a, 0x351000dc, 0x36700000, + 0x36700030, 0x36700036, 0x36700040, 0x3670005c, + 0x367000da, 0x36700117, 0x3670011c, 0x36800000, + 0x36800052, 0x36a00000, 0x36a000db, 0x36c00000, 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, // Entry 220 - 23F - 0x37a00000, 0x38000000, 0x38000117, 0x38700000, - 0x38900000, 0x38900131, 0x39000000, 0x3900006f, - 0x390000a4, 0x39500000, 0x39500099, 0x39800000, - 0x3980007d, 0x39800106, 0x39d00000, 0x39d05000, - 0x39d050e8, 0x39d36000, 0x39d36099, 0x3a100000, - 0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001, + 0x37a00000, 0x38000000, 0x38000118, 0x38700000, + 0x38900000, 0x38900132, 0x39000000, 0x39000070, + 0x390000a5, 0x39500000, 0x3950009a, 0x39800000, + 0x3980007e, 0x39800107, 0x39d00000, 0x39d05000, + 0x39d050e9, 0x39d36000, 0x39d3609a, 0x3a100000, + 0x3b300000, 0x3b3000ea, 0x3bd00000, 0x3bd00001, 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, - 0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086, + 0x3c000041, 0x3c00004e, 0x3c00005b, 0x3c000087, // Entry 240 - 25F - 0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1, - 0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000, - 0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000, + 0x3c00008c, 0x3c0000b8, 0x3c0000c7, 0x3c0000d2, + 0x3c0000ef, 0x3c000119, 0x3c000127, 0x3c400000, + 0x3c40003f, 0x3c40006a, 0x3c4000e5, 0x3d400000, 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, - 0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f, - 0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae, - 0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000, - 0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000, + 0x3dc000bd, 0x3dc00105, 0x3de00000, 0x3de00130, + 0x3e200000, 0x3e200047, 0x3e2000a6, 0x3e2000af, + 0x3e2000bd, 0x3e200107, 0x3e200131, 0x3e500000, + 0x3e500108, 0x3e600000, 0x3e600130, 0x3eb00000, // Entry 260 - 27F - 0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000, - 0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000, - 0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c, - 0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3, + 0x3eb00107, 0x3ec00000, 0x3ec000a5, 0x3f300000, + 0x3f300130, 0x3fa00000, 0x3fa000e9, 0x3fc00000, + 0x3fd00000, 0x3fd00073, 0x3fd000db, 0x3fd0010d, + 0x3ff00000, 0x3ff000d2, 0x40100000, 0x401000c4, 0x40200000, 0x4020004c, 0x40700000, 0x40800000, - 0x4085a000, 0x4085a0ba, 0x408e3000, 0x408e30ba, - 0x40c00000, 0x40c000b3, 0x41200000, 0x41200111, - 0x41600000, 0x4160010f, 0x41c00000, 0x41d00000, + 0x4085b000, 0x4085b0bb, 0x408eb000, 0x408eb0bb, + 0x40c00000, 0x40c000b4, 0x41200000, 0x41200112, + 0x41600000, 0x41600110, 0x41c00000, 0x41d00000, // Entry 280 - 29F - 0x41e00000, 0x41f00000, 0x41f00072, 0x42200000, - 0x42300000, 0x42300164, 0x42900000, 0x42900062, - 0x4290006f, 0x429000a4, 0x42900115, 0x43100000, - 0x43100027, 0x431000c2, 0x4310014d, 0x43200000, - 0x43220000, 0x43220033, 0x432200bd, 0x43220105, - 0x4322014d, 0x4325a000, 0x4325a033, 0x4325a0bd, - 0x4325a105, 0x4325a14d, 0x43700000, 0x43a00000, - 0x43b00000, 0x44400000, 0x44400031, 0x44400072, + 0x41e00000, 0x41f00000, 0x41f00073, 0x42200000, + 0x42300000, 0x42300165, 0x42900000, 0x42900063, + 0x42900070, 0x429000a5, 0x42900116, 0x43100000, + 0x43100027, 0x431000c3, 0x4310014e, 0x43200000, + 0x43220000, 0x43220033, 0x432200be, 0x43220106, + 0x4322014e, 0x4325b000, 0x4325b033, 0x4325b0be, + 0x4325b106, 0x4325b14e, 0x43700000, 0x43a00000, + 0x43b00000, 0x44400000, 0x44400031, 0x44400073, // Entry 2A0 - 2BF - 0x4440010c, 0x44500000, 0x4450004b, 0x445000a4, - 0x4450012f, 0x44500131, 0x44e00000, 0x45000000, - 0x45000099, 0x450000b3, 0x450000d0, 0x4500010d, - 0x46100000, 0x46100099, 0x46400000, 0x464000a4, - 0x46400131, 0x46700000, 0x46700124, 0x46b00000, - 0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f, - 0x47100000, 0x47600000, 0x47600127, 0x47a00000, - 0x48000000, 0x48200000, 0x48200129, 0x48a00000, + 0x4440010d, 0x44500000, 0x4450004b, 0x445000a5, + 0x44500130, 0x44500132, 0x44e00000, 0x45000000, + 0x4500009a, 0x450000b4, 0x450000d1, 0x4500010e, + 0x46100000, 0x4610009a, 0x46400000, 0x464000a5, + 0x46400132, 0x46700000, 0x46700125, 0x46b00000, + 0x46b00124, 0x46f00000, 0x46f0006e, 0x46f00070, + 0x47100000, 0x47600000, 0x47600128, 0x47a00000, + 0x48000000, 0x48200000, 0x4820012a, 0x48a00000, // Entry 2C0 - 2DF - 0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000, - 0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000, - 0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000, - 0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8, + 0x48a0005e, 0x48a0012c, 0x48e00000, 0x49400000, + 0x49400107, 0x4a400000, 0x4a4000d5, 0x4a900000, + 0x4a9000bb, 0x4ac00000, 0x4ac00053, 0x4ae00000, + 0x4ae00131, 0x4b400000, 0x4b40009a, 0x4b4000e9, 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc20000, - 0x4bc20137, 0x4bc5a000, 0x4bc5a137, 0x4be00000, - 0x4be5a000, 0x4be5a0b4, 0x4beeb000, 0x4beeb0b4, - 0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000, + 0x4bc20138, 0x4bc5b000, 0x4bc5b138, 0x4be00000, + 0x4be5b000, 0x4be5b0b5, 0x4bef4000, 0x4bef40b5, + 0x4c000000, 0x4c300000, 0x4c30013f, 0x4c900000, // Entry 2E0 - 2FF - 0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000, - 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114, - 0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000, + 0x4c900001, 0x4cc00000, 0x4cc00130, 0x4ce00000, + 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500115, + 0x4f200000, 0x4fb00000, 0x4fb00132, 0x50900000, 0x50900052, 0x51200000, 0x51200001, 0x51800000, - 0x5180003b, 0x518000d6, 0x51f00000, 0x51f3b000, - 0x51f3b053, 0x51f3c000, 0x51f3c08d, 0x52800000, - 0x528000ba, 0x52900000, 0x5293b000, 0x5293b053, - 0x5293b08d, 0x5293b0c6, 0x5293b10d, 0x5293c000, + 0x5180003b, 0x518000d7, 0x51f00000, 0x51f3b000, + 0x51f3b053, 0x51f3c000, 0x51f3c08e, 0x52800000, + 0x528000bb, 0x52900000, 0x5293b000, 0x5293b053, + 0x5293b08e, 0x5293b0c7, 0x5293b10e, 0x5293c000, // Entry 300 - 31F - 0x5293c08d, 0x5293c0c6, 0x5293c12e, 0x52f00000, - 0x52f00161, + 0x5293c08e, 0x5293c0c7, 0x5293c12f, 0x52f00000, + 0x52f00162, } // Size: 3116 bytes const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" -// Total table size 3147 bytes (3KiB); checksum: BE816D44 +// Total table size 3147 bytes (3KiB); checksum: 5A8FFFA5 diff --git a/vendor/golang.org/x/text/internal/language/language.go b/vendor/golang.org/x/text/internal/language/language.go index 6105bc7..09d41c7 100644 --- a/vendor/golang.org/x/text/internal/language/language.go +++ b/vendor/golang.org/x/text/internal/language/language.go @@ -409,7 +409,7 @@ func (t Tag) SetTypeForKey(key, value string) (Tag, error) { return t, nil } -// findKeyAndType returns the start and end position for the type corresponding +// findTypeForKey returns the start and end position for the type corresponding // to key or the point at which to insert the key-value pair if the type // wasn't found. The hasExt return value reports whether an -u extension was present. // Note: the extensions are typically very small and are likely to contain diff --git a/vendor/golang.org/x/text/internal/language/lookup.go b/vendor/golang.org/x/text/internal/language/lookup.go index 6294b81..231b4fb 100644 --- a/vendor/golang.org/x/text/internal/language/lookup.go +++ b/vendor/golang.org/x/text/internal/language/lookup.go @@ -50,7 +50,7 @@ func (id Language) Canonicalize() (Language, AliasType) { return normLang(id) } -// mapLang returns the mapped langID of id according to mapping m. +// normLang returns the mapped langID of id according to mapping m. func normLang(id Language) (Language, AliasType) { k := sort.Search(len(AliasMap), func(i int) bool { return AliasMap[i].From >= uint16(id) @@ -328,7 +328,7 @@ func (r Region) IsPrivateUse() bool { return r.typ()&iso3166UserAssigned != 0 } -type Script uint8 +type Script uint16 // getScriptID returns the script id for string s. It assumes that s // is of the format [A-Z][a-z]{3}. diff --git a/vendor/golang.org/x/text/internal/language/parse.go b/vendor/golang.org/x/text/internal/language/parse.go index 47ee0fe..aad1e0a 100644 --- a/vendor/golang.org/x/text/internal/language/parse.go +++ b/vendor/golang.org/x/text/internal/language/parse.go @@ -270,7 +270,7 @@ func parse(scan *scanner, s string) (t Tag, err error) { } else if n >= 4 { return Und, ErrSyntax } else { // the usual case - t, end = parseTag(scan) + t, end = parseTag(scan, true) if n := len(scan.token); n == 1 { t.pExt = uint16(end) end = parseExtensions(scan) @@ -296,7 +296,8 @@ func parse(scan *scanner, s string) (t Tag, err error) { // parseTag parses language, script, region and variants. // It returns a Tag and the end position in the input that was parsed. -func parseTag(scan *scanner) (t Tag, end int) { +// If doNorm is true, then - will be normalized to . +func parseTag(scan *scanner, doNorm bool) (t Tag, end int) { var e error // TODO: set an error if an unknown lang, script or region is encountered. t.LangID, e = getLangID(scan.token) @@ -307,14 +308,17 @@ func parseTag(scan *scanner) (t Tag, end int) { for len(scan.token) == 3 && isAlpha(scan.token[0]) { // From http://tools.ietf.org/html/bcp47, - tags are equivalent // to a tag of the form . - lang, e := getLangID(scan.token) - if lang != 0 { - t.LangID = lang - copy(scan.b[langStart:], lang.String()) - scan.b[langStart+3] = '-' - scan.start = langStart + 4 + if doNorm { + lang, e := getLangID(scan.token) + if lang != 0 { + t.LangID = lang + langStr := lang.String() + copy(scan.b[langStart:], langStr) + scan.b[langStart+len(langStr)] = '-' + scan.start = langStart + len(langStr) + 1 + } + scan.gobble(e) } - scan.gobble(e) end = scan.scan() } if len(scan.token) == 4 && isAlpha(scan.token[0]) { @@ -559,7 +563,7 @@ func parseExtension(scan *scanner) int { case 't': // https://www.ietf.org/rfc/rfc6497.txt scan.scan() if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) { - _, end = parseTag(scan) + _, end = parseTag(scan, false) scan.toLower(start, end) } for len(scan.token) == 2 && !isAlpha(scan.token[1]) { diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go index a19480c..14167e7 100644 --- a/vendor/golang.org/x/text/internal/language/tables.go +++ b/vendor/golang.org/x/text/internal/language/tables.go @@ -7,11 +7,11 @@ import "golang.org/x/text/internal/tag" // CLDRVersion is the CLDR version from which the tables in this package are derived. const CLDRVersion = "32" -const NumLanguages = 8717 +const NumLanguages = 8798 -const NumScripts = 251 +const NumScripts = 261 -const NumRegions = 357 +const NumRegions = 358 type FromTo struct { From uint16 @@ -121,9 +121,10 @@ const langPrivateEnd = 0x3179 // lang holds an alphabetically sorted list of ISO-639 language identifiers. // All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. // For 2-byte language identifiers, the two successive bytes have the following meaning: -// - if the first letter of the 2- and 3-letter ISO codes are the same: -// the second and third letter of the 3-letter ISO code. -// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. +// - if the first letter of the 2- and 3-letter ISO codes are the same: +// the second and third letter of the 3-letter ISO code. +// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. +// // For 3-byte language identifiers the 4th byte is 0. const lang tag.Index = "" + // Size: 5324 bytes "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" + @@ -262,10 +263,10 @@ var langNoIndex = [2197]uint8{ 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, - 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, + 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x72, 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, - 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a, + 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xbc, 0x0a, 0x6a, 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff, // Entry 40 - 7F 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0, @@ -277,7 +278,7 @@ var langNoIndex = [2197]uint8{ 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, // Entry 80 - BF - 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff, + 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x7f, 0xff, 0xff, 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, @@ -288,34 +289,34 @@ var langNoIndex = [2197]uint8{ // Entry C0 - FF 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, 0x1b, 0x14, 0x08, 0xf3, 0x2b, 0xe7, 0x17, 0x56, - 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7b, 0xf3, 0xef, + 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7f, 0xf3, 0xef, 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, - 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x73, 0x35, - 0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00, - 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, + 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x7b, 0x35, + 0x3e, 0xc7, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00, + 0xb0, 0x05, 0x80, 0x00, 0x20, 0x00, 0x00, 0x03, 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, // Entry 100 - 13F 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00, 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3, - 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c, + 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x41, 0x0c, 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc7, 0x67, 0x5f, 0x56, 0x99, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, - 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, + 0x90, 0x6d, 0x01, 0x2e, 0x96, 0x69, 0x20, 0xfb, // Entry 140 - 17F 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x0c, 0x16, - 0x03, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, + 0x03, 0x00, 0x00, 0xb0, 0x14, 0x23, 0x50, 0x06, 0x0a, 0x00, 0x01, 0x00, 0x00, 0x10, 0x11, 0x09, 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, - 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, - 0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04, + 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x05, + 0x08, 0x00, 0x00, 0x05, 0x00, 0x80, 0x28, 0x04, 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, - 0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03, + 0x24, 0x52, 0xf4, 0xd5, 0xbf, 0x62, 0xc9, 0x03, // Entry 180 - 1BF 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, - 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, + 0x21, 0x18, 0x81, 0x08, 0x00, 0x01, 0x40, 0x82, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, @@ -333,20 +334,20 @@ var langNoIndex = [2197]uint8{ // Entry 200 - 23F 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27, 0xed, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5, - 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe0, 0xdf, - 0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x01, 0xe3, + 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe1, 0xdf, + 0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x81, 0xe3, 0x92, 0x54, 0xdb, 0x28, 0xd3, 0x5f, 0xfe, 0x6d, - 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, + 0x79, 0xed, 0x1c, 0x7f, 0x04, 0x08, 0x00, 0x01, 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, // Entry 240 - 27F 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00, - 0x20, 0x7b, 0x78, 0x02, 0x05, 0x84, 0x00, 0xf0, + 0x20, 0x7b, 0x78, 0x02, 0x07, 0x84, 0x00, 0xf0, 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00, 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04, 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00, - 0x11, 0x24, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff, + 0x91, 0x24, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff, 0x7b, 0x7f, 0x70, 0x00, 0x05, 0x9b, 0xdd, 0x66, // Entry 280 - 2BF 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05, @@ -358,19 +359,19 @@ var langNoIndex = [2197]uint8{ 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, // Entry 2C0 - 2FF - 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, - 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, + 0x02, 0x50, 0x80, 0x11, 0x00, 0x99, 0x6c, 0xe2, + 0x50, 0x27, 0x1d, 0x11, 0x29, 0x0e, 0x59, 0xe9, 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, - 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, - 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00, + 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x40, 0x08, + 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x8d, 0x12, 0x00, // Entry 300 - 33F 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00, 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80, - 0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0, + 0x00, 0x01, 0xd0, 0x16, 0x40, 0x00, 0x10, 0xb0, 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00, 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80, 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00, @@ -391,15 +392,15 @@ var langNoIndex = [2197]uint8{ 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, - 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, + 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x7d, 0x1f, 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, // Entry 3C0 - 3FF 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, - 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, - 0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xf9, 0x2e, 0x11, - 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x01, - 0x05, 0xd1, 0x50, 0x5c, 0x00, 0x00, 0x00, 0x10, + 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x20, + 0x40, 0x54, 0x9f, 0x8a, 0xdf, 0xf9, 0x6e, 0x11, + 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x03, + 0x05, 0xd1, 0x50, 0x5c, 0x00, 0x40, 0x00, 0x10, 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, // Entry 400 - 43F @@ -421,26 +422,26 @@ var langNoIndex = [2197]uint8{ 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff, 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4, // Entry 480 - 4BF - 0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb, + 0x93, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb, 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, - 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, - 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x05, 0xc5, 0x05, - 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04, + 0x14, 0x00, 0x55, 0x51, 0xc2, 0x65, 0xf5, 0x41, + 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x85, 0xc5, 0x05, + 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x05, 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, - 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1, + 0x06, 0x11, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, // Entry 4C0 - 4FF - 0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed, - 0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, + 0xfd, 0x47, 0x69, 0x06, 0x95, 0x06, 0x57, 0xed, + 0xfb, 0x4d, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83, - 0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7, + 0xb8, 0x4f, 0x10, 0x8e, 0x89, 0x46, 0xde, 0xf7, 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00, 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d, 0xbe, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, // Entry 500 - 53F 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, - 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, + 0x2d, 0x14, 0x27, 0x5f, 0xed, 0xf1, 0x3f, 0xe7, 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe7, 0xf7, 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, @@ -448,7 +449,7 @@ var langNoIndex = [2197]uint8{ 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, // Entry 540 - 57F - 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, + 0x00, 0x00, 0x01, 0x43, 0x19, 0x24, 0x08, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, @@ -463,14 +464,14 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, - 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, + 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x20, 0x81, 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, // Entry 5C0 - 5FF - 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, + 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0xbe, 0x02, 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, - 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, - 0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20, + 0x3d, 0x40, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, + 0x31, 0x00, 0x00, 0x00, 0x01, 0x18, 0x02, 0x20, 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, 0x1f, 0x98, 0xcf, 0x9c, 0xff, 0xaf, 0x5f, 0xfe, @@ -479,9 +480,9 @@ var langNoIndex = [2197]uint8{ 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1, 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7, 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd, - 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f, + 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x9f, 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe, - 0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18, + 0xbe, 0x5f, 0x46, 0x5b, 0xe9, 0x5f, 0x50, 0x18, 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f, // Entry 640 - 67F 0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf5, 0x57, 0x6c, @@ -490,20 +491,20 @@ var langNoIndex = [2197]uint8{ 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, 0xb9, 0xda, 0x7d, 0xd0, 0x3e, 0x15, 0x7b, 0xb4, 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, - 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, + 0x5f, 0xff, 0xff, 0x9e, 0xdf, 0xf6, 0xd7, 0xb9, 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, // Entry 680 - 6BF 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, - 0xce, 0x7f, 0x04, 0x1d, 0x73, 0x7f, 0xf8, 0xda, - 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0, + 0xce, 0x7f, 0x44, 0x1d, 0x73, 0x7f, 0xf8, 0xda, + 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x79, 0xa0, 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x09, 0x06, 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, 0x04, 0x00, 0x10, 0xdc, 0x58, 0xd7, 0x0d, 0x0f, // Entry 6C0 - 6FF - 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08, - 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, + 0x54, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, + 0x40, 0x02, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x48, 0x41, 0x24, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -512,8 +513,8 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, // Entry 700 - 73F 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, - 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, - 0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79, + 0x80, 0x86, 0xc2, 0x00, 0x00, 0x01, 0x00, 0x01, + 0xff, 0x18, 0x02, 0x00, 0x02, 0xf0, 0xfd, 0x79, 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00, @@ -521,46 +522,46 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 740 - 77F 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, - 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, + 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x46, 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, 0x01, 0x00, 0x00, 0xb0, 0x80, 0x20, 0x55, 0x75, - 0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03, + 0x97, 0x7c, 0xdf, 0x31, 0xcc, 0x68, 0xd1, 0x03, 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, // Entry 780 - 7BF - 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, + 0x83, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, - 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, + 0x10, 0x03, 0x31, 0x02, 0x01, 0x00, 0x00, 0xf0, 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, - 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41, - 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, + 0x78, 0x15, 0x50, 0x05, 0xa4, 0x84, 0xa9, 0x41, + 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x40, 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, // Entry 7C0 - 7FF - 0xdd, 0xbf, 0x72, 0x1d, 0xc7, 0x0c, 0xd5, 0x42, + 0xdd, 0xbf, 0xf2, 0x5d, 0xc7, 0x0c, 0xd5, 0x42, 0xfc, 0xff, 0xf7, 0x1f, 0x00, 0x80, 0x40, 0x56, 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff, 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, - 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, + 0xfe, 0x01, 0x02, 0x88, 0x2a, 0x40, 0x16, 0x01, 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, // Entry 800 - 83F 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, - 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, + 0xbf, 0x03, 0x00, 0x00, 0x10, 0xdc, 0xa3, 0xd1, 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, - 0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93, + 0x2f, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93, 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, // Entry 840 - 87F - 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x12, 0x81, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, + 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x89, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x03, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, - 0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1, + 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x54, 0xf1, 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, @@ -582,8 +583,8 @@ var altLangIndex = [6]uint16{ } // AliasMap maps langIDs to their suggested replacements. -// Size: 704 bytes, 176 elements -var AliasMap = [176]FromTo{ +// Size: 772 bytes, 193 elements +var AliasMap = [193]FromTo{ 0: {From: 0x82, To: 0x88}, 1: {From: 0x187, To: 0x1ae}, 2: {From: 0x1f3, To: 0x1e1}, @@ -598,219 +599,239 @@ var AliasMap = [176]FromTo{ 11: {From: 0x4a2, To: 0x21}, 12: {From: 0x53e, To: 0x544}, 13: {From: 0x58f, To: 0x12d}, - 14: {From: 0x630, To: 0x1eb1}, - 15: {From: 0x651, To: 0x431}, - 16: {From: 0x662, To: 0x431}, - 17: {From: 0x6ed, To: 0x3a}, - 18: {From: 0x6f8, To: 0x1d7}, - 19: {From: 0x709, To: 0x3625}, - 20: {From: 0x73e, To: 0x21a1}, - 21: {From: 0x7b3, To: 0x56}, - 22: {From: 0x7b9, To: 0x299b}, - 23: {From: 0x7c5, To: 0x58}, - 24: {From: 0x7e6, To: 0x145}, - 25: {From: 0x80c, To: 0x5a}, - 26: {From: 0x815, To: 0x8d}, - 27: {From: 0x87e, To: 0x810}, - 28: {From: 0x8c3, To: 0xee3}, - 29: {From: 0x9ef, To: 0x331}, - 30: {From: 0xa36, To: 0x2c5}, - 31: {From: 0xa3d, To: 0xbf}, - 32: {From: 0xabe, To: 0x3322}, - 33: {From: 0xb38, To: 0x529}, - 34: {From: 0xb75, To: 0x265a}, - 35: {From: 0xb7e, To: 0xbc3}, - 36: {From: 0xb9b, To: 0x44e}, - 37: {From: 0xbbc, To: 0x4229}, - 38: {From: 0xbbf, To: 0x529}, - 39: {From: 0xbfe, To: 0x2da7}, - 40: {From: 0xc2e, To: 0x3181}, - 41: {From: 0xcb9, To: 0xf3}, - 42: {From: 0xd08, To: 0xfa}, - 43: {From: 0xdc8, To: 0x11a}, - 44: {From: 0xdd7, To: 0x32d}, - 45: {From: 0xdf8, To: 0xdfb}, - 46: {From: 0xdfe, To: 0x531}, - 47: {From: 0xe01, To: 0xdf3}, - 48: {From: 0xedf, To: 0x205a}, - 49: {From: 0xee9, To: 0x222e}, - 50: {From: 0xeee, To: 0x2e9a}, - 51: {From: 0xf39, To: 0x367}, - 52: {From: 0x10d0, To: 0x140}, - 53: {From: 0x1104, To: 0x2d0}, - 54: {From: 0x11a0, To: 0x1ec}, - 55: {From: 0x1279, To: 0x21}, - 56: {From: 0x1424, To: 0x15e}, - 57: {From: 0x1470, To: 0x14e}, - 58: {From: 0x151f, To: 0xd9b}, - 59: {From: 0x1523, To: 0x390}, - 60: {From: 0x1532, To: 0x19f}, - 61: {From: 0x1580, To: 0x210}, - 62: {From: 0x1583, To: 0x10d}, - 63: {From: 0x15a3, To: 0x3caf}, - 64: {From: 0x1630, To: 0x222e}, - 65: {From: 0x166a, To: 0x19b}, - 66: {From: 0x16c8, To: 0x136}, - 67: {From: 0x1700, To: 0x29f8}, - 68: {From: 0x1718, To: 0x194}, - 69: {From: 0x1727, To: 0xf3f}, - 70: {From: 0x177a, To: 0x178}, - 71: {From: 0x1809, To: 0x17b6}, - 72: {From: 0x1816, To: 0x18f3}, - 73: {From: 0x188a, To: 0x436}, - 74: {From: 0x1979, To: 0x1d01}, - 75: {From: 0x1a74, To: 0x2bb0}, - 76: {From: 0x1a8a, To: 0x1f8}, - 77: {From: 0x1b5a, To: 0x1fa}, - 78: {From: 0x1b86, To: 0x1515}, - 79: {From: 0x1d64, To: 0x2c9b}, - 80: {From: 0x2038, To: 0x37b1}, - 81: {From: 0x203d, To: 0x20dd}, - 82: {From: 0x205a, To: 0x30b}, - 83: {From: 0x20e3, To: 0x274}, - 84: {From: 0x20ee, To: 0x263}, - 85: {From: 0x20f2, To: 0x22d}, - 86: {From: 0x20f9, To: 0x256}, - 87: {From: 0x210f, To: 0x21eb}, - 88: {From: 0x2135, To: 0x27d}, - 89: {From: 0x2160, To: 0x913}, - 90: {From: 0x2199, To: 0x121}, - 91: {From: 0x21ce, To: 0x1561}, - 92: {From: 0x21e6, To: 0x504}, - 93: {From: 0x21f4, To: 0x49f}, - 94: {From: 0x21fb, To: 0x269}, - 95: {From: 0x222d, To: 0x121}, - 96: {From: 0x2237, To: 0x121}, - 97: {From: 0x2262, To: 0x92a}, - 98: {From: 0x2316, To: 0x3226}, - 99: {From: 0x236a, To: 0x2835}, - 100: {From: 0x2382, To: 0x3365}, - 101: {From: 0x2472, To: 0x2c7}, - 102: {From: 0x24e4, To: 0x2ff}, - 103: {From: 0x24f0, To: 0x2fa}, - 104: {From: 0x24fa, To: 0x31f}, - 105: {From: 0x2550, To: 0xb5b}, - 106: {From: 0x25a9, To: 0xe2}, - 107: {From: 0x263e, To: 0x2d0}, - 108: {From: 0x26c9, To: 0x26b4}, - 109: {From: 0x26f9, To: 0x3c8}, - 110: {From: 0x2727, To: 0x3caf}, - 111: {From: 0x2755, To: 0x6a4}, - 112: {From: 0x2765, To: 0x26b4}, - 113: {From: 0x2789, To: 0x4358}, - 114: {From: 0x27c9, To: 0x2001}, - 115: {From: 0x28ea, To: 0x27b1}, - 116: {From: 0x28ef, To: 0x2837}, - 117: {From: 0x2914, To: 0x351}, - 118: {From: 0x2986, To: 0x2da7}, - 119: {From: 0x29f0, To: 0x96b}, - 120: {From: 0x2b1a, To: 0x38d}, - 121: {From: 0x2bfc, To: 0x395}, - 122: {From: 0x2c3f, To: 0x3caf}, - 123: {From: 0x2cfc, To: 0x3be}, - 124: {From: 0x2d13, To: 0x597}, - 125: {From: 0x2d47, To: 0x148}, - 126: {From: 0x2d48, To: 0x148}, - 127: {From: 0x2dff, To: 0x2f1}, - 128: {From: 0x2e08, To: 0x19cc}, - 129: {From: 0x2e1a, To: 0x2d95}, - 130: {From: 0x2e21, To: 0x292}, - 131: {From: 0x2e54, To: 0x7d}, - 132: {From: 0x2e65, To: 0x2282}, - 133: {From: 0x2ea0, To: 0x2e9b}, - 134: {From: 0x2eef, To: 0x2ed7}, - 135: {From: 0x3193, To: 0x3c4}, - 136: {From: 0x3366, To: 0x338e}, - 137: {From: 0x342a, To: 0x3dc}, - 138: {From: 0x34ee, To: 0x18d0}, - 139: {From: 0x35c8, To: 0x2c9b}, - 140: {From: 0x35e6, To: 0x412}, - 141: {From: 0x3658, To: 0x246}, - 142: {From: 0x3676, To: 0x3f4}, - 143: {From: 0x36fd, To: 0x445}, - 144: {From: 0x37c0, To: 0x121}, - 145: {From: 0x3816, To: 0x38f2}, - 146: {From: 0x382a, To: 0x2b48}, - 147: {From: 0x382b, To: 0x2c9b}, - 148: {From: 0x382f, To: 0xa9}, - 149: {From: 0x3832, To: 0x3228}, - 150: {From: 0x386c, To: 0x39a6}, - 151: {From: 0x3892, To: 0x3fc0}, - 152: {From: 0x38a5, To: 0x39d7}, - 153: {From: 0x38b4, To: 0x1fa4}, - 154: {From: 0x38b5, To: 0x2e9a}, - 155: {From: 0x395c, To: 0x47e}, - 156: {From: 0x3b4e, To: 0xd91}, - 157: {From: 0x3b78, To: 0x137}, - 158: {From: 0x3c99, To: 0x4bc}, - 159: {From: 0x3fbd, To: 0x100}, - 160: {From: 0x4208, To: 0xa91}, - 161: {From: 0x42be, To: 0x573}, - 162: {From: 0x42f9, To: 0x3f60}, - 163: {From: 0x4378, To: 0x25a}, - 164: {From: 0x43b8, To: 0xe6c}, - 165: {From: 0x43cd, To: 0x10f}, - 166: {From: 0x44af, To: 0x3322}, - 167: {From: 0x44e3, To: 0x512}, - 168: {From: 0x45ca, To: 0x2409}, - 169: {From: 0x45dd, To: 0x26dc}, - 170: {From: 0x4610, To: 0x48ae}, - 171: {From: 0x46ae, To: 0x46a0}, - 172: {From: 0x473e, To: 0x4745}, - 173: {From: 0x4817, To: 0x3503}, - 174: {From: 0x4916, To: 0x31f}, - 175: {From: 0x49a7, To: 0x523}, + 14: {From: 0x62b, To: 0x34}, + 15: {From: 0x62f, To: 0x14}, + 16: {From: 0x630, To: 0x1eb1}, + 17: {From: 0x651, To: 0x431}, + 18: {From: 0x662, To: 0x431}, + 19: {From: 0x6ed, To: 0x3a}, + 20: {From: 0x6f8, To: 0x1d7}, + 21: {From: 0x709, To: 0x3625}, + 22: {From: 0x73e, To: 0x21a1}, + 23: {From: 0x7b3, To: 0x56}, + 24: {From: 0x7b9, To: 0x299b}, + 25: {From: 0x7c5, To: 0x58}, + 26: {From: 0x7e6, To: 0x145}, + 27: {From: 0x80c, To: 0x5a}, + 28: {From: 0x815, To: 0x8d}, + 29: {From: 0x87e, To: 0x810}, + 30: {From: 0x8a8, To: 0x8b7}, + 31: {From: 0x8c3, To: 0xee3}, + 32: {From: 0x8fa, To: 0x1dc}, + 33: {From: 0x9ef, To: 0x331}, + 34: {From: 0xa36, To: 0x2c5}, + 35: {From: 0xa3d, To: 0xbf}, + 36: {From: 0xabe, To: 0x3322}, + 37: {From: 0xb38, To: 0x529}, + 38: {From: 0xb75, To: 0x265a}, + 39: {From: 0xb7e, To: 0xbc3}, + 40: {From: 0xb9b, To: 0x44e}, + 41: {From: 0xbbc, To: 0x4229}, + 42: {From: 0xbbf, To: 0x529}, + 43: {From: 0xbfe, To: 0x2da7}, + 44: {From: 0xc2e, To: 0x3181}, + 45: {From: 0xcb9, To: 0xf3}, + 46: {From: 0xd08, To: 0xfa}, + 47: {From: 0xdc8, To: 0x11a}, + 48: {From: 0xdd7, To: 0x32d}, + 49: {From: 0xdf8, To: 0xdfb}, + 50: {From: 0xdfe, To: 0x531}, + 51: {From: 0xe01, To: 0xdf3}, + 52: {From: 0xedf, To: 0x205a}, + 53: {From: 0xee9, To: 0x222e}, + 54: {From: 0xeee, To: 0x2e9a}, + 55: {From: 0xf39, To: 0x367}, + 56: {From: 0x10d0, To: 0x140}, + 57: {From: 0x1104, To: 0x2d0}, + 58: {From: 0x11a0, To: 0x1ec}, + 59: {From: 0x1279, To: 0x21}, + 60: {From: 0x1424, To: 0x15e}, + 61: {From: 0x1470, To: 0x14e}, + 62: {From: 0x151f, To: 0xd9b}, + 63: {From: 0x1523, To: 0x390}, + 64: {From: 0x1532, To: 0x19f}, + 65: {From: 0x1580, To: 0x210}, + 66: {From: 0x1583, To: 0x10d}, + 67: {From: 0x15a3, To: 0x3caf}, + 68: {From: 0x1630, To: 0x222e}, + 69: {From: 0x166a, To: 0x19b}, + 70: {From: 0x16c8, To: 0x136}, + 71: {From: 0x1700, To: 0x29f8}, + 72: {From: 0x1718, To: 0x194}, + 73: {From: 0x1727, To: 0xf3f}, + 74: {From: 0x177a, To: 0x178}, + 75: {From: 0x1809, To: 0x17b6}, + 76: {From: 0x1816, To: 0x18f3}, + 77: {From: 0x188a, To: 0x436}, + 78: {From: 0x1979, To: 0x1d01}, + 79: {From: 0x1a74, To: 0x2bb0}, + 80: {From: 0x1a8a, To: 0x1f8}, + 81: {From: 0x1b5a, To: 0x1fa}, + 82: {From: 0x1b86, To: 0x1515}, + 83: {From: 0x1d64, To: 0x2c9b}, + 84: {From: 0x2038, To: 0x37b1}, + 85: {From: 0x203d, To: 0x20dd}, + 86: {From: 0x2042, To: 0x2e00}, + 87: {From: 0x205a, To: 0x30b}, + 88: {From: 0x20e3, To: 0x274}, + 89: {From: 0x20ee, To: 0x263}, + 90: {From: 0x20f2, To: 0x22d}, + 91: {From: 0x20f9, To: 0x256}, + 92: {From: 0x210f, To: 0x21eb}, + 93: {From: 0x2135, To: 0x27d}, + 94: {From: 0x2160, To: 0x913}, + 95: {From: 0x2199, To: 0x121}, + 96: {From: 0x21ce, To: 0x1561}, + 97: {From: 0x21e6, To: 0x504}, + 98: {From: 0x21f4, To: 0x49f}, + 99: {From: 0x21fb, To: 0x269}, + 100: {From: 0x222d, To: 0x121}, + 101: {From: 0x2237, To: 0x121}, + 102: {From: 0x2248, To: 0x217d}, + 103: {From: 0x2262, To: 0x92a}, + 104: {From: 0x2316, To: 0x3226}, + 105: {From: 0x236a, To: 0x2835}, + 106: {From: 0x2382, To: 0x3365}, + 107: {From: 0x2472, To: 0x2c7}, + 108: {From: 0x24e4, To: 0x2ff}, + 109: {From: 0x24f0, To: 0x2fa}, + 110: {From: 0x24fa, To: 0x31f}, + 111: {From: 0x2550, To: 0xb5b}, + 112: {From: 0x25a9, To: 0xe2}, + 113: {From: 0x263e, To: 0x2d0}, + 114: {From: 0x26c9, To: 0x26b4}, + 115: {From: 0x26f9, To: 0x3c8}, + 116: {From: 0x2727, To: 0x3caf}, + 117: {From: 0x2755, To: 0x6a4}, + 118: {From: 0x2765, To: 0x26b4}, + 119: {From: 0x2789, To: 0x4358}, + 120: {From: 0x27c9, To: 0x2001}, + 121: {From: 0x28ea, To: 0x27b1}, + 122: {From: 0x28ef, To: 0x2837}, + 123: {From: 0x28fe, To: 0xaa5}, + 124: {From: 0x2914, To: 0x351}, + 125: {From: 0x2986, To: 0x2da7}, + 126: {From: 0x29f0, To: 0x96b}, + 127: {From: 0x2b1a, To: 0x38d}, + 128: {From: 0x2bfc, To: 0x395}, + 129: {From: 0x2c3f, To: 0x3caf}, + 130: {From: 0x2ce1, To: 0x2201}, + 131: {From: 0x2cfc, To: 0x3be}, + 132: {From: 0x2d13, To: 0x597}, + 133: {From: 0x2d47, To: 0x148}, + 134: {From: 0x2d48, To: 0x148}, + 135: {From: 0x2dff, To: 0x2f1}, + 136: {From: 0x2e08, To: 0x19cc}, + 137: {From: 0x2e10, To: 0xc45}, + 138: {From: 0x2e1a, To: 0x2d95}, + 139: {From: 0x2e21, To: 0x292}, + 140: {From: 0x2e54, To: 0x7d}, + 141: {From: 0x2e65, To: 0x2282}, + 142: {From: 0x2e97, To: 0x1a4}, + 143: {From: 0x2ea0, To: 0x2e9b}, + 144: {From: 0x2eef, To: 0x2ed7}, + 145: {From: 0x3193, To: 0x3c4}, + 146: {From: 0x3366, To: 0x338e}, + 147: {From: 0x342a, To: 0x3dc}, + 148: {From: 0x34ee, To: 0x18d0}, + 149: {From: 0x35c8, To: 0x2c9b}, + 150: {From: 0x35e6, To: 0x412}, + 151: {From: 0x35f5, To: 0x24b}, + 152: {From: 0x360d, To: 0x1dc}, + 153: {From: 0x3658, To: 0x246}, + 154: {From: 0x3676, To: 0x3f4}, + 155: {From: 0x36fd, To: 0x445}, + 156: {From: 0x3747, To: 0x3b42}, + 157: {From: 0x37c0, To: 0x121}, + 158: {From: 0x3816, To: 0x38f2}, + 159: {From: 0x382a, To: 0x2b48}, + 160: {From: 0x382b, To: 0x2c9b}, + 161: {From: 0x382f, To: 0xa9}, + 162: {From: 0x3832, To: 0x3228}, + 163: {From: 0x386c, To: 0x39a6}, + 164: {From: 0x3892, To: 0x3fc0}, + 165: {From: 0x38a0, To: 0x45f}, + 166: {From: 0x38a5, To: 0x39d7}, + 167: {From: 0x38b4, To: 0x1fa4}, + 168: {From: 0x38b5, To: 0x2e9a}, + 169: {From: 0x38fa, To: 0x38f1}, + 170: {From: 0x395c, To: 0x47e}, + 171: {From: 0x3b4e, To: 0xd91}, + 172: {From: 0x3b78, To: 0x137}, + 173: {From: 0x3c99, To: 0x4bc}, + 174: {From: 0x3fbd, To: 0x100}, + 175: {From: 0x4208, To: 0xa91}, + 176: {From: 0x42be, To: 0x573}, + 177: {From: 0x42f9, To: 0x3f60}, + 178: {From: 0x4378, To: 0x25a}, + 179: {From: 0x43b8, To: 0xe6c}, + 180: {From: 0x43cd, To: 0x10f}, + 181: {From: 0x43d4, To: 0x4848}, + 182: {From: 0x44af, To: 0x3322}, + 183: {From: 0x44e3, To: 0x512}, + 184: {From: 0x45ca, To: 0x2409}, + 185: {From: 0x45dd, To: 0x26dc}, + 186: {From: 0x4610, To: 0x48ae}, + 187: {From: 0x46ae, To: 0x46a0}, + 188: {From: 0x473e, To: 0x4745}, + 189: {From: 0x4817, To: 0x3503}, + 190: {From: 0x483b, To: 0x208b}, + 191: {From: 0x4916, To: 0x31f}, + 192: {From: 0x49a7, To: 0x523}, } -// Size: 176 bytes, 176 elements -var AliasTypes = [176]AliasType{ +// Size: 193 bytes, 193 elements +var AliasTypes = [193]AliasType{ // Entry 0 - 3F - 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, - 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, - 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, - 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, + 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 0, 0, + 1, 2, 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, + 0, 2, 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, + 1, 1, 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, // Entry 40 - 7F - 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, - 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, - 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, 1, 1, 0, 1, 0, 0, - 0, 0, 0, 0, 0, 1, 0, 0, 1, 1, 0, 1, 0, 2, 1, 1, + 1, 2, 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, + 2, 1, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, + 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, // Entry 80 - BF - 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 0, 2, 1, 1, 1, - 0, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, 2, - 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1, + 1, 0, 0, 1, 0, 2, 1, 1, 0, 0, 0, 1, 0, 0, 0, 0, + 0, 1, 1, 2, 0, 0, 2, 0, 0, 1, 1, 1, 0, 0, 0, 0, + 0, 2, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, 2, 0, + 0, 0, 1, 0, 1, 0, 0, 1, 0, 0, 0, 0, 1, 0, 0, 1, + // Entry C0 - FF + 1, } const ( - _Latn = 90 + _Latn = 91 _Hani = 57 _Hans = 59 _Hant = 60 - _Qaaa = 143 - _Qaai = 151 - _Qabx = 192 - _Zinh = 245 - _Zyyy = 250 - _Zzzz = 251 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 ) // script is an alphabetically sorted list of ISO 15924 codes. The index // of the script in the string, divided by 4, is the internal scriptID. -const script tag.Index = "" + // Size: 1012 bytes +const script tag.Index = "" + // Size: 1052 bytes "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + "BrahBraiBugiBuhdCakmCansCariChamCherChrsCirtCoptCpmnCprtCyrlCyrsDevaDiak" + "DogrDsrtDuplEgydEgyhEgypElbaElymEthiGeokGeorGlagGongGonmGothGranGrekGujr" + "GuruHanbHangHaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamo" + - "JavaJpanJurcKaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatg" + - "LatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMend" + - "MercMeroMlymModiMongMoonMrooMteiMultMymrNandNarbNbatNewaNkdbNkgbNkooNshu" + - "OgamOlckOrkhOryaOsgeOsmaPalmPaucPermPhagPhliPhlpPhlvPhnxPiqdPlrdPrtiQaaa" + - "QaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaamQaanQaaoQaapQaaqQaarQaas" + - "QaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabeQabfQabgQabhQabiQabjQabk" + - "QablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabwQabxRjngRohgRoroRunrSamr" + - "SaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogdSogoSoraSoyoSundSyloSyrcSyre" + - "SyrjSyrnTagbTakrTaleTaluTamlTangTavtTeluTengTfngTglgThaaThaiTibtTirhToto" + - "UgarVaiiVispWaraWchoWoleXpeoXsuxYeziYiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz" + - "\xff\xff\xff\xff" + "JavaJpanJurcKaliKanaKawiKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatf" + + "LatgLatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedf" + + "MendMercMeroMlymModiMongMoonMrooMteiMultMymrNagmNandNarbNbatNewaNkdbNkgb" + + "NkooNshuOgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlv" + + "PhnxPiqdPlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaam" + + "QaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabe" + + "QabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabw" + + "QabxRanjRjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogd" + + "SogoSoraSoyoSundSunuSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTelu" + + "TengTfngTglgThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsux" + + "YeziYiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" // suppressScript is an index from langID to the dominant script for that language, // if it exists. If a script is given, it should be suppressed from the language tag. @@ -819,7 +840,7 @@ var suppressScript = [1330]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -828,7 +849,7 @@ var suppressScript = [1330]uint8{ // Entry 40 - 7F 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -841,53 +862,53 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry C0 - FF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 100 - 13F - 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xe5, 0x00, 0x00, 0x00, 0x00, 0xe7, 0x00, 0x00, + 0xed, 0x00, 0x00, 0x00, 0x00, 0xef, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x34, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x5a, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x5b, 0x00, // Entry 140 - 17F - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 180 - 1BF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x35, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x35, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x22, 0x00, // Entry 1C0 - 1FF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x5a, 0x00, 0x5a, 0x5a, 0x00, 0x08, + 0x00, 0x5b, 0x5b, 0x00, 0x5b, 0x5b, 0x00, 0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x5a, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, // Entry 200 - 23F 0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -898,9 +919,9 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 240 - 27F - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x00, 0x00, 0x4e, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x53, 0x00, 0x22, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x53, 0x00, 0x00, 0x54, 0x00, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -908,93 +929,93 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 280 - 2BF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x58, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 2C0 - 2FF - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, // Entry 300 - 33F - 0x00, 0x00, 0x00, 0x00, 0x6e, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x6f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5a, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5b, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x75, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x76, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, // Entry 340 - 37F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x5a, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x7c, 0x5a, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x5b, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 380 - 3BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x83, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x36, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, // Entry 3C0 - 3FF - 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 400 - 43F - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xcf, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xd6, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, // Entry 440 - 47F - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xde, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xe6, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xe1, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xe6, 0x00, 0x00, 0x00, 0x2c, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0xe9, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xee, 0x00, 0x00, 0x00, 0x2c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, // Entry 480 - 4BF - 0x5a, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x5b, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 4C0 - 4FF - 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 500 - 53F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -1002,7 +1023,7 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, } @@ -1011,16 +1032,16 @@ const ( _419 = 31 _BR = 65 _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 ) // isoRegionOffset needs to be added to the index of regionISO to obtain the regionID @@ -1029,8 +1050,8 @@ const ( const isoRegionOffset = 32 // regionTypes defines the status of a region for various standards. -// Size: 358 bytes, 358 elements -var regionTypes = [358]uint8{ +// Size: 359 bytes, 359 elements +var regionTypes = [359]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -1043,73 +1064,73 @@ var regionTypes = [358]uint8{ // Entry 40 - 7F 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, - 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, - 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x04, 0x06, + 0x04, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x04, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry 80 - BF 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry C0 - FF - 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, // Entry 100 - 13F - 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x05, 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, // Entry 140 - 17F - 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, - 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, + 0x06, 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, } // regionISO holds a list of alphabetically sorted 2-letter ISO region codes. // Each 2-letter codes is followed by two bytes with the following meaning: -// - [A-Z}{2}: the first letter of the 2-letter code plus these two -// letters form the 3-letter ISO code. -// - 0, n: index into altRegionISO3. -const regionISO tag.Index = "" + // Size: 1308 bytes +// - [A-Z}{2}: the first letter of the 2-letter code plus these two +// letters form the 3-letter ISO code. +// - 0, n: index into altRegionISO3. +const regionISO tag.Index = "" + // Size: 1312 bytes "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + - "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + - "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + - "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + - "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + - "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + - "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + - "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + - "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + - "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + - "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + - "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + - "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + - "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + - "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + - "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + - "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + - "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" + "CQ CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADO" + + "OMDYHYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSM" + + "FOROFQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQ" + + "NQGRRCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERL" + + "ILSRIMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM" + + "\x00\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSO" + + "LTTULUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNP" + + "MQTQMRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLD" + + "NOORNPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM" + + "\x00\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSS" + + "QTTTQU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLB" + + "SCYCSDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXM" + + "SYYRSZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTT" + + "TOTVUVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVN" + + "NMVUUTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXN" + + "NNXOOOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUG" + + "ZAAFZMMBZRARZWWEZZZZ\xff\xff\xff\xff" // altRegionISO3 holds a list of 3-letter region codes that cannot be // mapped to 2-letter codes using the default algorithm. This is a short list. @@ -1119,38 +1140,38 @@ const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" // of the 3-letter ISO codes in altRegionISO3. // Size: 22 bytes, 11 elements var altRegionIDs = [11]uint16{ - 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105, - 0x0121, 0x015f, 0x00dc, + 0x0058, 0x0071, 0x0089, 0x00a9, 0x00ab, 0x00ae, 0x00eb, 0x0106, + 0x0122, 0x0160, 0x00dd, } // Size: 80 bytes, 20 elements var regionOldMap = [20]FromTo{ - 0: {From: 0x44, To: 0xc4}, - 1: {From: 0x58, To: 0xa7}, - 2: {From: 0x5f, To: 0x60}, - 3: {From: 0x66, To: 0x3b}, - 4: {From: 0x79, To: 0x78}, - 5: {From: 0x93, To: 0x37}, - 6: {From: 0xa3, To: 0x133}, - 7: {From: 0xc1, To: 0x133}, - 8: {From: 0xd7, To: 0x13f}, - 9: {From: 0xdc, To: 0x2b}, - 10: {From: 0xef, To: 0x133}, - 11: {From: 0xf2, To: 0xe2}, - 12: {From: 0xfc, To: 0x70}, - 13: {From: 0x103, To: 0x164}, - 14: {From: 0x12a, To: 0x126}, - 15: {From: 0x132, To: 0x7b}, - 16: {From: 0x13a, To: 0x13e}, - 17: {From: 0x141, To: 0x133}, - 18: {From: 0x15d, To: 0x15e}, - 19: {From: 0x163, To: 0x4b}, + 0: {From: 0x44, To: 0xc5}, + 1: {From: 0x59, To: 0xa8}, + 2: {From: 0x60, To: 0x61}, + 3: {From: 0x67, To: 0x3b}, + 4: {From: 0x7a, To: 0x79}, + 5: {From: 0x94, To: 0x37}, + 6: {From: 0xa4, To: 0x134}, + 7: {From: 0xc2, To: 0x134}, + 8: {From: 0xd8, To: 0x140}, + 9: {From: 0xdd, To: 0x2b}, + 10: {From: 0xf0, To: 0x134}, + 11: {From: 0xf3, To: 0xe3}, + 12: {From: 0xfd, To: 0x71}, + 13: {From: 0x104, To: 0x165}, + 14: {From: 0x12b, To: 0x127}, + 15: {From: 0x133, To: 0x7c}, + 16: {From: 0x13b, To: 0x13f}, + 17: {From: 0x142, To: 0x134}, + 18: {From: 0x15e, To: 0x15f}, + 19: {From: 0x164, To: 0x4b}, } // m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are // codes indicating collections of regions. -// Size: 716 bytes, 358 elements -var m49 = [358]int16{ +// Size: 718 bytes, 359 elements +var m49 = [359]int16{ // Entry 0 - 3F 0, 1, 2, 3, 5, 9, 11, 13, 14, 15, 17, 18, 19, 21, 29, 30, @@ -1163,50 +1184,52 @@ var m49 = [358]int16{ // Entry 40 - 7F 535, 76, 44, 64, 104, 74, 72, 112, 84, 124, 166, 180, 140, 178, 756, 384, - 184, 152, 120, 156, 170, 0, 188, 891, - 296, 192, 132, 531, 162, 196, 203, 278, - 276, 0, 262, 208, 212, 214, 204, 12, - 0, 218, 233, 818, 732, 232, 724, 231, - 967, 0, 246, 242, 238, 583, 234, 0, - 250, 249, 266, 826, 308, 268, 254, 831, + 184, 152, 120, 156, 170, 0, 0, 188, + 891, 296, 192, 132, 531, 162, 196, 203, + 278, 276, 0, 262, 208, 212, 214, 204, + 12, 0, 218, 233, 818, 732, 232, 724, + 231, 967, 0, 246, 242, 238, 583, 234, + 0, 250, 249, 266, 826, 308, 268, 254, // Entry 80 - BF - 288, 292, 304, 270, 324, 312, 226, 300, - 239, 320, 316, 624, 328, 344, 334, 340, - 191, 332, 348, 854, 0, 360, 372, 376, - 833, 356, 86, 368, 364, 352, 380, 832, - 388, 400, 392, 581, 404, 417, 116, 296, - 174, 659, 408, 410, 414, 136, 398, 418, - 422, 662, 438, 144, 430, 426, 440, 442, - 428, 434, 504, 492, 498, 499, 663, 450, + 831, 288, 292, 304, 270, 324, 312, 226, + 300, 239, 320, 316, 624, 328, 344, 334, + 340, 191, 332, 348, 854, 0, 360, 372, + 376, 833, 356, 86, 368, 364, 352, 380, + 832, 388, 400, 392, 581, 404, 417, 116, + 296, 174, 659, 408, 410, 414, 136, 398, + 418, 422, 662, 438, 144, 430, 426, 440, + 442, 428, 434, 504, 492, 498, 499, 663, // Entry C0 - FF - 584, 581, 807, 466, 104, 496, 446, 580, - 474, 478, 500, 470, 480, 462, 454, 484, - 458, 508, 516, 540, 562, 574, 566, 548, - 558, 528, 578, 524, 10, 520, 536, 570, - 554, 512, 591, 0, 604, 258, 598, 608, - 586, 616, 666, 612, 630, 275, 620, 581, - 585, 600, 591, 634, 959, 960, 961, 962, - 963, 964, 965, 966, 967, 968, 969, 970, + 450, 584, 581, 807, 466, 104, 496, 446, + 580, 474, 478, 500, 470, 480, 462, 454, + 484, 458, 508, 516, 540, 562, 574, 566, + 548, 558, 528, 578, 524, 10, 520, 536, + 570, 554, 512, 591, 0, 604, 258, 598, + 608, 586, 616, 666, 612, 630, 275, 620, + 581, 585, 600, 591, 634, 959, 960, 961, + 962, 963, 964, 965, 966, 967, 968, 969, // Entry 100 - 13F - 971, 972, 638, 716, 642, 688, 643, 646, - 682, 90, 690, 729, 752, 702, 654, 705, - 744, 703, 694, 674, 686, 706, 740, 728, - 678, 810, 222, 534, 760, 748, 0, 796, - 148, 260, 768, 764, 762, 772, 626, 795, - 788, 776, 626, 792, 780, 798, 158, 834, - 804, 800, 826, 581, 0, 840, 858, 860, - 336, 670, 704, 862, 92, 850, 704, 548, + 970, 971, 972, 638, 716, 642, 688, 643, + 646, 682, 90, 690, 729, 752, 702, 654, + 705, 744, 703, 694, 674, 686, 706, 740, + 728, 678, 810, 222, 534, 760, 748, 0, + 796, 148, 260, 768, 764, 762, 772, 626, + 795, 788, 776, 626, 792, 780, 798, 158, + 834, 804, 800, 826, 581, 0, 840, 858, + 860, 336, 670, 704, 862, 92, 850, 704, // Entry 140 - 17F - 876, 581, 882, 973, 974, 975, 976, 977, - 978, 979, 980, 981, 982, 983, 984, 985, - 986, 987, 988, 989, 990, 991, 992, 993, - 994, 995, 996, 997, 998, 720, 887, 175, - 891, 710, 894, 180, 716, 999, + 548, 876, 581, 882, 973, 974, 975, 976, + 977, 978, 979, 980, 981, 982, 983, 984, + 985, 986, 987, 988, 989, 990, 991, 992, + 993, 994, 995, 996, 997, 998, 720, 887, + 175, 891, 710, 894, 180, 716, 999, } // m49Index gives indexes into fromM49 based on the three most significant bits // of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in -// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] +// +// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] +// // for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. // The region code is stored in the 9 lsb of the indexed value. // Size: 18 bytes, 9 elements @@ -1220,165 +1243,172 @@ var m49Index = [9]int16{ var fromM49 = [333]uint16{ // Entry 0 - 3F 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, - 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, + 0x1606, 0x1868, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, - 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047, - 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18, + 0xac9b, 0xb50a, 0xb93d, 0xc03e, 0xc838, 0xd0c5, 0xd83a, 0xe047, + 0xe8a7, 0xf052, 0xf849, 0x085b, 0x10ae, 0x184c, 0x1c17, 0x1e18, // Entry 40 - 7F - 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, - 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d, - 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e, - 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f, - 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72, - 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a, - 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881, - 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884, + 0x20b4, 0x2219, 0x2921, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, + 0x3853, 0x3d2f, 0x445d, 0x4c4a, 0x5454, 0x5ca9, 0x5f60, 0x644d, + 0x684b, 0x7050, 0x7857, 0x7e91, 0x805a, 0x885e, 0x941e, 0x965f, + 0x983b, 0xa064, 0xa865, 0xac66, 0xb46a, 0xbd1b, 0xc487, 0xcc70, + 0xce70, 0xd06e, 0xd26b, 0xd477, 0xdc75, 0xde89, 0xe474, 0xec73, + 0xf031, 0xf27a, 0xf479, 0xfc7f, 0x04e6, 0x0922, 0x0c63, 0x147b, + 0x187e, 0x1c84, 0x26ee, 0x2861, 0x2c60, 0x3061, 0x4081, 0x4882, + 0x50a8, 0x5888, 0x6083, 0x687d, 0x7086, 0x788b, 0x808a, 0x8885, // Entry 80 - BF - 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d, - 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f, - 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac, - 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9, - 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd, - 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5, - 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd, - 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de, + 0x908d, 0x9892, 0x9c8f, 0xa139, 0xa890, 0xb08e, 0xb893, 0xc09e, + 0xc89a, 0xd096, 0xd89d, 0xe09c, 0xe897, 0xf098, 0xf89f, 0x004f, + 0x08a1, 0x10a3, 0x1caf, 0x20a2, 0x28a5, 0x30ab, 0x34ac, 0x3cad, + 0x42a6, 0x44b0, 0x461f, 0x4cb1, 0x54b6, 0x58b9, 0x5cb5, 0x64ba, + 0x6cb3, 0x70b7, 0x74b8, 0x7cc7, 0x84c0, 0x8ccf, 0x94d1, 0x9cce, + 0xa4c4, 0xaccc, 0xb4c9, 0xbcca, 0xc0cd, 0xc8d0, 0xd8bc, 0xe0c6, + 0xe4bd, 0xe6be, 0xe8cb, 0xf0bb, 0xf8d2, 0x00e2, 0x08d3, 0x10de, + 0x18dc, 0x20da, 0x2429, 0x265c, 0x2a30, 0x2d1c, 0x2e40, 0x30df, // Entry C0 - FF - 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5, - 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2, - 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b, - 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c, - 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513, - 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11, - 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117, - 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e, + 0x38d4, 0x4940, 0x54e1, 0x5cd9, 0x64d5, 0x6cd7, 0x74e0, 0x7cd6, + 0x84db, 0x88c8, 0x8b34, 0x8e76, 0x90c1, 0x92f1, 0x94e9, 0x9ee3, + 0xace7, 0xb0f2, 0xb8e5, 0xc0e8, 0xc8ec, 0xd0ea, 0xd8ef, 0xe08c, + 0xe527, 0xeced, 0xf4f4, 0xfd03, 0x0505, 0x0707, 0x0d08, 0x183c, + 0x1d0f, 0x26aa, 0x2826, 0x2cb2, 0x2ebf, 0x34eb, 0x3d3a, 0x4514, + 0x4d19, 0x5509, 0x5d15, 0x6106, 0x650b, 0x6d13, 0x7d0e, 0x7f12, + 0x813f, 0x8310, 0x8516, 0x8d62, 0x9965, 0xa15e, 0xa86f, 0xb118, + 0xb30c, 0xb86d, 0xc10c, 0xc917, 0xd111, 0xd91e, 0xe10d, 0xe84e, // Entry 100 - 13F - 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023, - 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2, - 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135, - 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e, - 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7, - 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff, - 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548, - 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550, + 0xf11d, 0xf525, 0xf924, 0x0123, 0x0926, 0x112a, 0x192d, 0x2023, + 0x2929, 0x312c, 0x3728, 0x3920, 0x3d2e, 0x4132, 0x4931, 0x4ec3, + 0x551a, 0x646c, 0x747c, 0x7e80, 0x80a0, 0x8299, 0x8530, 0x9136, + 0xa53e, 0xac37, 0xb537, 0xb938, 0xbd3c, 0xd941, 0xe543, 0xed5f, + 0xef5f, 0xf658, 0xfd63, 0x7c20, 0x7ef5, 0x80f6, 0x82f7, 0x84f8, + 0x86f9, 0x88fa, 0x8afb, 0x8cfc, 0x8e71, 0x90fe, 0x92ff, 0x9500, + 0x9701, 0x9902, 0x9b44, 0x9d45, 0x9f46, 0xa147, 0xa348, 0xa549, + 0xa74a, 0xa94b, 0xab4c, 0xad4d, 0xaf4e, 0xb14f, 0xb350, 0xb551, // Entry 140 - 17F - 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558, - 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65, + 0xb752, 0xb953, 0xbb54, 0xbd55, 0xbf56, 0xc157, 0xc358, 0xc559, + 0xc75a, 0xc95b, 0xcb5c, 0xcd5d, 0xcf66, } -// Size: 1995 bytes +// Size: 2128 bytes var variantIndex = map[string]uint8{ "1606nict": 0x0, "1694acad": 0x1, "1901": 0x2, "1959acad": 0x3, - "1994": 0x60, + "1994": 0x67, "1996": 0x4, "abl1943": 0x5, "akuapem": 0x6, - "alalc97": 0x62, + "alalc97": 0x69, "aluku": 0x7, "ao1990": 0x8, "aranes": 0x9, "arevela": 0xa, "arevmda": 0xb, - "asante": 0xc, - "auvern": 0xd, - "baku1926": 0xe, - "balanka": 0xf, - "barla": 0x10, - "basiceng": 0x11, - "bauddha": 0x12, - "biscayan": 0x13, - "biske": 0x5b, - "bohoric": 0x14, - "boont": 0x15, - "bornholm": 0x16, - "cisaup": 0x17, - "colb1945": 0x18, - "cornu": 0x19, - "creiss": 0x1a, - "dajnko": 0x1b, - "ekavsk": 0x1c, - "emodeng": 0x1d, - "fonipa": 0x63, - "fonkirsh": 0x64, - "fonnapa": 0x65, - "fonupa": 0x66, - "fonxsamp": 0x67, - "gascon": 0x1e, - "grclass": 0x1f, - "grital": 0x20, - "grmistr": 0x21, - "hepburn": 0x22, - "heploc": 0x61, - "hognorsk": 0x23, - "hsistemo": 0x24, - "ijekavsk": 0x25, - "itihasa": 0x26, - "ivanchov": 0x27, - "jauer": 0x28, - "jyutping": 0x29, - "kkcor": 0x2a, - "kociewie": 0x2b, - "kscor": 0x2c, - "laukika": 0x2d, - "lemosin": 0x2e, - "lengadoc": 0x2f, - "lipaw": 0x5c, - "luna1918": 0x30, - "metelko": 0x31, - "monoton": 0x32, - "ndyuka": 0x33, - "nedis": 0x34, - "newfound": 0x35, - "nicard": 0x36, - "njiva": 0x5d, - "nulik": 0x37, - "osojs": 0x5e, - "oxendict": 0x38, - "pahawh2": 0x39, - "pahawh3": 0x3a, - "pahawh4": 0x3b, - "pamaka": 0x3c, - "peano": 0x3d, - "petr1708": 0x3e, - "pinyin": 0x3f, - "polyton": 0x40, - "provenc": 0x41, - "puter": 0x42, - "rigik": 0x43, - "rozaj": 0x44, - "rumgr": 0x45, - "scotland": 0x46, - "scouse": 0x47, - "simple": 0x68, - "solba": 0x5f, - "sotav": 0x48, - "spanglis": 0x49, - "surmiran": 0x4a, - "sursilv": 0x4b, - "sutsilv": 0x4c, - "tarask": 0x4d, - "tongyong": 0x4e, - "tunumiit": 0x4f, - "uccor": 0x50, - "ucrcor": 0x51, - "ulster": 0x52, - "unifon": 0x53, - "vaidika": 0x54, - "valencia": 0x55, - "vallader": 0x56, - "vecdruka": 0x57, - "vivaraup": 0x58, - "wadegile": 0x59, - "xsistemo": 0x5a, + "arkaika": 0xc, + "asante": 0xd, + "auvern": 0xe, + "baku1926": 0xf, + "balanka": 0x10, + "barla": 0x11, + "basiceng": 0x12, + "bauddha": 0x13, + "bciav": 0x14, + "bcizbl": 0x15, + "biscayan": 0x16, + "biske": 0x62, + "bohoric": 0x17, + "boont": 0x18, + "bornholm": 0x19, + "cisaup": 0x1a, + "colb1945": 0x1b, + "cornu": 0x1c, + "creiss": 0x1d, + "dajnko": 0x1e, + "ekavsk": 0x1f, + "emodeng": 0x20, + "fonipa": 0x6a, + "fonkirsh": 0x6b, + "fonnapa": 0x6c, + "fonupa": 0x6d, + "fonxsamp": 0x6e, + "gallo": 0x21, + "gascon": 0x22, + "grclass": 0x23, + "grital": 0x24, + "grmistr": 0x25, + "hepburn": 0x26, + "heploc": 0x68, + "hognorsk": 0x27, + "hsistemo": 0x28, + "ijekavsk": 0x29, + "itihasa": 0x2a, + "ivanchov": 0x2b, + "jauer": 0x2c, + "jyutping": 0x2d, + "kkcor": 0x2e, + "kociewie": 0x2f, + "kscor": 0x30, + "laukika": 0x31, + "lemosin": 0x32, + "lengadoc": 0x33, + "lipaw": 0x63, + "ltg1929": 0x34, + "ltg2007": 0x35, + "luna1918": 0x36, + "metelko": 0x37, + "monoton": 0x38, + "ndyuka": 0x39, + "nedis": 0x3a, + "newfound": 0x3b, + "nicard": 0x3c, + "njiva": 0x64, + "nulik": 0x3d, + "osojs": 0x65, + "oxendict": 0x3e, + "pahawh2": 0x3f, + "pahawh3": 0x40, + "pahawh4": 0x41, + "pamaka": 0x42, + "peano": 0x43, + "petr1708": 0x44, + "pinyin": 0x45, + "polyton": 0x46, + "provenc": 0x47, + "puter": 0x48, + "rigik": 0x49, + "rozaj": 0x4a, + "rumgr": 0x4b, + "scotland": 0x4c, + "scouse": 0x4d, + "simple": 0x6f, + "solba": 0x66, + "sotav": 0x4e, + "spanglis": 0x4f, + "surmiran": 0x50, + "sursilv": 0x51, + "sutsilv": 0x52, + "synnejyl": 0x53, + "tarask": 0x54, + "tongyong": 0x55, + "tunumiit": 0x56, + "uccor": 0x57, + "ucrcor": 0x58, + "ulster": 0x59, + "unifon": 0x5a, + "vaidika": 0x5b, + "valencia": 0x5c, + "vallader": 0x5d, + "vecdruka": 0x5e, + "vivaraup": 0x5f, + "wadegile": 0x60, + "xsistemo": 0x61, } // variantNumSpecialized is the number of specialized variants in variants. -const variantNumSpecialized = 98 +const variantNumSpecialized = 105 // nRegionGroups is the number of region groups. const nRegionGroups = 33 @@ -1390,156 +1420,156 @@ type likelyLangRegion struct { // likelyScript is a lookup table, indexed by scriptID, for the most likely // languages and regions given a script. -// Size: 1012 bytes, 253 elements -var likelyScript = [253]likelyLangRegion{ - 1: {lang: 0x14e, region: 0x84}, - 3: {lang: 0x2a2, region: 0x106}, - 4: {lang: 0x1f, region: 0x99}, - 5: {lang: 0x3a, region: 0x6b}, - 7: {lang: 0x3b, region: 0x9c}, +// Size: 1052 bytes, 263 elements +var likelyScript = [263]likelyLangRegion{ + 1: {lang: 0x14e, region: 0x85}, + 3: {lang: 0x2a2, region: 0x107}, + 4: {lang: 0x1f, region: 0x9a}, + 5: {lang: 0x3a, region: 0x6c}, + 7: {lang: 0x3b, region: 0x9d}, 8: {lang: 0x1d7, region: 0x28}, - 9: {lang: 0x13, region: 0x9c}, - 10: {lang: 0x5b, region: 0x95}, + 9: {lang: 0x13, region: 0x9d}, + 10: {lang: 0x5b, region: 0x96}, 11: {lang: 0x60, region: 0x52}, - 12: {lang: 0xb9, region: 0xb4}, - 13: {lang: 0x63, region: 0x95}, + 12: {lang: 0xb9, region: 0xb5}, + 13: {lang: 0x63, region: 0x96}, 14: {lang: 0xa5, region: 0x35}, - 15: {lang: 0x3e9, region: 0x99}, - 17: {lang: 0x529, region: 0x12e}, - 18: {lang: 0x3b1, region: 0x99}, - 19: {lang: 0x15e, region: 0x78}, - 20: {lang: 0xc2, region: 0x95}, - 21: {lang: 0x9d, region: 0xe7}, + 15: {lang: 0x3e9, region: 0x9a}, + 17: {lang: 0x529, region: 0x12f}, + 18: {lang: 0x3b1, region: 0x9a}, + 19: {lang: 0x15e, region: 0x79}, + 20: {lang: 0xc2, region: 0x96}, + 21: {lang: 0x9d, region: 0xe8}, 22: {lang: 0xdb, region: 0x35}, 23: {lang: 0xf3, region: 0x49}, - 24: {lang: 0x4f0, region: 0x12b}, - 25: {lang: 0xe7, region: 0x13e}, - 26: {lang: 0xe5, region: 0x135}, - 29: {lang: 0xf1, region: 0x6b}, - 31: {lang: 0x1a0, region: 0x5d}, - 32: {lang: 0x3e2, region: 0x106}, - 34: {lang: 0x1be, region: 0x99}, - 38: {lang: 0x15e, region: 0x78}, - 41: {lang: 0x133, region: 0x6b}, + 24: {lang: 0x4f0, region: 0x12c}, + 25: {lang: 0xe7, region: 0x13f}, + 26: {lang: 0xe5, region: 0x136}, + 29: {lang: 0xf1, region: 0x6c}, + 31: {lang: 0x1a0, region: 0x5e}, + 32: {lang: 0x3e2, region: 0x107}, + 34: {lang: 0x1be, region: 0x9a}, + 38: {lang: 0x15e, region: 0x79}, + 41: {lang: 0x133, region: 0x6c}, 42: {lang: 0x431, region: 0x27}, - 44: {lang: 0x27, region: 0x6f}, - 46: {lang: 0x210, region: 0x7d}, + 44: {lang: 0x27, region: 0x70}, + 46: {lang: 0x210, region: 0x7e}, 47: {lang: 0xfe, region: 0x38}, - 49: {lang: 0x19b, region: 0x99}, - 50: {lang: 0x19e, region: 0x130}, - 51: {lang: 0x3e9, region: 0x99}, - 52: {lang: 0x136, region: 0x87}, - 53: {lang: 0x1a4, region: 0x99}, - 54: {lang: 0x39d, region: 0x99}, - 55: {lang: 0x529, region: 0x12e}, - 56: {lang: 0x254, region: 0xab}, + 49: {lang: 0x19b, region: 0x9a}, + 50: {lang: 0x19e, region: 0x131}, + 51: {lang: 0x3e9, region: 0x9a}, + 52: {lang: 0x136, region: 0x88}, + 53: {lang: 0x1a4, region: 0x9a}, + 54: {lang: 0x39d, region: 0x9a}, + 55: {lang: 0x529, region: 0x12f}, + 56: {lang: 0x254, region: 0xac}, 57: {lang: 0x529, region: 0x53}, - 58: {lang: 0x1cb, region: 0xe7}, + 58: {lang: 0x1cb, region: 0xe8}, 59: {lang: 0x529, region: 0x53}, - 60: {lang: 0x529, region: 0x12e}, - 61: {lang: 0x2fd, region: 0x9b}, - 62: {lang: 0x1bc, region: 0x97}, - 63: {lang: 0x200, region: 0xa2}, - 64: {lang: 0x1c5, region: 0x12b}, - 65: {lang: 0x1ca, region: 0xaf}, - 68: {lang: 0x1d5, region: 0x92}, - 70: {lang: 0x142, region: 0x9e}, - 71: {lang: 0x254, region: 0xab}, - 72: {lang: 0x20e, region: 0x95}, - 73: {lang: 0x200, region: 0xa2}, - 75: {lang: 0x135, region: 0xc4}, - 76: {lang: 0x200, region: 0xa2}, - 77: {lang: 0x3bb, region: 0xe8}, - 78: {lang: 0x24a, region: 0xa6}, - 79: {lang: 0x3fa, region: 0x99}, - 82: {lang: 0x251, region: 0x99}, - 83: {lang: 0x254, region: 0xab}, - 85: {lang: 0x88, region: 0x99}, - 86: {lang: 0x370, region: 0x123}, - 87: {lang: 0x2b8, region: 0xaf}, - 92: {lang: 0x29f, region: 0x99}, - 93: {lang: 0x2a8, region: 0x99}, - 94: {lang: 0x28f, region: 0x87}, - 95: {lang: 0x1a0, region: 0x87}, - 96: {lang: 0x2ac, region: 0x53}, - 98: {lang: 0x4f4, region: 0x12b}, - 99: {lang: 0x4f5, region: 0x12b}, - 100: {lang: 0x1be, region: 0x99}, - 102: {lang: 0x337, region: 0x9c}, - 103: {lang: 0x4f7, region: 0x53}, - 104: {lang: 0xa9, region: 0x53}, - 107: {lang: 0x2e8, region: 0x112}, - 108: {lang: 0x4f8, region: 0x10b}, - 109: {lang: 0x4f8, region: 0x10b}, - 110: {lang: 0x304, region: 0x99}, - 111: {lang: 0x31b, region: 0x99}, - 112: {lang: 0x30b, region: 0x53}, - 114: {lang: 0x31e, region: 0x35}, - 115: {lang: 0x30e, region: 0x99}, - 116: {lang: 0x414, region: 0xe8}, - 117: {lang: 0x331, region: 0xc4}, - 119: {lang: 0x4f9, region: 0x108}, - 120: {lang: 0x3b, region: 0xa1}, - 121: {lang: 0x353, region: 0xdb}, - 124: {lang: 0x2d0, region: 0x84}, - 125: {lang: 0x52a, region: 0x53}, - 126: {lang: 0x403, region: 0x96}, - 127: {lang: 0x3ee, region: 0x99}, - 128: {lang: 0x39b, region: 0xc5}, - 129: {lang: 0x395, region: 0x99}, - 130: {lang: 0x399, region: 0x135}, - 131: {lang: 0x429, region: 0x115}, - 132: {lang: 0x3b, region: 0x11c}, - 133: {lang: 0xfd, region: 0xc4}, - 134: {lang: 0x27d, region: 0x106}, - 135: {lang: 0x2c9, region: 0x53}, - 136: {lang: 0x39f, region: 0x9c}, - 137: {lang: 0x39f, region: 0x53}, - 139: {lang: 0x3ad, region: 0xb0}, - 141: {lang: 0x1c6, region: 0x53}, - 142: {lang: 0x4fd, region: 0x9c}, - 193: {lang: 0x3cb, region: 0x95}, - 196: {lang: 0x372, region: 0x10c}, - 197: {lang: 0x420, region: 0x97}, - 199: {lang: 0x4ff, region: 0x15e}, - 200: {lang: 0x3f0, region: 0x99}, - 201: {lang: 0x45, region: 0x135}, - 202: {lang: 0x139, region: 0x7b}, - 203: {lang: 0x3e9, region: 0x99}, - 205: {lang: 0x3e9, region: 0x99}, - 206: {lang: 0x3fa, region: 0x99}, - 207: {lang: 0x40c, region: 0xb3}, - 210: {lang: 0x433, region: 0x99}, - 211: {lang: 0xef, region: 0xc5}, - 212: {lang: 0x43e, region: 0x95}, - 213: {lang: 0x44d, region: 0x35}, - 214: {lang: 0x44e, region: 0x9b}, - 218: {lang: 0x45a, region: 0xe7}, - 219: {lang: 0x11a, region: 0x99}, - 220: {lang: 0x45e, region: 0x53}, - 221: {lang: 0x232, region: 0x53}, - 222: {lang: 0x450, region: 0x99}, - 223: {lang: 0x4a5, region: 0x53}, - 224: {lang: 0x9f, region: 0x13e}, - 225: {lang: 0x461, region: 0x99}, - 227: {lang: 0x528, region: 0xba}, - 228: {lang: 0x153, region: 0xe7}, - 229: {lang: 0x128, region: 0xcd}, - 230: {lang: 0x46b, region: 0x123}, - 231: {lang: 0xa9, region: 0x53}, - 232: {lang: 0x2ce, region: 0x99}, - 234: {lang: 0x4ad, region: 0x11c}, - 235: {lang: 0x4be, region: 0xb4}, - 237: {lang: 0x1ce, region: 0x99}, - 240: {lang: 0x3a9, region: 0x9c}, - 241: {lang: 0x22, region: 0x9b}, - 243: {lang: 0x1ea, region: 0x53}, - 244: {lang: 0xef, region: 0xc5}, + 60: {lang: 0x529, region: 0x12f}, + 61: {lang: 0x2fd, region: 0x9c}, + 62: {lang: 0x1bc, region: 0x98}, + 63: {lang: 0x200, region: 0xa3}, + 64: {lang: 0x1c5, region: 0x12c}, + 65: {lang: 0x1ca, region: 0xb0}, + 68: {lang: 0x1d5, region: 0x93}, + 70: {lang: 0x142, region: 0x9f}, + 71: {lang: 0x254, region: 0xac}, + 72: {lang: 0x20e, region: 0x96}, + 73: {lang: 0x200, region: 0xa3}, + 75: {lang: 0x135, region: 0xc5}, + 76: {lang: 0x200, region: 0xa3}, + 78: {lang: 0x3bb, region: 0xe9}, + 79: {lang: 0x24a, region: 0xa7}, + 80: {lang: 0x3fa, region: 0x9a}, + 83: {lang: 0x251, region: 0x9a}, + 84: {lang: 0x254, region: 0xac}, + 86: {lang: 0x88, region: 0x9a}, + 87: {lang: 0x370, region: 0x124}, + 88: {lang: 0x2b8, region: 0xb0}, + 93: {lang: 0x29f, region: 0x9a}, + 94: {lang: 0x2a8, region: 0x9a}, + 95: {lang: 0x28f, region: 0x88}, + 96: {lang: 0x1a0, region: 0x88}, + 97: {lang: 0x2ac, region: 0x53}, + 99: {lang: 0x4f4, region: 0x12c}, + 100: {lang: 0x4f5, region: 0x12c}, + 101: {lang: 0x1be, region: 0x9a}, + 103: {lang: 0x337, region: 0x9d}, + 104: {lang: 0x4f7, region: 0x53}, + 105: {lang: 0xa9, region: 0x53}, + 108: {lang: 0x2e8, region: 0x113}, + 109: {lang: 0x4f8, region: 0x10c}, + 110: {lang: 0x4f8, region: 0x10c}, + 111: {lang: 0x304, region: 0x9a}, + 112: {lang: 0x31b, region: 0x9a}, + 113: {lang: 0x30b, region: 0x53}, + 115: {lang: 0x31e, region: 0x35}, + 116: {lang: 0x30e, region: 0x9a}, + 117: {lang: 0x414, region: 0xe9}, + 118: {lang: 0x331, region: 0xc5}, + 121: {lang: 0x4f9, region: 0x109}, + 122: {lang: 0x3b, region: 0xa2}, + 123: {lang: 0x353, region: 0xdc}, + 126: {lang: 0x2d0, region: 0x85}, + 127: {lang: 0x52a, region: 0x53}, + 128: {lang: 0x403, region: 0x97}, + 129: {lang: 0x3ee, region: 0x9a}, + 130: {lang: 0x39b, region: 0xc6}, + 131: {lang: 0x395, region: 0x9a}, + 132: {lang: 0x399, region: 0x136}, + 133: {lang: 0x429, region: 0x116}, + 135: {lang: 0x3b, region: 0x11d}, + 136: {lang: 0xfd, region: 0xc5}, + 139: {lang: 0x27d, region: 0x107}, + 140: {lang: 0x2c9, region: 0x53}, + 141: {lang: 0x39f, region: 0x9d}, + 142: {lang: 0x39f, region: 0x53}, + 144: {lang: 0x3ad, region: 0xb1}, + 146: {lang: 0x1c6, region: 0x53}, + 147: {lang: 0x4fd, region: 0x9d}, + 200: {lang: 0x3cb, region: 0x96}, + 203: {lang: 0x372, region: 0x10d}, + 204: {lang: 0x420, region: 0x98}, + 206: {lang: 0x4ff, region: 0x15f}, + 207: {lang: 0x3f0, region: 0x9a}, + 208: {lang: 0x45, region: 0x136}, + 209: {lang: 0x139, region: 0x7c}, + 210: {lang: 0x3e9, region: 0x9a}, + 212: {lang: 0x3e9, region: 0x9a}, + 213: {lang: 0x3fa, region: 0x9a}, + 214: {lang: 0x40c, region: 0xb4}, + 217: {lang: 0x433, region: 0x9a}, + 218: {lang: 0xef, region: 0xc6}, + 219: {lang: 0x43e, region: 0x96}, + 221: {lang: 0x44d, region: 0x35}, + 222: {lang: 0x44e, region: 0x9c}, + 226: {lang: 0x45a, region: 0xe8}, + 227: {lang: 0x11a, region: 0x9a}, + 228: {lang: 0x45e, region: 0x53}, + 229: {lang: 0x232, region: 0x53}, + 230: {lang: 0x450, region: 0x9a}, + 231: {lang: 0x4a5, region: 0x53}, + 232: {lang: 0x9f, region: 0x13f}, + 233: {lang: 0x461, region: 0x9a}, + 235: {lang: 0x528, region: 0xbb}, + 236: {lang: 0x153, region: 0xe8}, + 237: {lang: 0x128, region: 0xce}, + 238: {lang: 0x46b, region: 0x124}, + 239: {lang: 0xa9, region: 0x53}, + 240: {lang: 0x2ce, region: 0x9a}, + 243: {lang: 0x4ad, region: 0x11d}, + 244: {lang: 0x4be, region: 0xb5}, + 247: {lang: 0x1ce, region: 0x9a}, + 250: {lang: 0x3a9, region: 0x9d}, + 251: {lang: 0x22, region: 0x9c}, + 253: {lang: 0x1ea, region: 0x53}, + 254: {lang: 0xef, region: 0xc6}, } type likelyScriptRegion struct { region uint16 - script uint8 + script uint16 flags uint8 } @@ -1547,1430 +1577,1430 @@ type likelyScriptRegion struct { // scripts and regions given incomplete information. If more entries exist for a // given language, region and script are the index and size respectively // of the list in likelyLangList. -// Size: 5320 bytes, 1330 elements +// Size: 7980 bytes, 1330 elements var likelyLang = [1330]likelyScriptRegion{ - 0: {region: 0x135, script: 0x5a, flags: 0x0}, - 1: {region: 0x6f, script: 0x5a, flags: 0x0}, - 2: {region: 0x165, script: 0x5a, flags: 0x0}, - 3: {region: 0x165, script: 0x5a, flags: 0x0}, - 4: {region: 0x165, script: 0x5a, flags: 0x0}, - 5: {region: 0x7d, script: 0x20, flags: 0x0}, - 6: {region: 0x165, script: 0x5a, flags: 0x0}, - 7: {region: 0x165, script: 0x20, flags: 0x0}, - 8: {region: 0x80, script: 0x5a, flags: 0x0}, - 9: {region: 0x165, script: 0x5a, flags: 0x0}, - 10: {region: 0x165, script: 0x5a, flags: 0x0}, - 11: {region: 0x165, script: 0x5a, flags: 0x0}, - 12: {region: 0x95, script: 0x5a, flags: 0x0}, - 13: {region: 0x131, script: 0x5a, flags: 0x0}, - 14: {region: 0x80, script: 0x5a, flags: 0x0}, - 15: {region: 0x165, script: 0x5a, flags: 0x0}, - 16: {region: 0x165, script: 0x5a, flags: 0x0}, - 17: {region: 0x106, script: 0x20, flags: 0x0}, - 18: {region: 0x165, script: 0x5a, flags: 0x0}, - 19: {region: 0x9c, script: 0x9, flags: 0x0}, - 20: {region: 0x128, script: 0x5, flags: 0x0}, - 21: {region: 0x165, script: 0x5a, flags: 0x0}, - 22: {region: 0x161, script: 0x5a, flags: 0x0}, - 23: {region: 0x165, script: 0x5a, flags: 0x0}, - 24: {region: 0x165, script: 0x5a, flags: 0x0}, - 25: {region: 0x165, script: 0x5a, flags: 0x0}, - 26: {region: 0x165, script: 0x5a, flags: 0x0}, - 27: {region: 0x165, script: 0x5a, flags: 0x0}, - 28: {region: 0x52, script: 0x5a, flags: 0x0}, - 29: {region: 0x165, script: 0x5a, flags: 0x0}, - 30: {region: 0x165, script: 0x5a, flags: 0x0}, - 31: {region: 0x99, script: 0x4, flags: 0x0}, - 32: {region: 0x165, script: 0x5a, flags: 0x0}, - 33: {region: 0x80, script: 0x5a, flags: 0x0}, - 34: {region: 0x9b, script: 0xf1, flags: 0x0}, - 35: {region: 0x165, script: 0x5a, flags: 0x0}, - 36: {region: 0x165, script: 0x5a, flags: 0x0}, - 37: {region: 0x14d, script: 0x5a, flags: 0x0}, - 38: {region: 0x106, script: 0x20, flags: 0x0}, - 39: {region: 0x6f, script: 0x2c, flags: 0x0}, - 40: {region: 0x165, script: 0x5a, flags: 0x0}, - 41: {region: 0x165, script: 0x5a, flags: 0x0}, - 42: {region: 0xd6, script: 0x5a, flags: 0x0}, - 43: {region: 0x165, script: 0x5a, flags: 0x0}, - 45: {region: 0x165, script: 0x5a, flags: 0x0}, - 46: {region: 0x165, script: 0x5a, flags: 0x0}, - 47: {region: 0x165, script: 0x5a, flags: 0x0}, - 48: {region: 0x165, script: 0x5a, flags: 0x0}, - 49: {region: 0x165, script: 0x5a, flags: 0x0}, - 50: {region: 0x165, script: 0x5a, flags: 0x0}, - 51: {region: 0x95, script: 0x5a, flags: 0x0}, - 52: {region: 0x165, script: 0x5, flags: 0x0}, - 53: {region: 0x122, script: 0x5, flags: 0x0}, - 54: {region: 0x165, script: 0x5a, flags: 0x0}, - 55: {region: 0x165, script: 0x5a, flags: 0x0}, - 56: {region: 0x165, script: 0x5a, flags: 0x0}, - 57: {region: 0x165, script: 0x5a, flags: 0x0}, - 58: {region: 0x6b, script: 0x5, flags: 0x0}, + 0: {region: 0x136, script: 0x5b, flags: 0x0}, + 1: {region: 0x70, script: 0x5b, flags: 0x0}, + 2: {region: 0x166, script: 0x5b, flags: 0x0}, + 3: {region: 0x166, script: 0x5b, flags: 0x0}, + 4: {region: 0x166, script: 0x5b, flags: 0x0}, + 5: {region: 0x7e, script: 0x20, flags: 0x0}, + 6: {region: 0x166, script: 0x5b, flags: 0x0}, + 7: {region: 0x166, script: 0x20, flags: 0x0}, + 8: {region: 0x81, script: 0x5b, flags: 0x0}, + 9: {region: 0x166, script: 0x5b, flags: 0x0}, + 10: {region: 0x166, script: 0x5b, flags: 0x0}, + 11: {region: 0x166, script: 0x5b, flags: 0x0}, + 12: {region: 0x96, script: 0x5b, flags: 0x0}, + 13: {region: 0x132, script: 0x5b, flags: 0x0}, + 14: {region: 0x81, script: 0x5b, flags: 0x0}, + 15: {region: 0x166, script: 0x5b, flags: 0x0}, + 16: {region: 0x166, script: 0x5b, flags: 0x0}, + 17: {region: 0x107, script: 0x20, flags: 0x0}, + 18: {region: 0x166, script: 0x5b, flags: 0x0}, + 19: {region: 0x9d, script: 0x9, flags: 0x0}, + 20: {region: 0x129, script: 0x5, flags: 0x0}, + 21: {region: 0x166, script: 0x5b, flags: 0x0}, + 22: {region: 0x162, script: 0x5b, flags: 0x0}, + 23: {region: 0x166, script: 0x5b, flags: 0x0}, + 24: {region: 0x166, script: 0x5b, flags: 0x0}, + 25: {region: 0x166, script: 0x5b, flags: 0x0}, + 26: {region: 0x166, script: 0x5b, flags: 0x0}, + 27: {region: 0x166, script: 0x5b, flags: 0x0}, + 28: {region: 0x52, script: 0x5b, flags: 0x0}, + 29: {region: 0x166, script: 0x5b, flags: 0x0}, + 30: {region: 0x166, script: 0x5b, flags: 0x0}, + 31: {region: 0x9a, script: 0x4, flags: 0x0}, + 32: {region: 0x166, script: 0x5b, flags: 0x0}, + 33: {region: 0x81, script: 0x5b, flags: 0x0}, + 34: {region: 0x9c, script: 0xfb, flags: 0x0}, + 35: {region: 0x166, script: 0x5b, flags: 0x0}, + 36: {region: 0x166, script: 0x5b, flags: 0x0}, + 37: {region: 0x14e, script: 0x5b, flags: 0x0}, + 38: {region: 0x107, script: 0x20, flags: 0x0}, + 39: {region: 0x70, script: 0x2c, flags: 0x0}, + 40: {region: 0x166, script: 0x5b, flags: 0x0}, + 41: {region: 0x166, script: 0x5b, flags: 0x0}, + 42: {region: 0xd7, script: 0x5b, flags: 0x0}, + 43: {region: 0x166, script: 0x5b, flags: 0x0}, + 45: {region: 0x166, script: 0x5b, flags: 0x0}, + 46: {region: 0x166, script: 0x5b, flags: 0x0}, + 47: {region: 0x166, script: 0x5b, flags: 0x0}, + 48: {region: 0x166, script: 0x5b, flags: 0x0}, + 49: {region: 0x166, script: 0x5b, flags: 0x0}, + 50: {region: 0x166, script: 0x5b, flags: 0x0}, + 51: {region: 0x96, script: 0x5b, flags: 0x0}, + 52: {region: 0x166, script: 0x5, flags: 0x0}, + 53: {region: 0x123, script: 0x5, flags: 0x0}, + 54: {region: 0x166, script: 0x5b, flags: 0x0}, + 55: {region: 0x166, script: 0x5b, flags: 0x0}, + 56: {region: 0x166, script: 0x5b, flags: 0x0}, + 57: {region: 0x166, script: 0x5b, flags: 0x0}, + 58: {region: 0x6c, script: 0x5, flags: 0x0}, 59: {region: 0x0, script: 0x3, flags: 0x1}, - 60: {region: 0x165, script: 0x5a, flags: 0x0}, - 61: {region: 0x51, script: 0x5a, flags: 0x0}, - 62: {region: 0x3f, script: 0x5a, flags: 0x0}, - 63: {region: 0x67, script: 0x5, flags: 0x0}, - 65: {region: 0xba, script: 0x5, flags: 0x0}, - 66: {region: 0x6b, script: 0x5, flags: 0x0}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0x12f, script: 0x5a, flags: 0x0}, - 69: {region: 0x135, script: 0xc9, flags: 0x0}, - 70: {region: 0x165, script: 0x5a, flags: 0x0}, - 71: {region: 0x165, script: 0x5a, flags: 0x0}, - 72: {region: 0x6e, script: 0x5a, flags: 0x0}, - 73: {region: 0x165, script: 0x5a, flags: 0x0}, - 74: {region: 0x165, script: 0x5a, flags: 0x0}, - 75: {region: 0x49, script: 0x5a, flags: 0x0}, - 76: {region: 0x165, script: 0x5a, flags: 0x0}, - 77: {region: 0x106, script: 0x20, flags: 0x0}, - 78: {region: 0x165, script: 0x5, flags: 0x0}, - 79: {region: 0x165, script: 0x5a, flags: 0x0}, - 80: {region: 0x165, script: 0x5a, flags: 0x0}, - 81: {region: 0x165, script: 0x5a, flags: 0x0}, - 82: {region: 0x99, script: 0x22, flags: 0x0}, - 83: {region: 0x165, script: 0x5a, flags: 0x0}, - 84: {region: 0x165, script: 0x5a, flags: 0x0}, - 85: {region: 0x165, script: 0x5a, flags: 0x0}, - 86: {region: 0x3f, script: 0x5a, flags: 0x0}, - 87: {region: 0x165, script: 0x5a, flags: 0x0}, + 60: {region: 0x166, script: 0x5b, flags: 0x0}, + 61: {region: 0x51, script: 0x5b, flags: 0x0}, + 62: {region: 0x3f, script: 0x5b, flags: 0x0}, + 63: {region: 0x68, script: 0x5, flags: 0x0}, + 65: {region: 0xbb, script: 0x5, flags: 0x0}, + 66: {region: 0x6c, script: 0x5, flags: 0x0}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0x130, script: 0x5b, flags: 0x0}, + 69: {region: 0x136, script: 0xd0, flags: 0x0}, + 70: {region: 0x166, script: 0x5b, flags: 0x0}, + 71: {region: 0x166, script: 0x5b, flags: 0x0}, + 72: {region: 0x6f, script: 0x5b, flags: 0x0}, + 73: {region: 0x166, script: 0x5b, flags: 0x0}, + 74: {region: 0x166, script: 0x5b, flags: 0x0}, + 75: {region: 0x49, script: 0x5b, flags: 0x0}, + 76: {region: 0x166, script: 0x5b, flags: 0x0}, + 77: {region: 0x107, script: 0x20, flags: 0x0}, + 78: {region: 0x166, script: 0x5, flags: 0x0}, + 79: {region: 0x166, script: 0x5b, flags: 0x0}, + 80: {region: 0x166, script: 0x5b, flags: 0x0}, + 81: {region: 0x166, script: 0x5b, flags: 0x0}, + 82: {region: 0x9a, script: 0x22, flags: 0x0}, + 83: {region: 0x166, script: 0x5b, flags: 0x0}, + 84: {region: 0x166, script: 0x5b, flags: 0x0}, + 85: {region: 0x166, script: 0x5b, flags: 0x0}, + 86: {region: 0x3f, script: 0x5b, flags: 0x0}, + 87: {region: 0x166, script: 0x5b, flags: 0x0}, 88: {region: 0x3, script: 0x5, flags: 0x1}, - 89: {region: 0x106, script: 0x20, flags: 0x0}, - 90: {region: 0xe8, script: 0x5, flags: 0x0}, - 91: {region: 0x95, script: 0x5a, flags: 0x0}, - 92: {region: 0xdb, script: 0x22, flags: 0x0}, - 93: {region: 0x2e, script: 0x5a, flags: 0x0}, - 94: {region: 0x52, script: 0x5a, flags: 0x0}, - 95: {region: 0x165, script: 0x5a, flags: 0x0}, + 89: {region: 0x107, script: 0x20, flags: 0x0}, + 90: {region: 0xe9, script: 0x5, flags: 0x0}, + 91: {region: 0x96, script: 0x5b, flags: 0x0}, + 92: {region: 0xdc, script: 0x22, flags: 0x0}, + 93: {region: 0x2e, script: 0x5b, flags: 0x0}, + 94: {region: 0x52, script: 0x5b, flags: 0x0}, + 95: {region: 0x166, script: 0x5b, flags: 0x0}, 96: {region: 0x52, script: 0xb, flags: 0x0}, - 97: {region: 0x165, script: 0x5a, flags: 0x0}, - 98: {region: 0x165, script: 0x5a, flags: 0x0}, - 99: {region: 0x95, script: 0x5a, flags: 0x0}, - 100: {region: 0x165, script: 0x5a, flags: 0x0}, - 101: {region: 0x52, script: 0x5a, flags: 0x0}, - 102: {region: 0x165, script: 0x5a, flags: 0x0}, - 103: {region: 0x165, script: 0x5a, flags: 0x0}, - 104: {region: 0x165, script: 0x5a, flags: 0x0}, - 105: {region: 0x165, script: 0x5a, flags: 0x0}, - 106: {region: 0x4f, script: 0x5a, flags: 0x0}, - 107: {region: 0x165, script: 0x5a, flags: 0x0}, - 108: {region: 0x165, script: 0x5a, flags: 0x0}, - 109: {region: 0x165, script: 0x5a, flags: 0x0}, - 110: {region: 0x165, script: 0x2c, flags: 0x0}, - 111: {region: 0x165, script: 0x5a, flags: 0x0}, - 112: {region: 0x165, script: 0x5a, flags: 0x0}, + 97: {region: 0x166, script: 0x5b, flags: 0x0}, + 98: {region: 0x166, script: 0x5b, flags: 0x0}, + 99: {region: 0x96, script: 0x5b, flags: 0x0}, + 100: {region: 0x166, script: 0x5b, flags: 0x0}, + 101: {region: 0x52, script: 0x5b, flags: 0x0}, + 102: {region: 0x166, script: 0x5b, flags: 0x0}, + 103: {region: 0x166, script: 0x5b, flags: 0x0}, + 104: {region: 0x166, script: 0x5b, flags: 0x0}, + 105: {region: 0x166, script: 0x5b, flags: 0x0}, + 106: {region: 0x4f, script: 0x5b, flags: 0x0}, + 107: {region: 0x166, script: 0x5b, flags: 0x0}, + 108: {region: 0x166, script: 0x5b, flags: 0x0}, + 109: {region: 0x166, script: 0x5b, flags: 0x0}, + 110: {region: 0x166, script: 0x2c, flags: 0x0}, + 111: {region: 0x166, script: 0x5b, flags: 0x0}, + 112: {region: 0x166, script: 0x5b, flags: 0x0}, 113: {region: 0x47, script: 0x20, flags: 0x0}, - 114: {region: 0x165, script: 0x5a, flags: 0x0}, - 115: {region: 0x165, script: 0x5a, flags: 0x0}, - 116: {region: 0x10b, script: 0x5, flags: 0x0}, - 117: {region: 0x162, script: 0x5a, flags: 0x0}, - 118: {region: 0x165, script: 0x5a, flags: 0x0}, - 119: {region: 0x95, script: 0x5a, flags: 0x0}, - 120: {region: 0x165, script: 0x5a, flags: 0x0}, - 121: {region: 0x12f, script: 0x5a, flags: 0x0}, - 122: {region: 0x52, script: 0x5a, flags: 0x0}, - 123: {region: 0x99, script: 0xde, flags: 0x0}, - 124: {region: 0xe8, script: 0x5, flags: 0x0}, - 125: {region: 0x99, script: 0x22, flags: 0x0}, + 114: {region: 0x166, script: 0x5b, flags: 0x0}, + 115: {region: 0x166, script: 0x5b, flags: 0x0}, + 116: {region: 0x10c, script: 0x5, flags: 0x0}, + 117: {region: 0x163, script: 0x5b, flags: 0x0}, + 118: {region: 0x166, script: 0x5b, flags: 0x0}, + 119: {region: 0x96, script: 0x5b, flags: 0x0}, + 120: {region: 0x166, script: 0x5b, flags: 0x0}, + 121: {region: 0x130, script: 0x5b, flags: 0x0}, + 122: {region: 0x52, script: 0x5b, flags: 0x0}, + 123: {region: 0x9a, script: 0xe6, flags: 0x0}, + 124: {region: 0xe9, script: 0x5, flags: 0x0}, + 125: {region: 0x9a, script: 0x22, flags: 0x0}, 126: {region: 0x38, script: 0x20, flags: 0x0}, - 127: {region: 0x99, script: 0x22, flags: 0x0}, - 128: {region: 0xe8, script: 0x5, flags: 0x0}, - 129: {region: 0x12b, script: 0x34, flags: 0x0}, - 131: {region: 0x99, script: 0x22, flags: 0x0}, - 132: {region: 0x165, script: 0x5a, flags: 0x0}, - 133: {region: 0x99, script: 0x22, flags: 0x0}, - 134: {region: 0xe7, script: 0x5a, flags: 0x0}, - 135: {region: 0x165, script: 0x5a, flags: 0x0}, - 136: {region: 0x99, script: 0x22, flags: 0x0}, - 137: {region: 0x165, script: 0x5a, flags: 0x0}, - 138: {region: 0x13f, script: 0x5a, flags: 0x0}, - 139: {region: 0x165, script: 0x5a, flags: 0x0}, - 140: {region: 0x165, script: 0x5a, flags: 0x0}, - 141: {region: 0xe7, script: 0x5a, flags: 0x0}, - 142: {region: 0x165, script: 0x5a, flags: 0x0}, - 143: {region: 0xd6, script: 0x5a, flags: 0x0}, - 144: {region: 0x165, script: 0x5a, flags: 0x0}, - 145: {region: 0x165, script: 0x5a, flags: 0x0}, - 146: {region: 0x165, script: 0x5a, flags: 0x0}, - 147: {region: 0x165, script: 0x2c, flags: 0x0}, - 148: {region: 0x99, script: 0x22, flags: 0x0}, - 149: {region: 0x95, script: 0x5a, flags: 0x0}, - 150: {region: 0x165, script: 0x5a, flags: 0x0}, - 151: {region: 0x165, script: 0x5a, flags: 0x0}, - 152: {region: 0x114, script: 0x5a, flags: 0x0}, - 153: {region: 0x165, script: 0x5a, flags: 0x0}, - 154: {region: 0x165, script: 0x5a, flags: 0x0}, - 155: {region: 0x52, script: 0x5a, flags: 0x0}, - 156: {region: 0x165, script: 0x5a, flags: 0x0}, - 157: {region: 0xe7, script: 0x5a, flags: 0x0}, - 158: {region: 0x165, script: 0x5a, flags: 0x0}, - 159: {region: 0x13e, script: 0xe0, flags: 0x0}, - 160: {region: 0xc3, script: 0x5a, flags: 0x0}, - 161: {region: 0x165, script: 0x5a, flags: 0x0}, - 162: {region: 0x165, script: 0x5a, flags: 0x0}, - 163: {region: 0xc3, script: 0x5a, flags: 0x0}, - 164: {region: 0x165, script: 0x5a, flags: 0x0}, + 127: {region: 0x9a, script: 0x22, flags: 0x0}, + 128: {region: 0xe9, script: 0x5, flags: 0x0}, + 129: {region: 0x12c, script: 0x34, flags: 0x0}, + 131: {region: 0x9a, script: 0x22, flags: 0x0}, + 132: {region: 0x166, script: 0x5b, flags: 0x0}, + 133: {region: 0x9a, script: 0x22, flags: 0x0}, + 134: {region: 0xe8, script: 0x5b, flags: 0x0}, + 135: {region: 0x166, script: 0x5b, flags: 0x0}, + 136: {region: 0x9a, script: 0x22, flags: 0x0}, + 137: {region: 0x166, script: 0x5b, flags: 0x0}, + 138: {region: 0x140, script: 0x5b, flags: 0x0}, + 139: {region: 0x166, script: 0x5b, flags: 0x0}, + 140: {region: 0x166, script: 0x5b, flags: 0x0}, + 141: {region: 0xe8, script: 0x5b, flags: 0x0}, + 142: {region: 0x166, script: 0x5b, flags: 0x0}, + 143: {region: 0xd7, script: 0x5b, flags: 0x0}, + 144: {region: 0x166, script: 0x5b, flags: 0x0}, + 145: {region: 0x166, script: 0x5b, flags: 0x0}, + 146: {region: 0x166, script: 0x5b, flags: 0x0}, + 147: {region: 0x166, script: 0x2c, flags: 0x0}, + 148: {region: 0x9a, script: 0x22, flags: 0x0}, + 149: {region: 0x96, script: 0x5b, flags: 0x0}, + 150: {region: 0x166, script: 0x5b, flags: 0x0}, + 151: {region: 0x166, script: 0x5b, flags: 0x0}, + 152: {region: 0x115, script: 0x5b, flags: 0x0}, + 153: {region: 0x166, script: 0x5b, flags: 0x0}, + 154: {region: 0x166, script: 0x5b, flags: 0x0}, + 155: {region: 0x52, script: 0x5b, flags: 0x0}, + 156: {region: 0x166, script: 0x5b, flags: 0x0}, + 157: {region: 0xe8, script: 0x5b, flags: 0x0}, + 158: {region: 0x166, script: 0x5b, flags: 0x0}, + 159: {region: 0x13f, script: 0xe8, flags: 0x0}, + 160: {region: 0xc4, script: 0x5b, flags: 0x0}, + 161: {region: 0x166, script: 0x5b, flags: 0x0}, + 162: {region: 0x166, script: 0x5b, flags: 0x0}, + 163: {region: 0xc4, script: 0x5b, flags: 0x0}, + 164: {region: 0x166, script: 0x5b, flags: 0x0}, 165: {region: 0x35, script: 0xe, flags: 0x0}, - 166: {region: 0x165, script: 0x5a, flags: 0x0}, - 167: {region: 0x165, script: 0x5a, flags: 0x0}, - 168: {region: 0x165, script: 0x5a, flags: 0x0}, - 169: {region: 0x53, script: 0xe7, flags: 0x0}, - 170: {region: 0x165, script: 0x5a, flags: 0x0}, - 171: {region: 0x165, script: 0x5a, flags: 0x0}, - 172: {region: 0x165, script: 0x5a, flags: 0x0}, - 173: {region: 0x99, script: 0xe, flags: 0x0}, - 174: {region: 0x165, script: 0x5a, flags: 0x0}, - 175: {region: 0x9c, script: 0x5, flags: 0x0}, - 176: {region: 0x165, script: 0x5a, flags: 0x0}, - 177: {region: 0x4f, script: 0x5a, flags: 0x0}, - 178: {region: 0x78, script: 0x5a, flags: 0x0}, - 179: {region: 0x99, script: 0x22, flags: 0x0}, - 180: {region: 0xe8, script: 0x5, flags: 0x0}, - 181: {region: 0x99, script: 0x22, flags: 0x0}, - 182: {region: 0x165, script: 0x5a, flags: 0x0}, - 183: {region: 0x33, script: 0x5a, flags: 0x0}, - 184: {region: 0x165, script: 0x5a, flags: 0x0}, - 185: {region: 0xb4, script: 0xc, flags: 0x0}, - 186: {region: 0x52, script: 0x5a, flags: 0x0}, - 187: {region: 0x165, script: 0x2c, flags: 0x0}, - 188: {region: 0xe7, script: 0x5a, flags: 0x0}, - 189: {region: 0x165, script: 0x5a, flags: 0x0}, - 190: {region: 0xe8, script: 0x22, flags: 0x0}, - 191: {region: 0x106, script: 0x20, flags: 0x0}, - 192: {region: 0x15f, script: 0x5a, flags: 0x0}, - 193: {region: 0x165, script: 0x5a, flags: 0x0}, - 194: {region: 0x95, script: 0x5a, flags: 0x0}, - 195: {region: 0x165, script: 0x5a, flags: 0x0}, - 196: {region: 0x52, script: 0x5a, flags: 0x0}, - 197: {region: 0x165, script: 0x5a, flags: 0x0}, - 198: {region: 0x165, script: 0x5a, flags: 0x0}, - 199: {region: 0x165, script: 0x5a, flags: 0x0}, - 200: {region: 0x86, script: 0x5a, flags: 0x0}, - 201: {region: 0x165, script: 0x5a, flags: 0x0}, - 202: {region: 0x165, script: 0x5a, flags: 0x0}, - 203: {region: 0x165, script: 0x5a, flags: 0x0}, - 204: {region: 0x165, script: 0x5a, flags: 0x0}, - 205: {region: 0x6d, script: 0x2c, flags: 0x0}, - 206: {region: 0x165, script: 0x5a, flags: 0x0}, - 207: {region: 0x165, script: 0x5a, flags: 0x0}, - 208: {region: 0x52, script: 0x5a, flags: 0x0}, - 209: {region: 0x165, script: 0x5a, flags: 0x0}, - 210: {region: 0x165, script: 0x5a, flags: 0x0}, - 211: {region: 0xc3, script: 0x5a, flags: 0x0}, - 212: {region: 0x165, script: 0x5a, flags: 0x0}, - 213: {region: 0x165, script: 0x5a, flags: 0x0}, - 214: {region: 0x165, script: 0x5a, flags: 0x0}, - 215: {region: 0x6e, script: 0x5a, flags: 0x0}, - 216: {region: 0x165, script: 0x5a, flags: 0x0}, - 217: {region: 0x165, script: 0x5a, flags: 0x0}, - 218: {region: 0xd6, script: 0x5a, flags: 0x0}, + 166: {region: 0x166, script: 0x5b, flags: 0x0}, + 167: {region: 0x166, script: 0x5b, flags: 0x0}, + 168: {region: 0x166, script: 0x5b, flags: 0x0}, + 169: {region: 0x53, script: 0xef, flags: 0x0}, + 170: {region: 0x166, script: 0x5b, flags: 0x0}, + 171: {region: 0x166, script: 0x5b, flags: 0x0}, + 172: {region: 0x166, script: 0x5b, flags: 0x0}, + 173: {region: 0x9a, script: 0xe, flags: 0x0}, + 174: {region: 0x166, script: 0x5b, flags: 0x0}, + 175: {region: 0x9d, script: 0x5, flags: 0x0}, + 176: {region: 0x166, script: 0x5b, flags: 0x0}, + 177: {region: 0x4f, script: 0x5b, flags: 0x0}, + 178: {region: 0x79, script: 0x5b, flags: 0x0}, + 179: {region: 0x9a, script: 0x22, flags: 0x0}, + 180: {region: 0xe9, script: 0x5, flags: 0x0}, + 181: {region: 0x9a, script: 0x22, flags: 0x0}, + 182: {region: 0x166, script: 0x5b, flags: 0x0}, + 183: {region: 0x33, script: 0x5b, flags: 0x0}, + 184: {region: 0x166, script: 0x5b, flags: 0x0}, + 185: {region: 0xb5, script: 0xc, flags: 0x0}, + 186: {region: 0x52, script: 0x5b, flags: 0x0}, + 187: {region: 0x166, script: 0x2c, flags: 0x0}, + 188: {region: 0xe8, script: 0x5b, flags: 0x0}, + 189: {region: 0x166, script: 0x5b, flags: 0x0}, + 190: {region: 0xe9, script: 0x22, flags: 0x0}, + 191: {region: 0x107, script: 0x20, flags: 0x0}, + 192: {region: 0x160, script: 0x5b, flags: 0x0}, + 193: {region: 0x166, script: 0x5b, flags: 0x0}, + 194: {region: 0x96, script: 0x5b, flags: 0x0}, + 195: {region: 0x166, script: 0x5b, flags: 0x0}, + 196: {region: 0x52, script: 0x5b, flags: 0x0}, + 197: {region: 0x166, script: 0x5b, flags: 0x0}, + 198: {region: 0x166, script: 0x5b, flags: 0x0}, + 199: {region: 0x166, script: 0x5b, flags: 0x0}, + 200: {region: 0x87, script: 0x5b, flags: 0x0}, + 201: {region: 0x166, script: 0x5b, flags: 0x0}, + 202: {region: 0x166, script: 0x5b, flags: 0x0}, + 203: {region: 0x166, script: 0x5b, flags: 0x0}, + 204: {region: 0x166, script: 0x5b, flags: 0x0}, + 205: {region: 0x6e, script: 0x2c, flags: 0x0}, + 206: {region: 0x166, script: 0x5b, flags: 0x0}, + 207: {region: 0x166, script: 0x5b, flags: 0x0}, + 208: {region: 0x52, script: 0x5b, flags: 0x0}, + 209: {region: 0x166, script: 0x5b, flags: 0x0}, + 210: {region: 0x166, script: 0x5b, flags: 0x0}, + 211: {region: 0xc4, script: 0x5b, flags: 0x0}, + 212: {region: 0x166, script: 0x5b, flags: 0x0}, + 213: {region: 0x166, script: 0x5b, flags: 0x0}, + 214: {region: 0x166, script: 0x5b, flags: 0x0}, + 215: {region: 0x6f, script: 0x5b, flags: 0x0}, + 216: {region: 0x166, script: 0x5b, flags: 0x0}, + 217: {region: 0x166, script: 0x5b, flags: 0x0}, + 218: {region: 0xd7, script: 0x5b, flags: 0x0}, 219: {region: 0x35, script: 0x16, flags: 0x0}, - 220: {region: 0x106, script: 0x20, flags: 0x0}, - 221: {region: 0xe7, script: 0x5a, flags: 0x0}, - 222: {region: 0x165, script: 0x5a, flags: 0x0}, - 223: {region: 0x131, script: 0x5a, flags: 0x0}, - 224: {region: 0x8a, script: 0x5a, flags: 0x0}, - 225: {region: 0x75, script: 0x5a, flags: 0x0}, - 226: {region: 0x106, script: 0x20, flags: 0x0}, - 227: {region: 0x135, script: 0x5a, flags: 0x0}, - 228: {region: 0x49, script: 0x5a, flags: 0x0}, - 229: {region: 0x135, script: 0x1a, flags: 0x0}, - 230: {region: 0xa6, script: 0x5, flags: 0x0}, - 231: {region: 0x13e, script: 0x19, flags: 0x0}, - 232: {region: 0x165, script: 0x5a, flags: 0x0}, - 233: {region: 0x9b, script: 0x5, flags: 0x0}, - 234: {region: 0x165, script: 0x5a, flags: 0x0}, - 235: {region: 0x165, script: 0x5a, flags: 0x0}, - 236: {region: 0x165, script: 0x5a, flags: 0x0}, - 237: {region: 0x165, script: 0x5a, flags: 0x0}, - 238: {region: 0x165, script: 0x5a, flags: 0x0}, - 239: {region: 0xc5, script: 0xd3, flags: 0x0}, - 240: {region: 0x78, script: 0x5a, flags: 0x0}, - 241: {region: 0x6b, script: 0x1d, flags: 0x0}, - 242: {region: 0xe7, script: 0x5a, flags: 0x0}, + 220: {region: 0x107, script: 0x20, flags: 0x0}, + 221: {region: 0xe8, script: 0x5b, flags: 0x0}, + 222: {region: 0x166, script: 0x5b, flags: 0x0}, + 223: {region: 0x132, script: 0x5b, flags: 0x0}, + 224: {region: 0x8b, script: 0x5b, flags: 0x0}, + 225: {region: 0x76, script: 0x5b, flags: 0x0}, + 226: {region: 0x107, script: 0x20, flags: 0x0}, + 227: {region: 0x136, script: 0x5b, flags: 0x0}, + 228: {region: 0x49, script: 0x5b, flags: 0x0}, + 229: {region: 0x136, script: 0x1a, flags: 0x0}, + 230: {region: 0xa7, script: 0x5, flags: 0x0}, + 231: {region: 0x13f, script: 0x19, flags: 0x0}, + 232: {region: 0x166, script: 0x5b, flags: 0x0}, + 233: {region: 0x9c, script: 0x5, flags: 0x0}, + 234: {region: 0x166, script: 0x5b, flags: 0x0}, + 235: {region: 0x166, script: 0x5b, flags: 0x0}, + 236: {region: 0x166, script: 0x5b, flags: 0x0}, + 237: {region: 0x166, script: 0x5b, flags: 0x0}, + 238: {region: 0x166, script: 0x5b, flags: 0x0}, + 239: {region: 0xc6, script: 0xda, flags: 0x0}, + 240: {region: 0x79, script: 0x5b, flags: 0x0}, + 241: {region: 0x6c, script: 0x1d, flags: 0x0}, + 242: {region: 0xe8, script: 0x5b, flags: 0x0}, 243: {region: 0x49, script: 0x17, flags: 0x0}, - 244: {region: 0x130, script: 0x20, flags: 0x0}, + 244: {region: 0x131, script: 0x20, flags: 0x0}, 245: {region: 0x49, script: 0x17, flags: 0x0}, 246: {region: 0x49, script: 0x17, flags: 0x0}, 247: {region: 0x49, script: 0x17, flags: 0x0}, 248: {region: 0x49, script: 0x17, flags: 0x0}, - 249: {region: 0x10a, script: 0x5a, flags: 0x0}, - 250: {region: 0x5e, script: 0x5a, flags: 0x0}, - 251: {region: 0xe9, script: 0x5a, flags: 0x0}, + 249: {region: 0x10b, script: 0x5b, flags: 0x0}, + 250: {region: 0x5f, script: 0x5b, flags: 0x0}, + 251: {region: 0xea, script: 0x5b, flags: 0x0}, 252: {region: 0x49, script: 0x17, flags: 0x0}, - 253: {region: 0xc4, script: 0x85, flags: 0x0}, + 253: {region: 0xc5, script: 0x88, flags: 0x0}, 254: {region: 0x8, script: 0x2, flags: 0x1}, - 255: {region: 0x106, script: 0x20, flags: 0x0}, - 256: {region: 0x7b, script: 0x5a, flags: 0x0}, - 257: {region: 0x63, script: 0x5a, flags: 0x0}, - 258: {region: 0x165, script: 0x5a, flags: 0x0}, - 259: {region: 0x165, script: 0x5a, flags: 0x0}, - 260: {region: 0x165, script: 0x5a, flags: 0x0}, - 261: {region: 0x165, script: 0x5a, flags: 0x0}, - 262: {region: 0x135, script: 0x5a, flags: 0x0}, - 263: {region: 0x106, script: 0x20, flags: 0x0}, - 264: {region: 0xa4, script: 0x5a, flags: 0x0}, - 265: {region: 0x165, script: 0x5a, flags: 0x0}, - 266: {region: 0x165, script: 0x5a, flags: 0x0}, - 267: {region: 0x99, script: 0x5, flags: 0x0}, - 268: {region: 0x165, script: 0x5a, flags: 0x0}, - 269: {region: 0x60, script: 0x5a, flags: 0x0}, - 270: {region: 0x165, script: 0x5a, flags: 0x0}, - 271: {region: 0x49, script: 0x5a, flags: 0x0}, - 272: {region: 0x165, script: 0x5a, flags: 0x0}, - 273: {region: 0x165, script: 0x5a, flags: 0x0}, - 274: {region: 0x165, script: 0x5a, flags: 0x0}, - 275: {region: 0x165, script: 0x5, flags: 0x0}, - 276: {region: 0x49, script: 0x5a, flags: 0x0}, - 277: {region: 0x165, script: 0x5a, flags: 0x0}, - 278: {region: 0x165, script: 0x5a, flags: 0x0}, - 279: {region: 0xd4, script: 0x5a, flags: 0x0}, - 280: {region: 0x4f, script: 0x5a, flags: 0x0}, - 281: {region: 0x165, script: 0x5a, flags: 0x0}, - 282: {region: 0x99, script: 0x5, flags: 0x0}, - 283: {region: 0x165, script: 0x5a, flags: 0x0}, - 284: {region: 0x165, script: 0x5a, flags: 0x0}, - 285: {region: 0x165, script: 0x5a, flags: 0x0}, - 286: {region: 0x165, script: 0x2c, flags: 0x0}, - 287: {region: 0x60, script: 0x5a, flags: 0x0}, - 288: {region: 0xc3, script: 0x5a, flags: 0x0}, - 289: {region: 0xd0, script: 0x5a, flags: 0x0}, - 290: {region: 0x165, script: 0x5a, flags: 0x0}, - 291: {region: 0xdb, script: 0x22, flags: 0x0}, - 292: {region: 0x52, script: 0x5a, flags: 0x0}, - 293: {region: 0x165, script: 0x5a, flags: 0x0}, - 294: {region: 0x165, script: 0x5a, flags: 0x0}, - 295: {region: 0x165, script: 0x5a, flags: 0x0}, - 296: {region: 0xcd, script: 0xe5, flags: 0x0}, - 297: {region: 0x165, script: 0x5a, flags: 0x0}, - 298: {region: 0x165, script: 0x5a, flags: 0x0}, - 299: {region: 0x114, script: 0x5a, flags: 0x0}, - 300: {region: 0x37, script: 0x5a, flags: 0x0}, - 301: {region: 0x43, script: 0xe7, flags: 0x0}, - 302: {region: 0x165, script: 0x5a, flags: 0x0}, - 303: {region: 0xa4, script: 0x5a, flags: 0x0}, - 304: {region: 0x80, script: 0x5a, flags: 0x0}, - 305: {region: 0xd6, script: 0x5a, flags: 0x0}, - 306: {region: 0x9e, script: 0x5a, flags: 0x0}, - 307: {region: 0x6b, script: 0x29, flags: 0x0}, - 308: {region: 0x165, script: 0x5a, flags: 0x0}, - 309: {region: 0xc4, script: 0x4b, flags: 0x0}, - 310: {region: 0x87, script: 0x34, flags: 0x0}, - 311: {region: 0x165, script: 0x5a, flags: 0x0}, - 312: {region: 0x165, script: 0x5a, flags: 0x0}, + 255: {region: 0x107, script: 0x20, flags: 0x0}, + 256: {region: 0x7c, script: 0x5b, flags: 0x0}, + 257: {region: 0x64, script: 0x5b, flags: 0x0}, + 258: {region: 0x166, script: 0x5b, flags: 0x0}, + 259: {region: 0x166, script: 0x5b, flags: 0x0}, + 260: {region: 0x166, script: 0x5b, flags: 0x0}, + 261: {region: 0x166, script: 0x5b, flags: 0x0}, + 262: {region: 0x136, script: 0x5b, flags: 0x0}, + 263: {region: 0x107, script: 0x20, flags: 0x0}, + 264: {region: 0xa5, script: 0x5b, flags: 0x0}, + 265: {region: 0x166, script: 0x5b, flags: 0x0}, + 266: {region: 0x166, script: 0x5b, flags: 0x0}, + 267: {region: 0x9a, script: 0x5, flags: 0x0}, + 268: {region: 0x166, script: 0x5b, flags: 0x0}, + 269: {region: 0x61, script: 0x5b, flags: 0x0}, + 270: {region: 0x166, script: 0x5b, flags: 0x0}, + 271: {region: 0x49, script: 0x5b, flags: 0x0}, + 272: {region: 0x166, script: 0x5b, flags: 0x0}, + 273: {region: 0x166, script: 0x5b, flags: 0x0}, + 274: {region: 0x166, script: 0x5b, flags: 0x0}, + 275: {region: 0x166, script: 0x5, flags: 0x0}, + 276: {region: 0x49, script: 0x5b, flags: 0x0}, + 277: {region: 0x166, script: 0x5b, flags: 0x0}, + 278: {region: 0x166, script: 0x5b, flags: 0x0}, + 279: {region: 0xd5, script: 0x5b, flags: 0x0}, + 280: {region: 0x4f, script: 0x5b, flags: 0x0}, + 281: {region: 0x166, script: 0x5b, flags: 0x0}, + 282: {region: 0x9a, script: 0x5, flags: 0x0}, + 283: {region: 0x166, script: 0x5b, flags: 0x0}, + 284: {region: 0x166, script: 0x5b, flags: 0x0}, + 285: {region: 0x166, script: 0x5b, flags: 0x0}, + 286: {region: 0x166, script: 0x2c, flags: 0x0}, + 287: {region: 0x61, script: 0x5b, flags: 0x0}, + 288: {region: 0xc4, script: 0x5b, flags: 0x0}, + 289: {region: 0xd1, script: 0x5b, flags: 0x0}, + 290: {region: 0x166, script: 0x5b, flags: 0x0}, + 291: {region: 0xdc, script: 0x22, flags: 0x0}, + 292: {region: 0x52, script: 0x5b, flags: 0x0}, + 293: {region: 0x166, script: 0x5b, flags: 0x0}, + 294: {region: 0x166, script: 0x5b, flags: 0x0}, + 295: {region: 0x166, script: 0x5b, flags: 0x0}, + 296: {region: 0xce, script: 0xed, flags: 0x0}, + 297: {region: 0x166, script: 0x5b, flags: 0x0}, + 298: {region: 0x166, script: 0x5b, flags: 0x0}, + 299: {region: 0x115, script: 0x5b, flags: 0x0}, + 300: {region: 0x37, script: 0x5b, flags: 0x0}, + 301: {region: 0x43, script: 0xef, flags: 0x0}, + 302: {region: 0x166, script: 0x5b, flags: 0x0}, + 303: {region: 0xa5, script: 0x5b, flags: 0x0}, + 304: {region: 0x81, script: 0x5b, flags: 0x0}, + 305: {region: 0xd7, script: 0x5b, flags: 0x0}, + 306: {region: 0x9f, script: 0x5b, flags: 0x0}, + 307: {region: 0x6c, script: 0x29, flags: 0x0}, + 308: {region: 0x166, script: 0x5b, flags: 0x0}, + 309: {region: 0xc5, script: 0x4b, flags: 0x0}, + 310: {region: 0x88, script: 0x34, flags: 0x0}, + 311: {region: 0x166, script: 0x5b, flags: 0x0}, + 312: {region: 0x166, script: 0x5b, flags: 0x0}, 313: {region: 0xa, script: 0x2, flags: 0x1}, - 314: {region: 0x165, script: 0x5a, flags: 0x0}, - 315: {region: 0x165, script: 0x5a, flags: 0x0}, - 316: {region: 0x1, script: 0x5a, flags: 0x0}, - 317: {region: 0x165, script: 0x5a, flags: 0x0}, - 318: {region: 0x6e, script: 0x5a, flags: 0x0}, - 319: {region: 0x135, script: 0x5a, flags: 0x0}, - 320: {region: 0x6a, script: 0x5a, flags: 0x0}, - 321: {region: 0x165, script: 0x5a, flags: 0x0}, - 322: {region: 0x9e, script: 0x46, flags: 0x0}, - 323: {region: 0x165, script: 0x5a, flags: 0x0}, - 324: {region: 0x165, script: 0x5a, flags: 0x0}, - 325: {region: 0x6e, script: 0x5a, flags: 0x0}, - 326: {region: 0x52, script: 0x5a, flags: 0x0}, - 327: {region: 0x6e, script: 0x5a, flags: 0x0}, - 328: {region: 0x9c, script: 0x5, flags: 0x0}, - 329: {region: 0x165, script: 0x5a, flags: 0x0}, - 330: {region: 0x165, script: 0x5a, flags: 0x0}, - 331: {region: 0x165, script: 0x5a, flags: 0x0}, - 332: {region: 0x165, script: 0x5a, flags: 0x0}, - 333: {region: 0x86, script: 0x5a, flags: 0x0}, + 314: {region: 0x166, script: 0x5b, flags: 0x0}, + 315: {region: 0x166, script: 0x5b, flags: 0x0}, + 316: {region: 0x1, script: 0x5b, flags: 0x0}, + 317: {region: 0x166, script: 0x5b, flags: 0x0}, + 318: {region: 0x6f, script: 0x5b, flags: 0x0}, + 319: {region: 0x136, script: 0x5b, flags: 0x0}, + 320: {region: 0x6b, script: 0x5b, flags: 0x0}, + 321: {region: 0x166, script: 0x5b, flags: 0x0}, + 322: {region: 0x9f, script: 0x46, flags: 0x0}, + 323: {region: 0x166, script: 0x5b, flags: 0x0}, + 324: {region: 0x166, script: 0x5b, flags: 0x0}, + 325: {region: 0x6f, script: 0x5b, flags: 0x0}, + 326: {region: 0x52, script: 0x5b, flags: 0x0}, + 327: {region: 0x6f, script: 0x5b, flags: 0x0}, + 328: {region: 0x9d, script: 0x5, flags: 0x0}, + 329: {region: 0x166, script: 0x5b, flags: 0x0}, + 330: {region: 0x166, script: 0x5b, flags: 0x0}, + 331: {region: 0x166, script: 0x5b, flags: 0x0}, + 332: {region: 0x166, script: 0x5b, flags: 0x0}, + 333: {region: 0x87, script: 0x5b, flags: 0x0}, 334: {region: 0xc, script: 0x2, flags: 0x1}, - 335: {region: 0x165, script: 0x5a, flags: 0x0}, - 336: {region: 0xc3, script: 0x5a, flags: 0x0}, - 337: {region: 0x72, script: 0x5a, flags: 0x0}, - 338: {region: 0x10b, script: 0x5, flags: 0x0}, - 339: {region: 0xe7, script: 0x5a, flags: 0x0}, - 340: {region: 0x10c, script: 0x5a, flags: 0x0}, - 341: {region: 0x73, script: 0x5a, flags: 0x0}, - 342: {region: 0x165, script: 0x5a, flags: 0x0}, - 343: {region: 0x165, script: 0x5a, flags: 0x0}, - 344: {region: 0x76, script: 0x5a, flags: 0x0}, - 345: {region: 0x165, script: 0x5a, flags: 0x0}, - 346: {region: 0x3b, script: 0x5a, flags: 0x0}, - 347: {region: 0x165, script: 0x5a, flags: 0x0}, - 348: {region: 0x165, script: 0x5a, flags: 0x0}, - 349: {region: 0x165, script: 0x5a, flags: 0x0}, - 350: {region: 0x78, script: 0x5a, flags: 0x0}, - 351: {region: 0x135, script: 0x5a, flags: 0x0}, - 352: {region: 0x78, script: 0x5a, flags: 0x0}, - 353: {region: 0x60, script: 0x5a, flags: 0x0}, - 354: {region: 0x60, script: 0x5a, flags: 0x0}, + 335: {region: 0x166, script: 0x5b, flags: 0x0}, + 336: {region: 0xc4, script: 0x5b, flags: 0x0}, + 337: {region: 0x73, script: 0x5b, flags: 0x0}, + 338: {region: 0x10c, script: 0x5, flags: 0x0}, + 339: {region: 0xe8, script: 0x5b, flags: 0x0}, + 340: {region: 0x10d, script: 0x5b, flags: 0x0}, + 341: {region: 0x74, script: 0x5b, flags: 0x0}, + 342: {region: 0x166, script: 0x5b, flags: 0x0}, + 343: {region: 0x166, script: 0x5b, flags: 0x0}, + 344: {region: 0x77, script: 0x5b, flags: 0x0}, + 345: {region: 0x166, script: 0x5b, flags: 0x0}, + 346: {region: 0x3b, script: 0x5b, flags: 0x0}, + 347: {region: 0x166, script: 0x5b, flags: 0x0}, + 348: {region: 0x166, script: 0x5b, flags: 0x0}, + 349: {region: 0x166, script: 0x5b, flags: 0x0}, + 350: {region: 0x79, script: 0x5b, flags: 0x0}, + 351: {region: 0x136, script: 0x5b, flags: 0x0}, + 352: {region: 0x79, script: 0x5b, flags: 0x0}, + 353: {region: 0x61, script: 0x5b, flags: 0x0}, + 354: {region: 0x61, script: 0x5b, flags: 0x0}, 355: {region: 0x52, script: 0x5, flags: 0x0}, - 356: {region: 0x140, script: 0x5a, flags: 0x0}, - 357: {region: 0x165, script: 0x5a, flags: 0x0}, - 358: {region: 0x84, script: 0x5a, flags: 0x0}, - 359: {region: 0x165, script: 0x5a, flags: 0x0}, - 360: {region: 0xd4, script: 0x5a, flags: 0x0}, - 361: {region: 0x9e, script: 0x5a, flags: 0x0}, - 362: {region: 0xd6, script: 0x5a, flags: 0x0}, - 363: {region: 0x165, script: 0x5a, flags: 0x0}, - 364: {region: 0x10b, script: 0x5a, flags: 0x0}, - 365: {region: 0xd9, script: 0x5a, flags: 0x0}, - 366: {region: 0x96, script: 0x5a, flags: 0x0}, - 367: {region: 0x80, script: 0x5a, flags: 0x0}, - 368: {region: 0x165, script: 0x5a, flags: 0x0}, - 369: {region: 0xbc, script: 0x5a, flags: 0x0}, - 370: {region: 0x165, script: 0x5a, flags: 0x0}, - 371: {region: 0x165, script: 0x5a, flags: 0x0}, - 372: {region: 0x165, script: 0x5a, flags: 0x0}, + 356: {region: 0x141, script: 0x5b, flags: 0x0}, + 357: {region: 0x166, script: 0x5b, flags: 0x0}, + 358: {region: 0x85, script: 0x5b, flags: 0x0}, + 359: {region: 0x166, script: 0x5b, flags: 0x0}, + 360: {region: 0xd5, script: 0x5b, flags: 0x0}, + 361: {region: 0x9f, script: 0x5b, flags: 0x0}, + 362: {region: 0xd7, script: 0x5b, flags: 0x0}, + 363: {region: 0x166, script: 0x5b, flags: 0x0}, + 364: {region: 0x10c, script: 0x5b, flags: 0x0}, + 365: {region: 0xda, script: 0x5b, flags: 0x0}, + 366: {region: 0x97, script: 0x5b, flags: 0x0}, + 367: {region: 0x81, script: 0x5b, flags: 0x0}, + 368: {region: 0x166, script: 0x5b, flags: 0x0}, + 369: {region: 0xbd, script: 0x5b, flags: 0x0}, + 370: {region: 0x166, script: 0x5b, flags: 0x0}, + 371: {region: 0x166, script: 0x5b, flags: 0x0}, + 372: {region: 0x166, script: 0x5b, flags: 0x0}, 373: {region: 0x53, script: 0x3b, flags: 0x0}, - 374: {region: 0x165, script: 0x5a, flags: 0x0}, - 375: {region: 0x95, script: 0x5a, flags: 0x0}, - 376: {region: 0x165, script: 0x5a, flags: 0x0}, - 377: {region: 0x165, script: 0x5a, flags: 0x0}, - 378: {region: 0x99, script: 0x22, flags: 0x0}, - 379: {region: 0x165, script: 0x5a, flags: 0x0}, - 380: {region: 0x9c, script: 0x5, flags: 0x0}, - 381: {region: 0x7e, script: 0x5a, flags: 0x0}, - 382: {region: 0x7b, script: 0x5a, flags: 0x0}, - 383: {region: 0x165, script: 0x5a, flags: 0x0}, - 384: {region: 0x165, script: 0x5a, flags: 0x0}, - 385: {region: 0x165, script: 0x5a, flags: 0x0}, - 386: {region: 0x165, script: 0x5a, flags: 0x0}, - 387: {region: 0x165, script: 0x5a, flags: 0x0}, - 388: {region: 0x165, script: 0x5a, flags: 0x0}, - 389: {region: 0x6f, script: 0x2c, flags: 0x0}, - 390: {region: 0x165, script: 0x5a, flags: 0x0}, - 391: {region: 0xdb, script: 0x22, flags: 0x0}, - 392: {region: 0x165, script: 0x5a, flags: 0x0}, - 393: {region: 0xa7, script: 0x5a, flags: 0x0}, - 394: {region: 0x165, script: 0x5a, flags: 0x0}, - 395: {region: 0xe8, script: 0x5, flags: 0x0}, - 396: {region: 0x165, script: 0x5a, flags: 0x0}, - 397: {region: 0xe8, script: 0x5, flags: 0x0}, - 398: {region: 0x165, script: 0x5a, flags: 0x0}, - 399: {region: 0x165, script: 0x5a, flags: 0x0}, - 400: {region: 0x6e, script: 0x5a, flags: 0x0}, - 401: {region: 0x9c, script: 0x5, flags: 0x0}, - 402: {region: 0x165, script: 0x5a, flags: 0x0}, - 403: {region: 0x165, script: 0x2c, flags: 0x0}, - 404: {region: 0xf1, script: 0x5a, flags: 0x0}, - 405: {region: 0x165, script: 0x5a, flags: 0x0}, - 406: {region: 0x165, script: 0x5a, flags: 0x0}, - 407: {region: 0x165, script: 0x5a, flags: 0x0}, - 408: {region: 0x165, script: 0x2c, flags: 0x0}, - 409: {region: 0x165, script: 0x5a, flags: 0x0}, - 410: {region: 0x99, script: 0x22, flags: 0x0}, - 411: {region: 0x99, script: 0xe1, flags: 0x0}, - 412: {region: 0x95, script: 0x5a, flags: 0x0}, - 413: {region: 0xd9, script: 0x5a, flags: 0x0}, - 414: {region: 0x130, script: 0x32, flags: 0x0}, - 415: {region: 0x165, script: 0x5a, flags: 0x0}, + 374: {region: 0x166, script: 0x5b, flags: 0x0}, + 375: {region: 0x96, script: 0x5b, flags: 0x0}, + 376: {region: 0x166, script: 0x5b, flags: 0x0}, + 377: {region: 0x166, script: 0x5b, flags: 0x0}, + 378: {region: 0x9a, script: 0x22, flags: 0x0}, + 379: {region: 0x166, script: 0x5b, flags: 0x0}, + 380: {region: 0x9d, script: 0x5, flags: 0x0}, + 381: {region: 0x7f, script: 0x5b, flags: 0x0}, + 382: {region: 0x7c, script: 0x5b, flags: 0x0}, + 383: {region: 0x166, script: 0x5b, flags: 0x0}, + 384: {region: 0x166, script: 0x5b, flags: 0x0}, + 385: {region: 0x166, script: 0x5b, flags: 0x0}, + 386: {region: 0x166, script: 0x5b, flags: 0x0}, + 387: {region: 0x166, script: 0x5b, flags: 0x0}, + 388: {region: 0x166, script: 0x5b, flags: 0x0}, + 389: {region: 0x70, script: 0x2c, flags: 0x0}, + 390: {region: 0x166, script: 0x5b, flags: 0x0}, + 391: {region: 0xdc, script: 0x22, flags: 0x0}, + 392: {region: 0x166, script: 0x5b, flags: 0x0}, + 393: {region: 0xa8, script: 0x5b, flags: 0x0}, + 394: {region: 0x166, script: 0x5b, flags: 0x0}, + 395: {region: 0xe9, script: 0x5, flags: 0x0}, + 396: {region: 0x166, script: 0x5b, flags: 0x0}, + 397: {region: 0xe9, script: 0x5, flags: 0x0}, + 398: {region: 0x166, script: 0x5b, flags: 0x0}, + 399: {region: 0x166, script: 0x5b, flags: 0x0}, + 400: {region: 0x6f, script: 0x5b, flags: 0x0}, + 401: {region: 0x9d, script: 0x5, flags: 0x0}, + 402: {region: 0x166, script: 0x5b, flags: 0x0}, + 403: {region: 0x166, script: 0x2c, flags: 0x0}, + 404: {region: 0xf2, script: 0x5b, flags: 0x0}, + 405: {region: 0x166, script: 0x5b, flags: 0x0}, + 406: {region: 0x166, script: 0x5b, flags: 0x0}, + 407: {region: 0x166, script: 0x5b, flags: 0x0}, + 408: {region: 0x166, script: 0x2c, flags: 0x0}, + 409: {region: 0x166, script: 0x5b, flags: 0x0}, + 410: {region: 0x9a, script: 0x22, flags: 0x0}, + 411: {region: 0x9a, script: 0xe9, flags: 0x0}, + 412: {region: 0x96, script: 0x5b, flags: 0x0}, + 413: {region: 0xda, script: 0x5b, flags: 0x0}, + 414: {region: 0x131, script: 0x32, flags: 0x0}, + 415: {region: 0x166, script: 0x5b, flags: 0x0}, 416: {region: 0xe, script: 0x2, flags: 0x1}, - 417: {region: 0x99, script: 0xe, flags: 0x0}, - 418: {region: 0x165, script: 0x5a, flags: 0x0}, - 419: {region: 0x4e, script: 0x5a, flags: 0x0}, - 420: {region: 0x99, script: 0x35, flags: 0x0}, - 421: {region: 0x41, script: 0x5a, flags: 0x0}, - 422: {region: 0x54, script: 0x5a, flags: 0x0}, - 423: {region: 0x165, script: 0x5a, flags: 0x0}, - 424: {region: 0x80, script: 0x5a, flags: 0x0}, - 425: {region: 0x165, script: 0x5a, flags: 0x0}, - 426: {region: 0x165, script: 0x5a, flags: 0x0}, - 427: {region: 0xa4, script: 0x5a, flags: 0x0}, - 428: {region: 0x98, script: 0x5a, flags: 0x0}, - 429: {region: 0x165, script: 0x5a, flags: 0x0}, - 430: {region: 0xdb, script: 0x22, flags: 0x0}, - 431: {region: 0x165, script: 0x5a, flags: 0x0}, - 432: {region: 0x165, script: 0x5, flags: 0x0}, - 433: {region: 0x49, script: 0x5a, flags: 0x0}, - 434: {region: 0x165, script: 0x5, flags: 0x0}, - 435: {region: 0x165, script: 0x5a, flags: 0x0}, + 417: {region: 0x9a, script: 0xe, flags: 0x0}, + 418: {region: 0x166, script: 0x5b, flags: 0x0}, + 419: {region: 0x4e, script: 0x5b, flags: 0x0}, + 420: {region: 0x9a, script: 0x35, flags: 0x0}, + 421: {region: 0x41, script: 0x5b, flags: 0x0}, + 422: {region: 0x54, script: 0x5b, flags: 0x0}, + 423: {region: 0x166, script: 0x5b, flags: 0x0}, + 424: {region: 0x81, script: 0x5b, flags: 0x0}, + 425: {region: 0x166, script: 0x5b, flags: 0x0}, + 426: {region: 0x166, script: 0x5b, flags: 0x0}, + 427: {region: 0xa5, script: 0x5b, flags: 0x0}, + 428: {region: 0x99, script: 0x5b, flags: 0x0}, + 429: {region: 0x166, script: 0x5b, flags: 0x0}, + 430: {region: 0xdc, script: 0x22, flags: 0x0}, + 431: {region: 0x166, script: 0x5b, flags: 0x0}, + 432: {region: 0x166, script: 0x5, flags: 0x0}, + 433: {region: 0x49, script: 0x5b, flags: 0x0}, + 434: {region: 0x166, script: 0x5, flags: 0x0}, + 435: {region: 0x166, script: 0x5b, flags: 0x0}, 436: {region: 0x10, script: 0x3, flags: 0x1}, - 437: {region: 0x165, script: 0x5a, flags: 0x0}, + 437: {region: 0x166, script: 0x5b, flags: 0x0}, 438: {region: 0x53, script: 0x3b, flags: 0x0}, - 439: {region: 0x165, script: 0x5a, flags: 0x0}, - 440: {region: 0x135, script: 0x5a, flags: 0x0}, + 439: {region: 0x166, script: 0x5b, flags: 0x0}, + 440: {region: 0x136, script: 0x5b, flags: 0x0}, 441: {region: 0x24, script: 0x5, flags: 0x0}, - 442: {region: 0x165, script: 0x5a, flags: 0x0}, - 443: {region: 0x165, script: 0x2c, flags: 0x0}, - 444: {region: 0x97, script: 0x3e, flags: 0x0}, - 445: {region: 0x165, script: 0x5a, flags: 0x0}, - 446: {region: 0x99, script: 0x22, flags: 0x0}, - 447: {region: 0x165, script: 0x5a, flags: 0x0}, - 448: {region: 0x73, script: 0x5a, flags: 0x0}, - 449: {region: 0x165, script: 0x5a, flags: 0x0}, - 450: {region: 0x165, script: 0x5a, flags: 0x0}, - 451: {region: 0xe7, script: 0x5a, flags: 0x0}, - 452: {region: 0x165, script: 0x5a, flags: 0x0}, - 453: {region: 0x12b, script: 0x40, flags: 0x0}, - 454: {region: 0x53, script: 0x8d, flags: 0x0}, - 455: {region: 0x165, script: 0x5a, flags: 0x0}, - 456: {region: 0xe8, script: 0x5, flags: 0x0}, - 457: {region: 0x99, script: 0x22, flags: 0x0}, - 458: {region: 0xaf, script: 0x41, flags: 0x0}, - 459: {region: 0xe7, script: 0x5a, flags: 0x0}, - 460: {region: 0xe8, script: 0x5, flags: 0x0}, - 461: {region: 0xe6, script: 0x5a, flags: 0x0}, - 462: {region: 0x99, script: 0x22, flags: 0x0}, - 463: {region: 0x99, script: 0x22, flags: 0x0}, - 464: {region: 0x165, script: 0x5a, flags: 0x0}, - 465: {region: 0x90, script: 0x5a, flags: 0x0}, - 466: {region: 0x60, script: 0x5a, flags: 0x0}, + 442: {region: 0x166, script: 0x5b, flags: 0x0}, + 443: {region: 0x166, script: 0x2c, flags: 0x0}, + 444: {region: 0x98, script: 0x3e, flags: 0x0}, + 445: {region: 0x166, script: 0x5b, flags: 0x0}, + 446: {region: 0x9a, script: 0x22, flags: 0x0}, + 447: {region: 0x166, script: 0x5b, flags: 0x0}, + 448: {region: 0x74, script: 0x5b, flags: 0x0}, + 449: {region: 0x166, script: 0x5b, flags: 0x0}, + 450: {region: 0x166, script: 0x5b, flags: 0x0}, + 451: {region: 0xe8, script: 0x5b, flags: 0x0}, + 452: {region: 0x166, script: 0x5b, flags: 0x0}, + 453: {region: 0x12c, script: 0x40, flags: 0x0}, + 454: {region: 0x53, script: 0x92, flags: 0x0}, + 455: {region: 0x166, script: 0x5b, flags: 0x0}, + 456: {region: 0xe9, script: 0x5, flags: 0x0}, + 457: {region: 0x9a, script: 0x22, flags: 0x0}, + 458: {region: 0xb0, script: 0x41, flags: 0x0}, + 459: {region: 0xe8, script: 0x5b, flags: 0x0}, + 460: {region: 0xe9, script: 0x5, flags: 0x0}, + 461: {region: 0xe7, script: 0x5b, flags: 0x0}, + 462: {region: 0x9a, script: 0x22, flags: 0x0}, + 463: {region: 0x9a, script: 0x22, flags: 0x0}, + 464: {region: 0x166, script: 0x5b, flags: 0x0}, + 465: {region: 0x91, script: 0x5b, flags: 0x0}, + 466: {region: 0x61, script: 0x5b, flags: 0x0}, 467: {region: 0x53, script: 0x3b, flags: 0x0}, - 468: {region: 0x91, script: 0x5a, flags: 0x0}, - 469: {region: 0x92, script: 0x5a, flags: 0x0}, - 470: {region: 0x165, script: 0x5a, flags: 0x0}, + 468: {region: 0x92, script: 0x5b, flags: 0x0}, + 469: {region: 0x93, script: 0x5b, flags: 0x0}, + 470: {region: 0x166, script: 0x5b, flags: 0x0}, 471: {region: 0x28, script: 0x8, flags: 0x0}, - 472: {region: 0xd2, script: 0x5a, flags: 0x0}, - 473: {region: 0x78, script: 0x5a, flags: 0x0}, - 474: {region: 0x165, script: 0x5a, flags: 0x0}, - 475: {region: 0x165, script: 0x5a, flags: 0x0}, - 476: {region: 0xd0, script: 0x5a, flags: 0x0}, - 477: {region: 0xd6, script: 0x5a, flags: 0x0}, - 478: {region: 0x165, script: 0x5a, flags: 0x0}, - 479: {region: 0x165, script: 0x5a, flags: 0x0}, - 480: {region: 0x165, script: 0x5a, flags: 0x0}, - 481: {region: 0x95, script: 0x5a, flags: 0x0}, - 482: {region: 0x165, script: 0x5a, flags: 0x0}, - 483: {region: 0x165, script: 0x5a, flags: 0x0}, - 484: {region: 0x165, script: 0x5a, flags: 0x0}, - 486: {region: 0x122, script: 0x5a, flags: 0x0}, - 487: {region: 0xd6, script: 0x5a, flags: 0x0}, - 488: {region: 0x165, script: 0x5a, flags: 0x0}, - 489: {region: 0x165, script: 0x5a, flags: 0x0}, - 490: {region: 0x53, script: 0xf3, flags: 0x0}, - 491: {region: 0x165, script: 0x5a, flags: 0x0}, - 492: {region: 0x135, script: 0x5a, flags: 0x0}, - 493: {region: 0x165, script: 0x5a, flags: 0x0}, - 494: {region: 0x49, script: 0x5a, flags: 0x0}, - 495: {region: 0x165, script: 0x5a, flags: 0x0}, - 496: {region: 0x165, script: 0x5a, flags: 0x0}, - 497: {region: 0xe7, script: 0x5a, flags: 0x0}, - 498: {region: 0x165, script: 0x5a, flags: 0x0}, - 499: {region: 0x95, script: 0x5a, flags: 0x0}, - 500: {region: 0x106, script: 0x20, flags: 0x0}, - 501: {region: 0x1, script: 0x5a, flags: 0x0}, - 502: {region: 0x165, script: 0x5a, flags: 0x0}, - 503: {region: 0x165, script: 0x5a, flags: 0x0}, - 504: {region: 0x9d, script: 0x5a, flags: 0x0}, - 505: {region: 0x9e, script: 0x5a, flags: 0x0}, + 472: {region: 0xd3, script: 0x5b, flags: 0x0}, + 473: {region: 0x79, script: 0x5b, flags: 0x0}, + 474: {region: 0x166, script: 0x5b, flags: 0x0}, + 475: {region: 0x166, script: 0x5b, flags: 0x0}, + 476: {region: 0xd1, script: 0x5b, flags: 0x0}, + 477: {region: 0xd7, script: 0x5b, flags: 0x0}, + 478: {region: 0x166, script: 0x5b, flags: 0x0}, + 479: {region: 0x166, script: 0x5b, flags: 0x0}, + 480: {region: 0x166, script: 0x5b, flags: 0x0}, + 481: {region: 0x96, script: 0x5b, flags: 0x0}, + 482: {region: 0x166, script: 0x5b, flags: 0x0}, + 483: {region: 0x166, script: 0x5b, flags: 0x0}, + 484: {region: 0x166, script: 0x5b, flags: 0x0}, + 486: {region: 0x123, script: 0x5b, flags: 0x0}, + 487: {region: 0xd7, script: 0x5b, flags: 0x0}, + 488: {region: 0x166, script: 0x5b, flags: 0x0}, + 489: {region: 0x166, script: 0x5b, flags: 0x0}, + 490: {region: 0x53, script: 0xfd, flags: 0x0}, + 491: {region: 0x166, script: 0x5b, flags: 0x0}, + 492: {region: 0x136, script: 0x5b, flags: 0x0}, + 493: {region: 0x166, script: 0x5b, flags: 0x0}, + 494: {region: 0x49, script: 0x5b, flags: 0x0}, + 495: {region: 0x166, script: 0x5b, flags: 0x0}, + 496: {region: 0x166, script: 0x5b, flags: 0x0}, + 497: {region: 0xe8, script: 0x5b, flags: 0x0}, + 498: {region: 0x166, script: 0x5b, flags: 0x0}, + 499: {region: 0x96, script: 0x5b, flags: 0x0}, + 500: {region: 0x107, script: 0x20, flags: 0x0}, + 501: {region: 0x1, script: 0x5b, flags: 0x0}, + 502: {region: 0x166, script: 0x5b, flags: 0x0}, + 503: {region: 0x166, script: 0x5b, flags: 0x0}, + 504: {region: 0x9e, script: 0x5b, flags: 0x0}, + 505: {region: 0x9f, script: 0x5b, flags: 0x0}, 506: {region: 0x49, script: 0x17, flags: 0x0}, - 507: {region: 0x97, script: 0x3e, flags: 0x0}, - 508: {region: 0x165, script: 0x5a, flags: 0x0}, - 509: {region: 0x165, script: 0x5a, flags: 0x0}, - 510: {region: 0x106, script: 0x5a, flags: 0x0}, - 511: {region: 0x165, script: 0x5a, flags: 0x0}, - 512: {region: 0xa2, script: 0x49, flags: 0x0}, - 513: {region: 0x165, script: 0x5a, flags: 0x0}, - 514: {region: 0xa0, script: 0x5a, flags: 0x0}, - 515: {region: 0x1, script: 0x5a, flags: 0x0}, - 516: {region: 0x165, script: 0x5a, flags: 0x0}, - 517: {region: 0x165, script: 0x5a, flags: 0x0}, - 518: {region: 0x165, script: 0x5a, flags: 0x0}, - 519: {region: 0x52, script: 0x5a, flags: 0x0}, - 520: {region: 0x130, script: 0x3e, flags: 0x0}, - 521: {region: 0x165, script: 0x5a, flags: 0x0}, - 522: {region: 0x12f, script: 0x5a, flags: 0x0}, - 523: {region: 0xdb, script: 0x22, flags: 0x0}, - 524: {region: 0x165, script: 0x5a, flags: 0x0}, - 525: {region: 0x63, script: 0x5a, flags: 0x0}, - 526: {region: 0x95, script: 0x5a, flags: 0x0}, - 527: {region: 0x95, script: 0x5a, flags: 0x0}, - 528: {region: 0x7d, script: 0x2e, flags: 0x0}, - 529: {region: 0x137, script: 0x20, flags: 0x0}, - 530: {region: 0x67, script: 0x5a, flags: 0x0}, - 531: {region: 0xc4, script: 0x5a, flags: 0x0}, - 532: {region: 0x165, script: 0x5a, flags: 0x0}, - 533: {region: 0x165, script: 0x5a, flags: 0x0}, - 534: {region: 0xd6, script: 0x5a, flags: 0x0}, - 535: {region: 0xa4, script: 0x5a, flags: 0x0}, - 536: {region: 0xc3, script: 0x5a, flags: 0x0}, - 537: {region: 0x106, script: 0x20, flags: 0x0}, - 538: {region: 0x165, script: 0x5a, flags: 0x0}, - 539: {region: 0x165, script: 0x5a, flags: 0x0}, - 540: {region: 0x165, script: 0x5a, flags: 0x0}, - 541: {region: 0x165, script: 0x5a, flags: 0x0}, - 542: {region: 0xd4, script: 0x5, flags: 0x0}, - 543: {region: 0xd6, script: 0x5a, flags: 0x0}, - 544: {region: 0x164, script: 0x5a, flags: 0x0}, - 545: {region: 0x165, script: 0x5a, flags: 0x0}, - 546: {region: 0x165, script: 0x5a, flags: 0x0}, - 547: {region: 0x12f, script: 0x5a, flags: 0x0}, - 548: {region: 0x122, script: 0x5, flags: 0x0}, - 549: {region: 0x165, script: 0x5a, flags: 0x0}, - 550: {region: 0x123, script: 0xe6, flags: 0x0}, - 551: {region: 0x5a, script: 0x5a, flags: 0x0}, - 552: {region: 0x52, script: 0x5a, flags: 0x0}, - 553: {region: 0x165, script: 0x5a, flags: 0x0}, - 554: {region: 0x4f, script: 0x5a, flags: 0x0}, - 555: {region: 0x99, script: 0x22, flags: 0x0}, - 556: {region: 0x99, script: 0x22, flags: 0x0}, - 557: {region: 0x4b, script: 0x5a, flags: 0x0}, - 558: {region: 0x95, script: 0x5a, flags: 0x0}, - 559: {region: 0x165, script: 0x5a, flags: 0x0}, - 560: {region: 0x41, script: 0x5a, flags: 0x0}, - 561: {region: 0x99, script: 0x5a, flags: 0x0}, - 562: {region: 0x53, script: 0xdd, flags: 0x0}, - 563: {region: 0x99, script: 0x22, flags: 0x0}, - 564: {region: 0xc3, script: 0x5a, flags: 0x0}, - 565: {region: 0x165, script: 0x5a, flags: 0x0}, - 566: {region: 0x99, script: 0x75, flags: 0x0}, - 567: {region: 0xe8, script: 0x5, flags: 0x0}, - 568: {region: 0x165, script: 0x5a, flags: 0x0}, - 569: {region: 0xa4, script: 0x5a, flags: 0x0}, - 570: {region: 0x165, script: 0x5a, flags: 0x0}, - 571: {region: 0x12b, script: 0x5a, flags: 0x0}, - 572: {region: 0x165, script: 0x5a, flags: 0x0}, - 573: {region: 0xd2, script: 0x5a, flags: 0x0}, - 574: {region: 0x165, script: 0x5a, flags: 0x0}, - 575: {region: 0xaf, script: 0x57, flags: 0x0}, - 576: {region: 0x165, script: 0x5a, flags: 0x0}, - 577: {region: 0x165, script: 0x5a, flags: 0x0}, + 507: {region: 0x98, script: 0x3e, flags: 0x0}, + 508: {region: 0x166, script: 0x5b, flags: 0x0}, + 509: {region: 0x166, script: 0x5b, flags: 0x0}, + 510: {region: 0x107, script: 0x5b, flags: 0x0}, + 511: {region: 0x166, script: 0x5b, flags: 0x0}, + 512: {region: 0xa3, script: 0x49, flags: 0x0}, + 513: {region: 0x166, script: 0x5b, flags: 0x0}, + 514: {region: 0xa1, script: 0x5b, flags: 0x0}, + 515: {region: 0x1, script: 0x5b, flags: 0x0}, + 516: {region: 0x166, script: 0x5b, flags: 0x0}, + 517: {region: 0x166, script: 0x5b, flags: 0x0}, + 518: {region: 0x166, script: 0x5b, flags: 0x0}, + 519: {region: 0x52, script: 0x5b, flags: 0x0}, + 520: {region: 0x131, script: 0x3e, flags: 0x0}, + 521: {region: 0x166, script: 0x5b, flags: 0x0}, + 522: {region: 0x130, script: 0x5b, flags: 0x0}, + 523: {region: 0xdc, script: 0x22, flags: 0x0}, + 524: {region: 0x166, script: 0x5b, flags: 0x0}, + 525: {region: 0x64, script: 0x5b, flags: 0x0}, + 526: {region: 0x96, script: 0x5b, flags: 0x0}, + 527: {region: 0x96, script: 0x5b, flags: 0x0}, + 528: {region: 0x7e, script: 0x2e, flags: 0x0}, + 529: {region: 0x138, script: 0x20, flags: 0x0}, + 530: {region: 0x68, script: 0x5b, flags: 0x0}, + 531: {region: 0xc5, script: 0x5b, flags: 0x0}, + 532: {region: 0x166, script: 0x5b, flags: 0x0}, + 533: {region: 0x166, script: 0x5b, flags: 0x0}, + 534: {region: 0xd7, script: 0x5b, flags: 0x0}, + 535: {region: 0xa5, script: 0x5b, flags: 0x0}, + 536: {region: 0xc4, script: 0x5b, flags: 0x0}, + 537: {region: 0x107, script: 0x20, flags: 0x0}, + 538: {region: 0x166, script: 0x5b, flags: 0x0}, + 539: {region: 0x166, script: 0x5b, flags: 0x0}, + 540: {region: 0x166, script: 0x5b, flags: 0x0}, + 541: {region: 0x166, script: 0x5b, flags: 0x0}, + 542: {region: 0xd5, script: 0x5, flags: 0x0}, + 543: {region: 0xd7, script: 0x5b, flags: 0x0}, + 544: {region: 0x165, script: 0x5b, flags: 0x0}, + 545: {region: 0x166, script: 0x5b, flags: 0x0}, + 546: {region: 0x166, script: 0x5b, flags: 0x0}, + 547: {region: 0x130, script: 0x5b, flags: 0x0}, + 548: {region: 0x123, script: 0x5, flags: 0x0}, + 549: {region: 0x166, script: 0x5b, flags: 0x0}, + 550: {region: 0x124, script: 0xee, flags: 0x0}, + 551: {region: 0x5b, script: 0x5b, flags: 0x0}, + 552: {region: 0x52, script: 0x5b, flags: 0x0}, + 553: {region: 0x166, script: 0x5b, flags: 0x0}, + 554: {region: 0x4f, script: 0x5b, flags: 0x0}, + 555: {region: 0x9a, script: 0x22, flags: 0x0}, + 556: {region: 0x9a, script: 0x22, flags: 0x0}, + 557: {region: 0x4b, script: 0x5b, flags: 0x0}, + 558: {region: 0x96, script: 0x5b, flags: 0x0}, + 559: {region: 0x166, script: 0x5b, flags: 0x0}, + 560: {region: 0x41, script: 0x5b, flags: 0x0}, + 561: {region: 0x9a, script: 0x5b, flags: 0x0}, + 562: {region: 0x53, script: 0xe5, flags: 0x0}, + 563: {region: 0x9a, script: 0x22, flags: 0x0}, + 564: {region: 0xc4, script: 0x5b, flags: 0x0}, + 565: {region: 0x166, script: 0x5b, flags: 0x0}, + 566: {region: 0x9a, script: 0x76, flags: 0x0}, + 567: {region: 0xe9, script: 0x5, flags: 0x0}, + 568: {region: 0x166, script: 0x5b, flags: 0x0}, + 569: {region: 0xa5, script: 0x5b, flags: 0x0}, + 570: {region: 0x166, script: 0x5b, flags: 0x0}, + 571: {region: 0x12c, script: 0x5b, flags: 0x0}, + 572: {region: 0x166, script: 0x5b, flags: 0x0}, + 573: {region: 0xd3, script: 0x5b, flags: 0x0}, + 574: {region: 0x166, script: 0x5b, flags: 0x0}, + 575: {region: 0xb0, script: 0x58, flags: 0x0}, + 576: {region: 0x166, script: 0x5b, flags: 0x0}, + 577: {region: 0x166, script: 0x5b, flags: 0x0}, 578: {region: 0x13, script: 0x6, flags: 0x1}, - 579: {region: 0x165, script: 0x5a, flags: 0x0}, - 580: {region: 0x52, script: 0x5a, flags: 0x0}, - 581: {region: 0x82, script: 0x5a, flags: 0x0}, - 582: {region: 0xa4, script: 0x5a, flags: 0x0}, - 583: {region: 0x165, script: 0x5a, flags: 0x0}, - 584: {region: 0x165, script: 0x5a, flags: 0x0}, - 585: {region: 0x165, script: 0x5a, flags: 0x0}, - 586: {region: 0xa6, script: 0x4e, flags: 0x0}, - 587: {region: 0x2a, script: 0x5a, flags: 0x0}, - 588: {region: 0x165, script: 0x5a, flags: 0x0}, - 589: {region: 0x165, script: 0x5a, flags: 0x0}, - 590: {region: 0x165, script: 0x5a, flags: 0x0}, - 591: {region: 0x165, script: 0x5a, flags: 0x0}, - 592: {region: 0x165, script: 0x5a, flags: 0x0}, - 593: {region: 0x99, script: 0x52, flags: 0x0}, - 594: {region: 0x8b, script: 0x5a, flags: 0x0}, - 595: {region: 0x165, script: 0x5a, flags: 0x0}, - 596: {region: 0xab, script: 0x53, flags: 0x0}, - 597: {region: 0x106, script: 0x20, flags: 0x0}, - 598: {region: 0x99, script: 0x22, flags: 0x0}, - 599: {region: 0x165, script: 0x5a, flags: 0x0}, - 600: {region: 0x75, script: 0x5a, flags: 0x0}, - 601: {region: 0x165, script: 0x5a, flags: 0x0}, - 602: {region: 0xb4, script: 0x5a, flags: 0x0}, - 603: {region: 0x165, script: 0x5a, flags: 0x0}, - 604: {region: 0x165, script: 0x5a, flags: 0x0}, - 605: {region: 0x165, script: 0x5a, flags: 0x0}, - 606: {region: 0x165, script: 0x5a, flags: 0x0}, - 607: {region: 0x165, script: 0x5a, flags: 0x0}, - 608: {region: 0x165, script: 0x5a, flags: 0x0}, - 609: {region: 0x165, script: 0x5a, flags: 0x0}, - 610: {region: 0x165, script: 0x2c, flags: 0x0}, - 611: {region: 0x165, script: 0x5a, flags: 0x0}, - 612: {region: 0x106, script: 0x20, flags: 0x0}, - 613: {region: 0x112, script: 0x5a, flags: 0x0}, - 614: {region: 0xe7, script: 0x5a, flags: 0x0}, - 615: {region: 0x106, script: 0x5a, flags: 0x0}, - 616: {region: 0x165, script: 0x5a, flags: 0x0}, - 617: {region: 0x99, script: 0x22, flags: 0x0}, - 618: {region: 0x99, script: 0x5, flags: 0x0}, - 619: {region: 0x12f, script: 0x5a, flags: 0x0}, - 620: {region: 0x165, script: 0x5a, flags: 0x0}, - 621: {region: 0x52, script: 0x5a, flags: 0x0}, - 622: {region: 0x60, script: 0x5a, flags: 0x0}, - 623: {region: 0x165, script: 0x5a, flags: 0x0}, - 624: {region: 0x165, script: 0x5a, flags: 0x0}, - 625: {region: 0x165, script: 0x2c, flags: 0x0}, - 626: {region: 0x165, script: 0x5a, flags: 0x0}, - 627: {region: 0x165, script: 0x5a, flags: 0x0}, + 579: {region: 0x166, script: 0x5b, flags: 0x0}, + 580: {region: 0x52, script: 0x5b, flags: 0x0}, + 581: {region: 0x83, script: 0x5b, flags: 0x0}, + 582: {region: 0xa5, script: 0x5b, flags: 0x0}, + 583: {region: 0x166, script: 0x5b, flags: 0x0}, + 584: {region: 0x166, script: 0x5b, flags: 0x0}, + 585: {region: 0x166, script: 0x5b, flags: 0x0}, + 586: {region: 0xa7, script: 0x4f, flags: 0x0}, + 587: {region: 0x2a, script: 0x5b, flags: 0x0}, + 588: {region: 0x166, script: 0x5b, flags: 0x0}, + 589: {region: 0x166, script: 0x5b, flags: 0x0}, + 590: {region: 0x166, script: 0x5b, flags: 0x0}, + 591: {region: 0x166, script: 0x5b, flags: 0x0}, + 592: {region: 0x166, script: 0x5b, flags: 0x0}, + 593: {region: 0x9a, script: 0x53, flags: 0x0}, + 594: {region: 0x8c, script: 0x5b, flags: 0x0}, + 595: {region: 0x166, script: 0x5b, flags: 0x0}, + 596: {region: 0xac, script: 0x54, flags: 0x0}, + 597: {region: 0x107, script: 0x20, flags: 0x0}, + 598: {region: 0x9a, script: 0x22, flags: 0x0}, + 599: {region: 0x166, script: 0x5b, flags: 0x0}, + 600: {region: 0x76, script: 0x5b, flags: 0x0}, + 601: {region: 0x166, script: 0x5b, flags: 0x0}, + 602: {region: 0xb5, script: 0x5b, flags: 0x0}, + 603: {region: 0x166, script: 0x5b, flags: 0x0}, + 604: {region: 0x166, script: 0x5b, flags: 0x0}, + 605: {region: 0x166, script: 0x5b, flags: 0x0}, + 606: {region: 0x166, script: 0x5b, flags: 0x0}, + 607: {region: 0x166, script: 0x5b, flags: 0x0}, + 608: {region: 0x166, script: 0x5b, flags: 0x0}, + 609: {region: 0x166, script: 0x5b, flags: 0x0}, + 610: {region: 0x166, script: 0x2c, flags: 0x0}, + 611: {region: 0x166, script: 0x5b, flags: 0x0}, + 612: {region: 0x107, script: 0x20, flags: 0x0}, + 613: {region: 0x113, script: 0x5b, flags: 0x0}, + 614: {region: 0xe8, script: 0x5b, flags: 0x0}, + 615: {region: 0x107, script: 0x5b, flags: 0x0}, + 616: {region: 0x166, script: 0x5b, flags: 0x0}, + 617: {region: 0x9a, script: 0x22, flags: 0x0}, + 618: {region: 0x9a, script: 0x5, flags: 0x0}, + 619: {region: 0x130, script: 0x5b, flags: 0x0}, + 620: {region: 0x166, script: 0x5b, flags: 0x0}, + 621: {region: 0x52, script: 0x5b, flags: 0x0}, + 622: {region: 0x61, script: 0x5b, flags: 0x0}, + 623: {region: 0x166, script: 0x5b, flags: 0x0}, + 624: {region: 0x166, script: 0x5b, flags: 0x0}, + 625: {region: 0x166, script: 0x2c, flags: 0x0}, + 626: {region: 0x166, script: 0x5b, flags: 0x0}, + 627: {region: 0x166, script: 0x5b, flags: 0x0}, 628: {region: 0x19, script: 0x3, flags: 0x1}, - 629: {region: 0x165, script: 0x5a, flags: 0x0}, - 630: {region: 0x165, script: 0x5a, flags: 0x0}, - 631: {region: 0x165, script: 0x5a, flags: 0x0}, - 632: {region: 0x165, script: 0x5a, flags: 0x0}, - 633: {region: 0x106, script: 0x20, flags: 0x0}, - 634: {region: 0x165, script: 0x5a, flags: 0x0}, - 635: {region: 0x165, script: 0x5a, flags: 0x0}, - 636: {region: 0x165, script: 0x5a, flags: 0x0}, - 637: {region: 0x106, script: 0x20, flags: 0x0}, - 638: {region: 0x165, script: 0x5a, flags: 0x0}, - 639: {region: 0x95, script: 0x5a, flags: 0x0}, - 640: {region: 0xe8, script: 0x5, flags: 0x0}, - 641: {region: 0x7b, script: 0x5a, flags: 0x0}, - 642: {region: 0x165, script: 0x5a, flags: 0x0}, - 643: {region: 0x165, script: 0x5a, flags: 0x0}, - 644: {region: 0x165, script: 0x5a, flags: 0x0}, - 645: {region: 0x165, script: 0x2c, flags: 0x0}, - 646: {region: 0x123, script: 0xe6, flags: 0x0}, - 647: {region: 0xe8, script: 0x5, flags: 0x0}, - 648: {region: 0x165, script: 0x5a, flags: 0x0}, - 649: {region: 0x165, script: 0x5a, flags: 0x0}, + 629: {region: 0x166, script: 0x5b, flags: 0x0}, + 630: {region: 0x166, script: 0x5b, flags: 0x0}, + 631: {region: 0x166, script: 0x5b, flags: 0x0}, + 632: {region: 0x166, script: 0x5b, flags: 0x0}, + 633: {region: 0x107, script: 0x20, flags: 0x0}, + 634: {region: 0x166, script: 0x5b, flags: 0x0}, + 635: {region: 0x166, script: 0x5b, flags: 0x0}, + 636: {region: 0x166, script: 0x5b, flags: 0x0}, + 637: {region: 0x107, script: 0x20, flags: 0x0}, + 638: {region: 0x166, script: 0x5b, flags: 0x0}, + 639: {region: 0x96, script: 0x5b, flags: 0x0}, + 640: {region: 0xe9, script: 0x5, flags: 0x0}, + 641: {region: 0x7c, script: 0x5b, flags: 0x0}, + 642: {region: 0x166, script: 0x5b, flags: 0x0}, + 643: {region: 0x166, script: 0x5b, flags: 0x0}, + 644: {region: 0x166, script: 0x5b, flags: 0x0}, + 645: {region: 0x166, script: 0x2c, flags: 0x0}, + 646: {region: 0x124, script: 0xee, flags: 0x0}, + 647: {region: 0xe9, script: 0x5, flags: 0x0}, + 648: {region: 0x166, script: 0x5b, flags: 0x0}, + 649: {region: 0x166, script: 0x5b, flags: 0x0}, 650: {region: 0x1c, script: 0x5, flags: 0x1}, - 651: {region: 0x165, script: 0x5a, flags: 0x0}, - 652: {region: 0x165, script: 0x5a, flags: 0x0}, - 653: {region: 0x165, script: 0x5a, flags: 0x0}, - 654: {region: 0x138, script: 0x5a, flags: 0x0}, - 655: {region: 0x87, script: 0x5e, flags: 0x0}, - 656: {region: 0x97, script: 0x3e, flags: 0x0}, - 657: {region: 0x12f, script: 0x5a, flags: 0x0}, - 658: {region: 0xe8, script: 0x5, flags: 0x0}, - 659: {region: 0x131, script: 0x5a, flags: 0x0}, - 660: {region: 0x165, script: 0x5a, flags: 0x0}, - 661: {region: 0xb7, script: 0x5a, flags: 0x0}, - 662: {region: 0x106, script: 0x20, flags: 0x0}, - 663: {region: 0x165, script: 0x5a, flags: 0x0}, - 664: {region: 0x95, script: 0x5a, flags: 0x0}, - 665: {region: 0x165, script: 0x5a, flags: 0x0}, - 666: {region: 0x53, script: 0xe6, flags: 0x0}, - 667: {region: 0x165, script: 0x5a, flags: 0x0}, - 668: {region: 0x165, script: 0x5a, flags: 0x0}, - 669: {region: 0x165, script: 0x5a, flags: 0x0}, - 670: {region: 0x165, script: 0x5a, flags: 0x0}, - 671: {region: 0x99, script: 0x5c, flags: 0x0}, - 672: {region: 0x165, script: 0x5a, flags: 0x0}, - 673: {region: 0x165, script: 0x5a, flags: 0x0}, - 674: {region: 0x106, script: 0x20, flags: 0x0}, - 675: {region: 0x131, script: 0x5a, flags: 0x0}, - 676: {region: 0x165, script: 0x5a, flags: 0x0}, - 677: {region: 0xd9, script: 0x5a, flags: 0x0}, - 678: {region: 0x165, script: 0x5a, flags: 0x0}, - 679: {region: 0x165, script: 0x5a, flags: 0x0}, + 651: {region: 0x166, script: 0x5b, flags: 0x0}, + 652: {region: 0x166, script: 0x5b, flags: 0x0}, + 653: {region: 0x166, script: 0x5b, flags: 0x0}, + 654: {region: 0x139, script: 0x5b, flags: 0x0}, + 655: {region: 0x88, script: 0x5f, flags: 0x0}, + 656: {region: 0x98, script: 0x3e, flags: 0x0}, + 657: {region: 0x130, script: 0x5b, flags: 0x0}, + 658: {region: 0xe9, script: 0x5, flags: 0x0}, + 659: {region: 0x132, script: 0x5b, flags: 0x0}, + 660: {region: 0x166, script: 0x5b, flags: 0x0}, + 661: {region: 0xb8, script: 0x5b, flags: 0x0}, + 662: {region: 0x107, script: 0x20, flags: 0x0}, + 663: {region: 0x166, script: 0x5b, flags: 0x0}, + 664: {region: 0x96, script: 0x5b, flags: 0x0}, + 665: {region: 0x166, script: 0x5b, flags: 0x0}, + 666: {region: 0x53, script: 0xee, flags: 0x0}, + 667: {region: 0x166, script: 0x5b, flags: 0x0}, + 668: {region: 0x166, script: 0x5b, flags: 0x0}, + 669: {region: 0x166, script: 0x5b, flags: 0x0}, + 670: {region: 0x166, script: 0x5b, flags: 0x0}, + 671: {region: 0x9a, script: 0x5d, flags: 0x0}, + 672: {region: 0x166, script: 0x5b, flags: 0x0}, + 673: {region: 0x166, script: 0x5b, flags: 0x0}, + 674: {region: 0x107, script: 0x20, flags: 0x0}, + 675: {region: 0x132, script: 0x5b, flags: 0x0}, + 676: {region: 0x166, script: 0x5b, flags: 0x0}, + 677: {region: 0xda, script: 0x5b, flags: 0x0}, + 678: {region: 0x166, script: 0x5b, flags: 0x0}, + 679: {region: 0x166, script: 0x5b, flags: 0x0}, 680: {region: 0x21, script: 0x2, flags: 0x1}, - 681: {region: 0x165, script: 0x5a, flags: 0x0}, - 682: {region: 0x165, script: 0x5a, flags: 0x0}, - 683: {region: 0x9e, script: 0x5a, flags: 0x0}, - 684: {region: 0x53, script: 0x60, flags: 0x0}, - 685: {region: 0x95, script: 0x5a, flags: 0x0}, - 686: {region: 0x9c, script: 0x5, flags: 0x0}, - 687: {region: 0x135, script: 0x5a, flags: 0x0}, - 688: {region: 0x165, script: 0x5a, flags: 0x0}, - 689: {region: 0x165, script: 0x5a, flags: 0x0}, - 690: {region: 0x99, script: 0xe1, flags: 0x0}, - 691: {region: 0x9e, script: 0x5a, flags: 0x0}, - 692: {region: 0x165, script: 0x5a, flags: 0x0}, - 693: {region: 0x4b, script: 0x5a, flags: 0x0}, - 694: {region: 0x165, script: 0x5a, flags: 0x0}, - 695: {region: 0x165, script: 0x5a, flags: 0x0}, - 696: {region: 0xaf, script: 0x57, flags: 0x0}, - 697: {region: 0x165, script: 0x5a, flags: 0x0}, - 698: {region: 0x165, script: 0x5a, flags: 0x0}, - 699: {region: 0x4b, script: 0x5a, flags: 0x0}, - 700: {region: 0x165, script: 0x5a, flags: 0x0}, - 701: {region: 0x165, script: 0x5a, flags: 0x0}, - 702: {region: 0x162, script: 0x5a, flags: 0x0}, - 703: {region: 0x9c, script: 0x5, flags: 0x0}, - 704: {region: 0xb6, script: 0x5a, flags: 0x0}, - 705: {region: 0xb8, script: 0x5a, flags: 0x0}, - 706: {region: 0x4b, script: 0x5a, flags: 0x0}, - 707: {region: 0x4b, script: 0x5a, flags: 0x0}, - 708: {region: 0xa4, script: 0x5a, flags: 0x0}, - 709: {region: 0xa4, script: 0x5a, flags: 0x0}, - 710: {region: 0x9c, script: 0x5, flags: 0x0}, - 711: {region: 0xb8, script: 0x5a, flags: 0x0}, - 712: {region: 0x123, script: 0xe6, flags: 0x0}, + 681: {region: 0x166, script: 0x5b, flags: 0x0}, + 682: {region: 0x166, script: 0x5b, flags: 0x0}, + 683: {region: 0x9f, script: 0x5b, flags: 0x0}, + 684: {region: 0x53, script: 0x61, flags: 0x0}, + 685: {region: 0x96, script: 0x5b, flags: 0x0}, + 686: {region: 0x9d, script: 0x5, flags: 0x0}, + 687: {region: 0x136, script: 0x5b, flags: 0x0}, + 688: {region: 0x166, script: 0x5b, flags: 0x0}, + 689: {region: 0x166, script: 0x5b, flags: 0x0}, + 690: {region: 0x9a, script: 0xe9, flags: 0x0}, + 691: {region: 0x9f, script: 0x5b, flags: 0x0}, + 692: {region: 0x166, script: 0x5b, flags: 0x0}, + 693: {region: 0x4b, script: 0x5b, flags: 0x0}, + 694: {region: 0x166, script: 0x5b, flags: 0x0}, + 695: {region: 0x166, script: 0x5b, flags: 0x0}, + 696: {region: 0xb0, script: 0x58, flags: 0x0}, + 697: {region: 0x166, script: 0x5b, flags: 0x0}, + 698: {region: 0x166, script: 0x5b, flags: 0x0}, + 699: {region: 0x4b, script: 0x5b, flags: 0x0}, + 700: {region: 0x166, script: 0x5b, flags: 0x0}, + 701: {region: 0x166, script: 0x5b, flags: 0x0}, + 702: {region: 0x163, script: 0x5b, flags: 0x0}, + 703: {region: 0x9d, script: 0x5, flags: 0x0}, + 704: {region: 0xb7, script: 0x5b, flags: 0x0}, + 705: {region: 0xb9, script: 0x5b, flags: 0x0}, + 706: {region: 0x4b, script: 0x5b, flags: 0x0}, + 707: {region: 0x4b, script: 0x5b, flags: 0x0}, + 708: {region: 0xa5, script: 0x5b, flags: 0x0}, + 709: {region: 0xa5, script: 0x5b, flags: 0x0}, + 710: {region: 0x9d, script: 0x5, flags: 0x0}, + 711: {region: 0xb9, script: 0x5b, flags: 0x0}, + 712: {region: 0x124, script: 0xee, flags: 0x0}, 713: {region: 0x53, script: 0x3b, flags: 0x0}, - 714: {region: 0x12b, script: 0x5a, flags: 0x0}, - 715: {region: 0x95, script: 0x5a, flags: 0x0}, - 716: {region: 0x52, script: 0x5a, flags: 0x0}, - 717: {region: 0x99, script: 0x22, flags: 0x0}, - 718: {region: 0x99, script: 0x22, flags: 0x0}, - 719: {region: 0x95, script: 0x5a, flags: 0x0}, + 714: {region: 0x12c, script: 0x5b, flags: 0x0}, + 715: {region: 0x96, script: 0x5b, flags: 0x0}, + 716: {region: 0x52, script: 0x5b, flags: 0x0}, + 717: {region: 0x9a, script: 0x22, flags: 0x0}, + 718: {region: 0x9a, script: 0x22, flags: 0x0}, + 719: {region: 0x96, script: 0x5b, flags: 0x0}, 720: {region: 0x23, script: 0x3, flags: 0x1}, - 721: {region: 0xa4, script: 0x5a, flags: 0x0}, - 722: {region: 0x165, script: 0x5a, flags: 0x0}, - 723: {region: 0xcf, script: 0x5a, flags: 0x0}, - 724: {region: 0x165, script: 0x5a, flags: 0x0}, - 725: {region: 0x165, script: 0x5a, flags: 0x0}, - 726: {region: 0x165, script: 0x5a, flags: 0x0}, - 727: {region: 0x165, script: 0x5a, flags: 0x0}, - 728: {region: 0x165, script: 0x5a, flags: 0x0}, - 729: {region: 0x165, script: 0x5a, flags: 0x0}, - 730: {region: 0x165, script: 0x5a, flags: 0x0}, - 731: {region: 0x165, script: 0x5a, flags: 0x0}, - 732: {region: 0x165, script: 0x5a, flags: 0x0}, - 733: {region: 0x165, script: 0x5a, flags: 0x0}, - 734: {region: 0x165, script: 0x5a, flags: 0x0}, - 735: {region: 0x165, script: 0x5, flags: 0x0}, - 736: {region: 0x106, script: 0x20, flags: 0x0}, - 737: {region: 0xe7, script: 0x5a, flags: 0x0}, - 738: {region: 0x165, script: 0x5a, flags: 0x0}, - 739: {region: 0x95, script: 0x5a, flags: 0x0}, - 740: {region: 0x165, script: 0x2c, flags: 0x0}, - 741: {region: 0x165, script: 0x5a, flags: 0x0}, - 742: {region: 0x165, script: 0x5a, flags: 0x0}, - 743: {region: 0x165, script: 0x5a, flags: 0x0}, - 744: {region: 0x112, script: 0x5a, flags: 0x0}, - 745: {region: 0xa4, script: 0x5a, flags: 0x0}, - 746: {region: 0x165, script: 0x5a, flags: 0x0}, - 747: {region: 0x165, script: 0x5a, flags: 0x0}, - 748: {region: 0x123, script: 0x5, flags: 0x0}, - 749: {region: 0xcc, script: 0x5a, flags: 0x0}, - 750: {region: 0x165, script: 0x5a, flags: 0x0}, - 751: {region: 0x165, script: 0x5a, flags: 0x0}, - 752: {region: 0x165, script: 0x5a, flags: 0x0}, - 753: {region: 0xbf, script: 0x5a, flags: 0x0}, - 754: {region: 0xd1, script: 0x5a, flags: 0x0}, - 755: {region: 0x165, script: 0x5a, flags: 0x0}, - 756: {region: 0x52, script: 0x5a, flags: 0x0}, - 757: {region: 0xdb, script: 0x22, flags: 0x0}, - 758: {region: 0x12f, script: 0x5a, flags: 0x0}, - 759: {region: 0xc0, script: 0x5a, flags: 0x0}, - 760: {region: 0x165, script: 0x5a, flags: 0x0}, - 761: {region: 0x165, script: 0x5a, flags: 0x0}, - 762: {region: 0xe0, script: 0x5a, flags: 0x0}, - 763: {region: 0x165, script: 0x5a, flags: 0x0}, - 764: {region: 0x95, script: 0x5a, flags: 0x0}, - 765: {region: 0x9b, script: 0x3d, flags: 0x0}, - 766: {region: 0x165, script: 0x5a, flags: 0x0}, - 767: {region: 0xc2, script: 0x20, flags: 0x0}, - 768: {region: 0x165, script: 0x5, flags: 0x0}, - 769: {region: 0x165, script: 0x5a, flags: 0x0}, - 770: {region: 0x165, script: 0x5a, flags: 0x0}, - 771: {region: 0x165, script: 0x5a, flags: 0x0}, - 772: {region: 0x99, script: 0x6e, flags: 0x0}, - 773: {region: 0x165, script: 0x5a, flags: 0x0}, - 774: {region: 0x165, script: 0x5a, flags: 0x0}, - 775: {region: 0x10b, script: 0x5a, flags: 0x0}, - 776: {region: 0x165, script: 0x5a, flags: 0x0}, - 777: {region: 0x165, script: 0x5a, flags: 0x0}, - 778: {region: 0x165, script: 0x5a, flags: 0x0}, + 721: {region: 0xa5, script: 0x5b, flags: 0x0}, + 722: {region: 0x166, script: 0x5b, flags: 0x0}, + 723: {region: 0xd0, script: 0x5b, flags: 0x0}, + 724: {region: 0x166, script: 0x5b, flags: 0x0}, + 725: {region: 0x166, script: 0x5b, flags: 0x0}, + 726: {region: 0x166, script: 0x5b, flags: 0x0}, + 727: {region: 0x166, script: 0x5b, flags: 0x0}, + 728: {region: 0x166, script: 0x5b, flags: 0x0}, + 729: {region: 0x166, script: 0x5b, flags: 0x0}, + 730: {region: 0x166, script: 0x5b, flags: 0x0}, + 731: {region: 0x166, script: 0x5b, flags: 0x0}, + 732: {region: 0x166, script: 0x5b, flags: 0x0}, + 733: {region: 0x166, script: 0x5b, flags: 0x0}, + 734: {region: 0x166, script: 0x5b, flags: 0x0}, + 735: {region: 0x166, script: 0x5, flags: 0x0}, + 736: {region: 0x107, script: 0x20, flags: 0x0}, + 737: {region: 0xe8, script: 0x5b, flags: 0x0}, + 738: {region: 0x166, script: 0x5b, flags: 0x0}, + 739: {region: 0x96, script: 0x5b, flags: 0x0}, + 740: {region: 0x166, script: 0x2c, flags: 0x0}, + 741: {region: 0x166, script: 0x5b, flags: 0x0}, + 742: {region: 0x166, script: 0x5b, flags: 0x0}, + 743: {region: 0x166, script: 0x5b, flags: 0x0}, + 744: {region: 0x113, script: 0x5b, flags: 0x0}, + 745: {region: 0xa5, script: 0x5b, flags: 0x0}, + 746: {region: 0x166, script: 0x5b, flags: 0x0}, + 747: {region: 0x166, script: 0x5b, flags: 0x0}, + 748: {region: 0x124, script: 0x5, flags: 0x0}, + 749: {region: 0xcd, script: 0x5b, flags: 0x0}, + 750: {region: 0x166, script: 0x5b, flags: 0x0}, + 751: {region: 0x166, script: 0x5b, flags: 0x0}, + 752: {region: 0x166, script: 0x5b, flags: 0x0}, + 753: {region: 0xc0, script: 0x5b, flags: 0x0}, + 754: {region: 0xd2, script: 0x5b, flags: 0x0}, + 755: {region: 0x166, script: 0x5b, flags: 0x0}, + 756: {region: 0x52, script: 0x5b, flags: 0x0}, + 757: {region: 0xdc, script: 0x22, flags: 0x0}, + 758: {region: 0x130, script: 0x5b, flags: 0x0}, + 759: {region: 0xc1, script: 0x5b, flags: 0x0}, + 760: {region: 0x166, script: 0x5b, flags: 0x0}, + 761: {region: 0x166, script: 0x5b, flags: 0x0}, + 762: {region: 0xe1, script: 0x5b, flags: 0x0}, + 763: {region: 0x166, script: 0x5b, flags: 0x0}, + 764: {region: 0x96, script: 0x5b, flags: 0x0}, + 765: {region: 0x9c, script: 0x3d, flags: 0x0}, + 766: {region: 0x166, script: 0x5b, flags: 0x0}, + 767: {region: 0xc3, script: 0x20, flags: 0x0}, + 768: {region: 0x166, script: 0x5, flags: 0x0}, + 769: {region: 0x166, script: 0x5b, flags: 0x0}, + 770: {region: 0x166, script: 0x5b, flags: 0x0}, + 771: {region: 0x166, script: 0x5b, flags: 0x0}, + 772: {region: 0x9a, script: 0x6f, flags: 0x0}, + 773: {region: 0x166, script: 0x5b, flags: 0x0}, + 774: {region: 0x166, script: 0x5b, flags: 0x0}, + 775: {region: 0x10c, script: 0x5b, flags: 0x0}, + 776: {region: 0x166, script: 0x5b, flags: 0x0}, + 777: {region: 0x166, script: 0x5b, flags: 0x0}, + 778: {region: 0x166, script: 0x5b, flags: 0x0}, 779: {region: 0x26, script: 0x3, flags: 0x1}, - 780: {region: 0x165, script: 0x5a, flags: 0x0}, - 781: {region: 0x165, script: 0x5a, flags: 0x0}, - 782: {region: 0x99, script: 0xe, flags: 0x0}, - 783: {region: 0xc4, script: 0x75, flags: 0x0}, - 785: {region: 0x165, script: 0x5a, flags: 0x0}, - 786: {region: 0x49, script: 0x5a, flags: 0x0}, - 787: {region: 0x49, script: 0x5a, flags: 0x0}, - 788: {region: 0x37, script: 0x5a, flags: 0x0}, - 789: {region: 0x165, script: 0x5a, flags: 0x0}, - 790: {region: 0x165, script: 0x5a, flags: 0x0}, - 791: {region: 0x165, script: 0x5a, flags: 0x0}, - 792: {region: 0x165, script: 0x5a, flags: 0x0}, - 793: {region: 0x165, script: 0x5a, flags: 0x0}, - 794: {region: 0x165, script: 0x5a, flags: 0x0}, - 795: {region: 0x99, script: 0x22, flags: 0x0}, - 796: {region: 0xdb, script: 0x22, flags: 0x0}, - 797: {region: 0x106, script: 0x20, flags: 0x0}, - 798: {region: 0x35, script: 0x72, flags: 0x0}, + 780: {region: 0x166, script: 0x5b, flags: 0x0}, + 781: {region: 0x166, script: 0x5b, flags: 0x0}, + 782: {region: 0x9a, script: 0xe, flags: 0x0}, + 783: {region: 0xc5, script: 0x76, flags: 0x0}, + 785: {region: 0x166, script: 0x5b, flags: 0x0}, + 786: {region: 0x49, script: 0x5b, flags: 0x0}, + 787: {region: 0x49, script: 0x5b, flags: 0x0}, + 788: {region: 0x37, script: 0x5b, flags: 0x0}, + 789: {region: 0x166, script: 0x5b, flags: 0x0}, + 790: {region: 0x166, script: 0x5b, flags: 0x0}, + 791: {region: 0x166, script: 0x5b, flags: 0x0}, + 792: {region: 0x166, script: 0x5b, flags: 0x0}, + 793: {region: 0x166, script: 0x5b, flags: 0x0}, + 794: {region: 0x166, script: 0x5b, flags: 0x0}, + 795: {region: 0x9a, script: 0x22, flags: 0x0}, + 796: {region: 0xdc, script: 0x22, flags: 0x0}, + 797: {region: 0x107, script: 0x20, flags: 0x0}, + 798: {region: 0x35, script: 0x73, flags: 0x0}, 799: {region: 0x29, script: 0x3, flags: 0x1}, - 800: {region: 0xcb, script: 0x5a, flags: 0x0}, - 801: {region: 0x165, script: 0x5a, flags: 0x0}, - 802: {region: 0x165, script: 0x5a, flags: 0x0}, - 803: {region: 0x165, script: 0x5a, flags: 0x0}, - 804: {region: 0x99, script: 0x22, flags: 0x0}, - 805: {region: 0x52, script: 0x5a, flags: 0x0}, - 807: {region: 0x165, script: 0x5a, flags: 0x0}, - 808: {region: 0x135, script: 0x5a, flags: 0x0}, - 809: {region: 0x165, script: 0x5a, flags: 0x0}, - 810: {region: 0x165, script: 0x5a, flags: 0x0}, - 811: {region: 0xe8, script: 0x5, flags: 0x0}, - 812: {region: 0xc3, script: 0x5a, flags: 0x0}, - 813: {region: 0x99, script: 0x22, flags: 0x0}, - 814: {region: 0x95, script: 0x5a, flags: 0x0}, - 815: {region: 0x164, script: 0x5a, flags: 0x0}, - 816: {region: 0x165, script: 0x5a, flags: 0x0}, - 817: {region: 0xc4, script: 0x75, flags: 0x0}, - 818: {region: 0x165, script: 0x5a, flags: 0x0}, - 819: {region: 0x165, script: 0x2c, flags: 0x0}, - 820: {region: 0x106, script: 0x20, flags: 0x0}, - 821: {region: 0x165, script: 0x5a, flags: 0x0}, - 822: {region: 0x131, script: 0x5a, flags: 0x0}, - 823: {region: 0x9c, script: 0x66, flags: 0x0}, - 824: {region: 0x165, script: 0x5a, flags: 0x0}, - 825: {region: 0x165, script: 0x5a, flags: 0x0}, - 826: {region: 0x9c, script: 0x5, flags: 0x0}, - 827: {region: 0x165, script: 0x5a, flags: 0x0}, - 828: {region: 0x165, script: 0x5a, flags: 0x0}, - 829: {region: 0x165, script: 0x5a, flags: 0x0}, - 830: {region: 0xdd, script: 0x5a, flags: 0x0}, - 831: {region: 0x165, script: 0x5a, flags: 0x0}, - 832: {region: 0x165, script: 0x5a, flags: 0x0}, - 834: {region: 0x165, script: 0x5a, flags: 0x0}, + 800: {region: 0xcc, script: 0x5b, flags: 0x0}, + 801: {region: 0x166, script: 0x5b, flags: 0x0}, + 802: {region: 0x166, script: 0x5b, flags: 0x0}, + 803: {region: 0x166, script: 0x5b, flags: 0x0}, + 804: {region: 0x9a, script: 0x22, flags: 0x0}, + 805: {region: 0x52, script: 0x5b, flags: 0x0}, + 807: {region: 0x166, script: 0x5b, flags: 0x0}, + 808: {region: 0x136, script: 0x5b, flags: 0x0}, + 809: {region: 0x166, script: 0x5b, flags: 0x0}, + 810: {region: 0x166, script: 0x5b, flags: 0x0}, + 811: {region: 0xe9, script: 0x5, flags: 0x0}, + 812: {region: 0xc4, script: 0x5b, flags: 0x0}, + 813: {region: 0x9a, script: 0x22, flags: 0x0}, + 814: {region: 0x96, script: 0x5b, flags: 0x0}, + 815: {region: 0x165, script: 0x5b, flags: 0x0}, + 816: {region: 0x166, script: 0x5b, flags: 0x0}, + 817: {region: 0xc5, script: 0x76, flags: 0x0}, + 818: {region: 0x166, script: 0x5b, flags: 0x0}, + 819: {region: 0x166, script: 0x2c, flags: 0x0}, + 820: {region: 0x107, script: 0x20, flags: 0x0}, + 821: {region: 0x166, script: 0x5b, flags: 0x0}, + 822: {region: 0x132, script: 0x5b, flags: 0x0}, + 823: {region: 0x9d, script: 0x67, flags: 0x0}, + 824: {region: 0x166, script: 0x5b, flags: 0x0}, + 825: {region: 0x166, script: 0x5b, flags: 0x0}, + 826: {region: 0x9d, script: 0x5, flags: 0x0}, + 827: {region: 0x166, script: 0x5b, flags: 0x0}, + 828: {region: 0x166, script: 0x5b, flags: 0x0}, + 829: {region: 0x166, script: 0x5b, flags: 0x0}, + 830: {region: 0xde, script: 0x5b, flags: 0x0}, + 831: {region: 0x166, script: 0x5b, flags: 0x0}, + 832: {region: 0x166, script: 0x5b, flags: 0x0}, + 834: {region: 0x166, script: 0x5b, flags: 0x0}, 835: {region: 0x53, script: 0x3b, flags: 0x0}, - 836: {region: 0x9e, script: 0x5a, flags: 0x0}, - 837: {region: 0xd2, script: 0x5a, flags: 0x0}, - 838: {region: 0x165, script: 0x5a, flags: 0x0}, - 839: {region: 0xda, script: 0x5a, flags: 0x0}, - 840: {region: 0x165, script: 0x5a, flags: 0x0}, - 841: {region: 0x165, script: 0x5a, flags: 0x0}, - 842: {region: 0x165, script: 0x5a, flags: 0x0}, - 843: {region: 0xcf, script: 0x5a, flags: 0x0}, - 844: {region: 0x165, script: 0x5a, flags: 0x0}, - 845: {region: 0x165, script: 0x5a, flags: 0x0}, - 846: {region: 0x164, script: 0x5a, flags: 0x0}, - 847: {region: 0xd1, script: 0x5a, flags: 0x0}, - 848: {region: 0x60, script: 0x5a, flags: 0x0}, - 849: {region: 0xdb, script: 0x22, flags: 0x0}, - 850: {region: 0x165, script: 0x5a, flags: 0x0}, - 851: {region: 0xdb, script: 0x22, flags: 0x0}, - 852: {region: 0x165, script: 0x5a, flags: 0x0}, - 853: {region: 0x165, script: 0x5a, flags: 0x0}, - 854: {region: 0xd2, script: 0x5a, flags: 0x0}, - 855: {region: 0x165, script: 0x5a, flags: 0x0}, - 856: {region: 0x165, script: 0x5a, flags: 0x0}, - 857: {region: 0xd1, script: 0x5a, flags: 0x0}, - 858: {region: 0x165, script: 0x5a, flags: 0x0}, - 859: {region: 0xcf, script: 0x5a, flags: 0x0}, - 860: {region: 0xcf, script: 0x5a, flags: 0x0}, - 861: {region: 0x165, script: 0x5a, flags: 0x0}, - 862: {region: 0x165, script: 0x5a, flags: 0x0}, - 863: {region: 0x95, script: 0x5a, flags: 0x0}, - 864: {region: 0x165, script: 0x5a, flags: 0x0}, - 865: {region: 0xdf, script: 0x5a, flags: 0x0}, - 866: {region: 0x165, script: 0x5a, flags: 0x0}, - 867: {region: 0x165, script: 0x5a, flags: 0x0}, - 868: {region: 0x99, script: 0x5a, flags: 0x0}, - 869: {region: 0x165, script: 0x5a, flags: 0x0}, - 870: {region: 0x165, script: 0x5a, flags: 0x0}, - 871: {region: 0xd9, script: 0x5a, flags: 0x0}, - 872: {region: 0x52, script: 0x5a, flags: 0x0}, - 873: {region: 0x165, script: 0x5a, flags: 0x0}, - 874: {region: 0xda, script: 0x5a, flags: 0x0}, - 875: {region: 0x165, script: 0x5a, flags: 0x0}, - 876: {region: 0x52, script: 0x5a, flags: 0x0}, - 877: {region: 0x165, script: 0x5a, flags: 0x0}, - 878: {region: 0x165, script: 0x5a, flags: 0x0}, - 879: {region: 0xda, script: 0x5a, flags: 0x0}, - 880: {region: 0x123, script: 0x56, flags: 0x0}, - 881: {region: 0x99, script: 0x22, flags: 0x0}, - 882: {region: 0x10c, script: 0xc4, flags: 0x0}, - 883: {region: 0x165, script: 0x5a, flags: 0x0}, - 884: {region: 0x165, script: 0x5a, flags: 0x0}, - 885: {region: 0x84, script: 0x7c, flags: 0x0}, - 886: {region: 0x161, script: 0x5a, flags: 0x0}, - 887: {region: 0x165, script: 0x5a, flags: 0x0}, + 836: {region: 0x9f, script: 0x5b, flags: 0x0}, + 837: {region: 0xd3, script: 0x5b, flags: 0x0}, + 838: {region: 0x166, script: 0x5b, flags: 0x0}, + 839: {region: 0xdb, script: 0x5b, flags: 0x0}, + 840: {region: 0x166, script: 0x5b, flags: 0x0}, + 841: {region: 0x166, script: 0x5b, flags: 0x0}, + 842: {region: 0x166, script: 0x5b, flags: 0x0}, + 843: {region: 0xd0, script: 0x5b, flags: 0x0}, + 844: {region: 0x166, script: 0x5b, flags: 0x0}, + 845: {region: 0x166, script: 0x5b, flags: 0x0}, + 846: {region: 0x165, script: 0x5b, flags: 0x0}, + 847: {region: 0xd2, script: 0x5b, flags: 0x0}, + 848: {region: 0x61, script: 0x5b, flags: 0x0}, + 849: {region: 0xdc, script: 0x22, flags: 0x0}, + 850: {region: 0x166, script: 0x5b, flags: 0x0}, + 851: {region: 0xdc, script: 0x22, flags: 0x0}, + 852: {region: 0x166, script: 0x5b, flags: 0x0}, + 853: {region: 0x166, script: 0x5b, flags: 0x0}, + 854: {region: 0xd3, script: 0x5b, flags: 0x0}, + 855: {region: 0x166, script: 0x5b, flags: 0x0}, + 856: {region: 0x166, script: 0x5b, flags: 0x0}, + 857: {region: 0xd2, script: 0x5b, flags: 0x0}, + 858: {region: 0x166, script: 0x5b, flags: 0x0}, + 859: {region: 0xd0, script: 0x5b, flags: 0x0}, + 860: {region: 0xd0, script: 0x5b, flags: 0x0}, + 861: {region: 0x166, script: 0x5b, flags: 0x0}, + 862: {region: 0x166, script: 0x5b, flags: 0x0}, + 863: {region: 0x96, script: 0x5b, flags: 0x0}, + 864: {region: 0x166, script: 0x5b, flags: 0x0}, + 865: {region: 0xe0, script: 0x5b, flags: 0x0}, + 866: {region: 0x166, script: 0x5b, flags: 0x0}, + 867: {region: 0x166, script: 0x5b, flags: 0x0}, + 868: {region: 0x9a, script: 0x5b, flags: 0x0}, + 869: {region: 0x166, script: 0x5b, flags: 0x0}, + 870: {region: 0x166, script: 0x5b, flags: 0x0}, + 871: {region: 0xda, script: 0x5b, flags: 0x0}, + 872: {region: 0x52, script: 0x5b, flags: 0x0}, + 873: {region: 0x166, script: 0x5b, flags: 0x0}, + 874: {region: 0xdb, script: 0x5b, flags: 0x0}, + 875: {region: 0x166, script: 0x5b, flags: 0x0}, + 876: {region: 0x52, script: 0x5b, flags: 0x0}, + 877: {region: 0x166, script: 0x5b, flags: 0x0}, + 878: {region: 0x166, script: 0x5b, flags: 0x0}, + 879: {region: 0xdb, script: 0x5b, flags: 0x0}, + 880: {region: 0x124, script: 0x57, flags: 0x0}, + 881: {region: 0x9a, script: 0x22, flags: 0x0}, + 882: {region: 0x10d, script: 0xcb, flags: 0x0}, + 883: {region: 0x166, script: 0x5b, flags: 0x0}, + 884: {region: 0x166, script: 0x5b, flags: 0x0}, + 885: {region: 0x85, script: 0x7e, flags: 0x0}, + 886: {region: 0x162, script: 0x5b, flags: 0x0}, + 887: {region: 0x166, script: 0x5b, flags: 0x0}, 888: {region: 0x49, script: 0x17, flags: 0x0}, - 889: {region: 0x165, script: 0x5a, flags: 0x0}, - 890: {region: 0x161, script: 0x5a, flags: 0x0}, - 891: {region: 0x165, script: 0x5a, flags: 0x0}, - 892: {region: 0x165, script: 0x5a, flags: 0x0}, - 893: {region: 0x165, script: 0x5a, flags: 0x0}, - 894: {region: 0x165, script: 0x5a, flags: 0x0}, - 895: {region: 0x165, script: 0x5a, flags: 0x0}, - 896: {region: 0x117, script: 0x5a, flags: 0x0}, - 897: {region: 0x165, script: 0x5a, flags: 0x0}, - 898: {region: 0x165, script: 0x5a, flags: 0x0}, - 899: {region: 0x135, script: 0x5a, flags: 0x0}, - 900: {region: 0x165, script: 0x5a, flags: 0x0}, - 901: {region: 0x53, script: 0x5a, flags: 0x0}, - 902: {region: 0x165, script: 0x5a, flags: 0x0}, - 903: {region: 0xce, script: 0x5a, flags: 0x0}, - 904: {region: 0x12f, script: 0x5a, flags: 0x0}, - 905: {region: 0x131, script: 0x5a, flags: 0x0}, - 906: {region: 0x80, script: 0x5a, flags: 0x0}, - 907: {region: 0x78, script: 0x5a, flags: 0x0}, - 908: {region: 0x165, script: 0x5a, flags: 0x0}, - 910: {region: 0x165, script: 0x5a, flags: 0x0}, - 911: {region: 0x165, script: 0x5a, flags: 0x0}, - 912: {region: 0x6f, script: 0x5a, flags: 0x0}, - 913: {region: 0x165, script: 0x5a, flags: 0x0}, - 914: {region: 0x165, script: 0x5a, flags: 0x0}, - 915: {region: 0x165, script: 0x5a, flags: 0x0}, - 916: {region: 0x165, script: 0x5a, flags: 0x0}, - 917: {region: 0x99, script: 0x81, flags: 0x0}, - 918: {region: 0x165, script: 0x5a, flags: 0x0}, - 919: {region: 0x165, script: 0x5, flags: 0x0}, - 920: {region: 0x7d, script: 0x20, flags: 0x0}, - 921: {region: 0x135, script: 0x82, flags: 0x0}, - 922: {region: 0x165, script: 0x5, flags: 0x0}, - 923: {region: 0xc5, script: 0x80, flags: 0x0}, - 924: {region: 0x165, script: 0x5a, flags: 0x0}, + 889: {region: 0x166, script: 0x5b, flags: 0x0}, + 890: {region: 0x162, script: 0x5b, flags: 0x0}, + 891: {region: 0x166, script: 0x5b, flags: 0x0}, + 892: {region: 0x166, script: 0x5b, flags: 0x0}, + 893: {region: 0x166, script: 0x5b, flags: 0x0}, + 894: {region: 0x166, script: 0x5b, flags: 0x0}, + 895: {region: 0x166, script: 0x5b, flags: 0x0}, + 896: {region: 0x118, script: 0x5b, flags: 0x0}, + 897: {region: 0x166, script: 0x5b, flags: 0x0}, + 898: {region: 0x166, script: 0x5b, flags: 0x0}, + 899: {region: 0x136, script: 0x5b, flags: 0x0}, + 900: {region: 0x166, script: 0x5b, flags: 0x0}, + 901: {region: 0x53, script: 0x5b, flags: 0x0}, + 902: {region: 0x166, script: 0x5b, flags: 0x0}, + 903: {region: 0xcf, script: 0x5b, flags: 0x0}, + 904: {region: 0x130, script: 0x5b, flags: 0x0}, + 905: {region: 0x132, script: 0x5b, flags: 0x0}, + 906: {region: 0x81, script: 0x5b, flags: 0x0}, + 907: {region: 0x79, script: 0x5b, flags: 0x0}, + 908: {region: 0x166, script: 0x5b, flags: 0x0}, + 910: {region: 0x166, script: 0x5b, flags: 0x0}, + 911: {region: 0x166, script: 0x5b, flags: 0x0}, + 912: {region: 0x70, script: 0x5b, flags: 0x0}, + 913: {region: 0x166, script: 0x5b, flags: 0x0}, + 914: {region: 0x166, script: 0x5b, flags: 0x0}, + 915: {region: 0x166, script: 0x5b, flags: 0x0}, + 916: {region: 0x166, script: 0x5b, flags: 0x0}, + 917: {region: 0x9a, script: 0x83, flags: 0x0}, + 918: {region: 0x166, script: 0x5b, flags: 0x0}, + 919: {region: 0x166, script: 0x5, flags: 0x0}, + 920: {region: 0x7e, script: 0x20, flags: 0x0}, + 921: {region: 0x136, script: 0x84, flags: 0x0}, + 922: {region: 0x166, script: 0x5, flags: 0x0}, + 923: {region: 0xc6, script: 0x82, flags: 0x0}, + 924: {region: 0x166, script: 0x5b, flags: 0x0}, 925: {region: 0x2c, script: 0x3, flags: 0x1}, - 926: {region: 0xe7, script: 0x5a, flags: 0x0}, + 926: {region: 0xe8, script: 0x5b, flags: 0x0}, 927: {region: 0x2f, script: 0x2, flags: 0x1}, - 928: {region: 0xe7, script: 0x5a, flags: 0x0}, - 929: {region: 0x30, script: 0x5a, flags: 0x0}, - 930: {region: 0xf0, script: 0x5a, flags: 0x0}, - 931: {region: 0x165, script: 0x5a, flags: 0x0}, - 932: {region: 0x78, script: 0x5a, flags: 0x0}, - 933: {region: 0xd6, script: 0x5a, flags: 0x0}, - 934: {region: 0x135, script: 0x5a, flags: 0x0}, - 935: {region: 0x49, script: 0x5a, flags: 0x0}, - 936: {region: 0x165, script: 0x5a, flags: 0x0}, - 937: {region: 0x9c, script: 0xf0, flags: 0x0}, - 938: {region: 0x165, script: 0x5a, flags: 0x0}, - 939: {region: 0x60, script: 0x5a, flags: 0x0}, - 940: {region: 0x165, script: 0x5, flags: 0x0}, - 941: {region: 0xb0, script: 0x8b, flags: 0x0}, - 943: {region: 0x165, script: 0x5a, flags: 0x0}, - 944: {region: 0x165, script: 0x5a, flags: 0x0}, - 945: {region: 0x99, script: 0x12, flags: 0x0}, - 946: {region: 0xa4, script: 0x5a, flags: 0x0}, - 947: {region: 0xe9, script: 0x5a, flags: 0x0}, - 948: {region: 0x165, script: 0x5a, flags: 0x0}, - 949: {region: 0x9e, script: 0x5a, flags: 0x0}, - 950: {region: 0x165, script: 0x5a, flags: 0x0}, - 951: {region: 0x165, script: 0x5a, flags: 0x0}, - 952: {region: 0x87, script: 0x34, flags: 0x0}, - 953: {region: 0x75, script: 0x5a, flags: 0x0}, - 954: {region: 0x165, script: 0x5a, flags: 0x0}, - 955: {region: 0xe8, script: 0x4d, flags: 0x0}, - 956: {region: 0x9c, script: 0x5, flags: 0x0}, - 957: {region: 0x1, script: 0x5a, flags: 0x0}, + 928: {region: 0xe8, script: 0x5b, flags: 0x0}, + 929: {region: 0x30, script: 0x5b, flags: 0x0}, + 930: {region: 0xf1, script: 0x5b, flags: 0x0}, + 931: {region: 0x166, script: 0x5b, flags: 0x0}, + 932: {region: 0x79, script: 0x5b, flags: 0x0}, + 933: {region: 0xd7, script: 0x5b, flags: 0x0}, + 934: {region: 0x136, script: 0x5b, flags: 0x0}, + 935: {region: 0x49, script: 0x5b, flags: 0x0}, + 936: {region: 0x166, script: 0x5b, flags: 0x0}, + 937: {region: 0x9d, script: 0xfa, flags: 0x0}, + 938: {region: 0x166, script: 0x5b, flags: 0x0}, + 939: {region: 0x61, script: 0x5b, flags: 0x0}, + 940: {region: 0x166, script: 0x5, flags: 0x0}, + 941: {region: 0xb1, script: 0x90, flags: 0x0}, + 943: {region: 0x166, script: 0x5b, flags: 0x0}, + 944: {region: 0x166, script: 0x5b, flags: 0x0}, + 945: {region: 0x9a, script: 0x12, flags: 0x0}, + 946: {region: 0xa5, script: 0x5b, flags: 0x0}, + 947: {region: 0xea, script: 0x5b, flags: 0x0}, + 948: {region: 0x166, script: 0x5b, flags: 0x0}, + 949: {region: 0x9f, script: 0x5b, flags: 0x0}, + 950: {region: 0x166, script: 0x5b, flags: 0x0}, + 951: {region: 0x166, script: 0x5b, flags: 0x0}, + 952: {region: 0x88, script: 0x34, flags: 0x0}, + 953: {region: 0x76, script: 0x5b, flags: 0x0}, + 954: {region: 0x166, script: 0x5b, flags: 0x0}, + 955: {region: 0xe9, script: 0x4e, flags: 0x0}, + 956: {region: 0x9d, script: 0x5, flags: 0x0}, + 957: {region: 0x1, script: 0x5b, flags: 0x0}, 958: {region: 0x24, script: 0x5, flags: 0x0}, - 959: {region: 0x165, script: 0x5a, flags: 0x0}, - 960: {region: 0x41, script: 0x5a, flags: 0x0}, - 961: {region: 0x165, script: 0x5a, flags: 0x0}, - 962: {region: 0x7a, script: 0x5a, flags: 0x0}, - 963: {region: 0x165, script: 0x5a, flags: 0x0}, - 964: {region: 0xe4, script: 0x5a, flags: 0x0}, - 965: {region: 0x89, script: 0x5a, flags: 0x0}, - 966: {region: 0x69, script: 0x5a, flags: 0x0}, - 967: {region: 0x165, script: 0x5a, flags: 0x0}, - 968: {region: 0x99, script: 0x22, flags: 0x0}, - 969: {region: 0x165, script: 0x5a, flags: 0x0}, - 970: {region: 0x102, script: 0x5a, flags: 0x0}, - 971: {region: 0x95, script: 0x5a, flags: 0x0}, - 972: {region: 0x165, script: 0x5a, flags: 0x0}, - 973: {region: 0x165, script: 0x5a, flags: 0x0}, - 974: {region: 0x9e, script: 0x5a, flags: 0x0}, - 975: {region: 0x165, script: 0x5, flags: 0x0}, - 976: {region: 0x99, script: 0x5a, flags: 0x0}, + 959: {region: 0x166, script: 0x5b, flags: 0x0}, + 960: {region: 0x41, script: 0x5b, flags: 0x0}, + 961: {region: 0x166, script: 0x5b, flags: 0x0}, + 962: {region: 0x7b, script: 0x5b, flags: 0x0}, + 963: {region: 0x166, script: 0x5b, flags: 0x0}, + 964: {region: 0xe5, script: 0x5b, flags: 0x0}, + 965: {region: 0x8a, script: 0x5b, flags: 0x0}, + 966: {region: 0x6a, script: 0x5b, flags: 0x0}, + 967: {region: 0x166, script: 0x5b, flags: 0x0}, + 968: {region: 0x9a, script: 0x22, flags: 0x0}, + 969: {region: 0x166, script: 0x5b, flags: 0x0}, + 970: {region: 0x103, script: 0x5b, flags: 0x0}, + 971: {region: 0x96, script: 0x5b, flags: 0x0}, + 972: {region: 0x166, script: 0x5b, flags: 0x0}, + 973: {region: 0x166, script: 0x5b, flags: 0x0}, + 974: {region: 0x9f, script: 0x5b, flags: 0x0}, + 975: {region: 0x166, script: 0x5, flags: 0x0}, + 976: {region: 0x9a, script: 0x5b, flags: 0x0}, 977: {region: 0x31, script: 0x2, flags: 0x1}, - 978: {region: 0xdb, script: 0x22, flags: 0x0}, + 978: {region: 0xdc, script: 0x22, flags: 0x0}, 979: {region: 0x35, script: 0xe, flags: 0x0}, - 980: {region: 0x4e, script: 0x5a, flags: 0x0}, - 981: {region: 0x72, script: 0x5a, flags: 0x0}, - 982: {region: 0x4e, script: 0x5a, flags: 0x0}, - 983: {region: 0x9c, script: 0x5, flags: 0x0}, - 984: {region: 0x10c, script: 0x5a, flags: 0x0}, - 985: {region: 0x3a, script: 0x5a, flags: 0x0}, - 986: {region: 0x165, script: 0x5a, flags: 0x0}, - 987: {region: 0xd1, script: 0x5a, flags: 0x0}, - 988: {region: 0x104, script: 0x5a, flags: 0x0}, - 989: {region: 0x95, script: 0x5a, flags: 0x0}, - 990: {region: 0x12f, script: 0x5a, flags: 0x0}, - 991: {region: 0x165, script: 0x5a, flags: 0x0}, - 992: {region: 0x165, script: 0x5a, flags: 0x0}, - 993: {region: 0x73, script: 0x5a, flags: 0x0}, - 994: {region: 0x106, script: 0x20, flags: 0x0}, - 995: {region: 0x130, script: 0x20, flags: 0x0}, - 996: {region: 0x109, script: 0x5a, flags: 0x0}, - 997: {region: 0x107, script: 0x5a, flags: 0x0}, - 998: {region: 0x12f, script: 0x5a, flags: 0x0}, - 999: {region: 0x165, script: 0x5a, flags: 0x0}, - 1000: {region: 0xa2, script: 0x4c, flags: 0x0}, - 1001: {region: 0x99, script: 0x22, flags: 0x0}, - 1002: {region: 0x80, script: 0x5a, flags: 0x0}, - 1003: {region: 0x106, script: 0x20, flags: 0x0}, - 1004: {region: 0xa4, script: 0x5a, flags: 0x0}, - 1005: {region: 0x95, script: 0x5a, flags: 0x0}, - 1006: {region: 0x99, script: 0x5a, flags: 0x0}, - 1007: {region: 0x114, script: 0x5a, flags: 0x0}, - 1008: {region: 0x99, script: 0xc8, flags: 0x0}, - 1009: {region: 0x165, script: 0x5a, flags: 0x0}, - 1010: {region: 0x165, script: 0x5a, flags: 0x0}, - 1011: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1012: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1013: {region: 0x99, script: 0x22, flags: 0x0}, - 1014: {region: 0x165, script: 0x5, flags: 0x0}, - 1015: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1016: {region: 0x7b, script: 0x5a, flags: 0x0}, - 1017: {region: 0x49, script: 0x5a, flags: 0x0}, + 980: {region: 0x4e, script: 0x5b, flags: 0x0}, + 981: {region: 0x73, script: 0x5b, flags: 0x0}, + 982: {region: 0x4e, script: 0x5b, flags: 0x0}, + 983: {region: 0x9d, script: 0x5, flags: 0x0}, + 984: {region: 0x10d, script: 0x5b, flags: 0x0}, + 985: {region: 0x3a, script: 0x5b, flags: 0x0}, + 986: {region: 0x166, script: 0x5b, flags: 0x0}, + 987: {region: 0xd2, script: 0x5b, flags: 0x0}, + 988: {region: 0x105, script: 0x5b, flags: 0x0}, + 989: {region: 0x96, script: 0x5b, flags: 0x0}, + 990: {region: 0x130, script: 0x5b, flags: 0x0}, + 991: {region: 0x166, script: 0x5b, flags: 0x0}, + 992: {region: 0x166, script: 0x5b, flags: 0x0}, + 993: {region: 0x74, script: 0x5b, flags: 0x0}, + 994: {region: 0x107, script: 0x20, flags: 0x0}, + 995: {region: 0x131, script: 0x20, flags: 0x0}, + 996: {region: 0x10a, script: 0x5b, flags: 0x0}, + 997: {region: 0x108, script: 0x5b, flags: 0x0}, + 998: {region: 0x130, script: 0x5b, flags: 0x0}, + 999: {region: 0x166, script: 0x5b, flags: 0x0}, + 1000: {region: 0xa3, script: 0x4c, flags: 0x0}, + 1001: {region: 0x9a, script: 0x22, flags: 0x0}, + 1002: {region: 0x81, script: 0x5b, flags: 0x0}, + 1003: {region: 0x107, script: 0x20, flags: 0x0}, + 1004: {region: 0xa5, script: 0x5b, flags: 0x0}, + 1005: {region: 0x96, script: 0x5b, flags: 0x0}, + 1006: {region: 0x9a, script: 0x5b, flags: 0x0}, + 1007: {region: 0x115, script: 0x5b, flags: 0x0}, + 1008: {region: 0x9a, script: 0xcf, flags: 0x0}, + 1009: {region: 0x166, script: 0x5b, flags: 0x0}, + 1010: {region: 0x166, script: 0x5b, flags: 0x0}, + 1011: {region: 0x130, script: 0x5b, flags: 0x0}, + 1012: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1013: {region: 0x9a, script: 0x22, flags: 0x0}, + 1014: {region: 0x166, script: 0x5, flags: 0x0}, + 1015: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1016: {region: 0x7c, script: 0x5b, flags: 0x0}, + 1017: {region: 0x49, script: 0x5b, flags: 0x0}, 1018: {region: 0x33, script: 0x4, flags: 0x1}, - 1019: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1020: {region: 0x9c, script: 0x5, flags: 0x0}, - 1021: {region: 0xda, script: 0x5a, flags: 0x0}, - 1022: {region: 0x4f, script: 0x5a, flags: 0x0}, - 1023: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1024: {region: 0xcf, script: 0x5a, flags: 0x0}, - 1025: {region: 0xc3, script: 0x5a, flags: 0x0}, - 1026: {region: 0x4c, script: 0x5a, flags: 0x0}, - 1027: {region: 0x96, script: 0x7e, flags: 0x0}, - 1028: {region: 0xb6, script: 0x5a, flags: 0x0}, - 1029: {region: 0x165, script: 0x2c, flags: 0x0}, - 1030: {region: 0x165, script: 0x5a, flags: 0x0}, - 1032: {region: 0xba, script: 0xe3, flags: 0x0}, - 1033: {region: 0x165, script: 0x5a, flags: 0x0}, - 1034: {region: 0xc4, script: 0x75, flags: 0x0}, - 1035: {region: 0x165, script: 0x5, flags: 0x0}, - 1036: {region: 0xb3, script: 0xcf, flags: 0x0}, - 1037: {region: 0x6f, script: 0x5a, flags: 0x0}, - 1038: {region: 0x165, script: 0x5a, flags: 0x0}, - 1039: {region: 0x165, script: 0x5a, flags: 0x0}, - 1040: {region: 0x165, script: 0x5a, flags: 0x0}, - 1041: {region: 0x165, script: 0x5a, flags: 0x0}, - 1042: {region: 0x111, script: 0x5a, flags: 0x0}, - 1043: {region: 0x165, script: 0x5a, flags: 0x0}, - 1044: {region: 0xe8, script: 0x5, flags: 0x0}, - 1045: {region: 0x165, script: 0x5a, flags: 0x0}, - 1046: {region: 0x10f, script: 0x5a, flags: 0x0}, - 1047: {region: 0x165, script: 0x5a, flags: 0x0}, - 1048: {region: 0xe9, script: 0x5a, flags: 0x0}, - 1049: {region: 0x165, script: 0x5a, flags: 0x0}, - 1050: {region: 0x95, script: 0x5a, flags: 0x0}, - 1051: {region: 0x142, script: 0x5a, flags: 0x0}, - 1052: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1054: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1055: {region: 0x72, script: 0x5a, flags: 0x0}, - 1056: {region: 0x97, script: 0xc5, flags: 0x0}, - 1057: {region: 0x165, script: 0x5a, flags: 0x0}, - 1058: {region: 0x72, script: 0x5a, flags: 0x0}, - 1059: {region: 0x164, script: 0x5a, flags: 0x0}, - 1060: {region: 0x165, script: 0x5a, flags: 0x0}, - 1061: {region: 0xc3, script: 0x5a, flags: 0x0}, - 1062: {region: 0x165, script: 0x5a, flags: 0x0}, - 1063: {region: 0x165, script: 0x5a, flags: 0x0}, - 1064: {region: 0x165, script: 0x5a, flags: 0x0}, - 1065: {region: 0x115, script: 0x5a, flags: 0x0}, - 1066: {region: 0x165, script: 0x5a, flags: 0x0}, - 1067: {region: 0x165, script: 0x5a, flags: 0x0}, - 1068: {region: 0x123, script: 0xe6, flags: 0x0}, - 1069: {region: 0x165, script: 0x5a, flags: 0x0}, - 1070: {region: 0x165, script: 0x5a, flags: 0x0}, - 1071: {region: 0x165, script: 0x5a, flags: 0x0}, - 1072: {region: 0x165, script: 0x5a, flags: 0x0}, - 1073: {region: 0x27, script: 0x5a, flags: 0x0}, + 1019: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1020: {region: 0x9d, script: 0x5, flags: 0x0}, + 1021: {region: 0xdb, script: 0x5b, flags: 0x0}, + 1022: {region: 0x4f, script: 0x5b, flags: 0x0}, + 1023: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1024: {region: 0xd0, script: 0x5b, flags: 0x0}, + 1025: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1026: {region: 0x4c, script: 0x5b, flags: 0x0}, + 1027: {region: 0x97, script: 0x80, flags: 0x0}, + 1028: {region: 0xb7, script: 0x5b, flags: 0x0}, + 1029: {region: 0x166, script: 0x2c, flags: 0x0}, + 1030: {region: 0x166, script: 0x5b, flags: 0x0}, + 1032: {region: 0xbb, script: 0xeb, flags: 0x0}, + 1033: {region: 0x166, script: 0x5b, flags: 0x0}, + 1034: {region: 0xc5, script: 0x76, flags: 0x0}, + 1035: {region: 0x166, script: 0x5, flags: 0x0}, + 1036: {region: 0xb4, script: 0xd6, flags: 0x0}, + 1037: {region: 0x70, script: 0x5b, flags: 0x0}, + 1038: {region: 0x166, script: 0x5b, flags: 0x0}, + 1039: {region: 0x166, script: 0x5b, flags: 0x0}, + 1040: {region: 0x166, script: 0x5b, flags: 0x0}, + 1041: {region: 0x166, script: 0x5b, flags: 0x0}, + 1042: {region: 0x112, script: 0x5b, flags: 0x0}, + 1043: {region: 0x166, script: 0x5b, flags: 0x0}, + 1044: {region: 0xe9, script: 0x5, flags: 0x0}, + 1045: {region: 0x166, script: 0x5b, flags: 0x0}, + 1046: {region: 0x110, script: 0x5b, flags: 0x0}, + 1047: {region: 0x166, script: 0x5b, flags: 0x0}, + 1048: {region: 0xea, script: 0x5b, flags: 0x0}, + 1049: {region: 0x166, script: 0x5b, flags: 0x0}, + 1050: {region: 0x96, script: 0x5b, flags: 0x0}, + 1051: {region: 0x143, script: 0x5b, flags: 0x0}, + 1052: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1054: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1055: {region: 0x73, script: 0x5b, flags: 0x0}, + 1056: {region: 0x98, script: 0xcc, flags: 0x0}, + 1057: {region: 0x166, script: 0x5b, flags: 0x0}, + 1058: {region: 0x73, script: 0x5b, flags: 0x0}, + 1059: {region: 0x165, script: 0x5b, flags: 0x0}, + 1060: {region: 0x166, script: 0x5b, flags: 0x0}, + 1061: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1062: {region: 0x166, script: 0x5b, flags: 0x0}, + 1063: {region: 0x166, script: 0x5b, flags: 0x0}, + 1064: {region: 0x166, script: 0x5b, flags: 0x0}, + 1065: {region: 0x116, script: 0x5b, flags: 0x0}, + 1066: {region: 0x166, script: 0x5b, flags: 0x0}, + 1067: {region: 0x166, script: 0x5b, flags: 0x0}, + 1068: {region: 0x124, script: 0xee, flags: 0x0}, + 1069: {region: 0x166, script: 0x5b, flags: 0x0}, + 1070: {region: 0x166, script: 0x5b, flags: 0x0}, + 1071: {region: 0x166, script: 0x5b, flags: 0x0}, + 1072: {region: 0x166, script: 0x5b, flags: 0x0}, + 1073: {region: 0x27, script: 0x5b, flags: 0x0}, 1074: {region: 0x37, script: 0x5, flags: 0x1}, - 1075: {region: 0x99, script: 0xd2, flags: 0x0}, - 1076: {region: 0x116, script: 0x5a, flags: 0x0}, - 1077: {region: 0x114, script: 0x5a, flags: 0x0}, - 1078: {region: 0x99, script: 0x22, flags: 0x0}, - 1079: {region: 0x161, script: 0x5a, flags: 0x0}, - 1080: {region: 0x165, script: 0x5a, flags: 0x0}, - 1081: {region: 0x165, script: 0x5a, flags: 0x0}, - 1082: {region: 0x6d, script: 0x5a, flags: 0x0}, - 1083: {region: 0x161, script: 0x5a, flags: 0x0}, - 1084: {region: 0x165, script: 0x5a, flags: 0x0}, - 1085: {region: 0x60, script: 0x5a, flags: 0x0}, - 1086: {region: 0x95, script: 0x5a, flags: 0x0}, - 1087: {region: 0x165, script: 0x5a, flags: 0x0}, - 1088: {region: 0x165, script: 0x5a, flags: 0x0}, - 1089: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1090: {region: 0x165, script: 0x5a, flags: 0x0}, - 1091: {region: 0x84, script: 0x5a, flags: 0x0}, - 1092: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1093: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1094: {region: 0x15f, script: 0x5, flags: 0x0}, - 1095: {region: 0x4b, script: 0x5a, flags: 0x0}, - 1096: {region: 0x60, script: 0x5a, flags: 0x0}, - 1097: {region: 0x165, script: 0x5a, flags: 0x0}, - 1098: {region: 0x99, script: 0x22, flags: 0x0}, - 1099: {region: 0x95, script: 0x5a, flags: 0x0}, - 1100: {region: 0x165, script: 0x5a, flags: 0x0}, + 1075: {region: 0x9a, script: 0xd9, flags: 0x0}, + 1076: {region: 0x117, script: 0x5b, flags: 0x0}, + 1077: {region: 0x115, script: 0x5b, flags: 0x0}, + 1078: {region: 0x9a, script: 0x22, flags: 0x0}, + 1079: {region: 0x162, script: 0x5b, flags: 0x0}, + 1080: {region: 0x166, script: 0x5b, flags: 0x0}, + 1081: {region: 0x166, script: 0x5b, flags: 0x0}, + 1082: {region: 0x6e, script: 0x5b, flags: 0x0}, + 1083: {region: 0x162, script: 0x5b, flags: 0x0}, + 1084: {region: 0x166, script: 0x5b, flags: 0x0}, + 1085: {region: 0x61, script: 0x5b, flags: 0x0}, + 1086: {region: 0x96, script: 0x5b, flags: 0x0}, + 1087: {region: 0x166, script: 0x5b, flags: 0x0}, + 1088: {region: 0x166, script: 0x5b, flags: 0x0}, + 1089: {region: 0x130, script: 0x5b, flags: 0x0}, + 1090: {region: 0x166, script: 0x5b, flags: 0x0}, + 1091: {region: 0x85, script: 0x5b, flags: 0x0}, + 1092: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1093: {region: 0x130, script: 0x5b, flags: 0x0}, + 1094: {region: 0x160, script: 0x5, flags: 0x0}, + 1095: {region: 0x4b, script: 0x5b, flags: 0x0}, + 1096: {region: 0x61, script: 0x5b, flags: 0x0}, + 1097: {region: 0x166, script: 0x5b, flags: 0x0}, + 1098: {region: 0x9a, script: 0x22, flags: 0x0}, + 1099: {region: 0x96, script: 0x5b, flags: 0x0}, + 1100: {region: 0x166, script: 0x5b, flags: 0x0}, 1101: {region: 0x35, script: 0xe, flags: 0x0}, - 1102: {region: 0x9b, script: 0xd6, flags: 0x0}, - 1103: {region: 0xe9, script: 0x5a, flags: 0x0}, - 1104: {region: 0x99, script: 0xde, flags: 0x0}, - 1105: {region: 0xdb, script: 0x22, flags: 0x0}, - 1106: {region: 0x165, script: 0x5a, flags: 0x0}, - 1107: {region: 0x165, script: 0x5a, flags: 0x0}, - 1108: {region: 0x165, script: 0x5a, flags: 0x0}, - 1109: {region: 0x165, script: 0x5a, flags: 0x0}, - 1110: {region: 0x165, script: 0x5a, flags: 0x0}, - 1111: {region: 0x165, script: 0x5a, flags: 0x0}, - 1112: {region: 0x165, script: 0x5a, flags: 0x0}, - 1113: {region: 0x165, script: 0x5a, flags: 0x0}, - 1114: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1115: {region: 0x165, script: 0x5a, flags: 0x0}, - 1116: {region: 0x165, script: 0x5a, flags: 0x0}, - 1117: {region: 0x99, script: 0x52, flags: 0x0}, - 1118: {region: 0x53, script: 0xdc, flags: 0x0}, - 1119: {region: 0xdb, script: 0x22, flags: 0x0}, - 1120: {region: 0xdb, script: 0x22, flags: 0x0}, - 1121: {region: 0x99, script: 0xe1, flags: 0x0}, - 1122: {region: 0x165, script: 0x5a, flags: 0x0}, - 1123: {region: 0x112, script: 0x5a, flags: 0x0}, - 1124: {region: 0x131, script: 0x5a, flags: 0x0}, - 1125: {region: 0x126, script: 0x5a, flags: 0x0}, - 1126: {region: 0x165, script: 0x5a, flags: 0x0}, + 1102: {region: 0x9c, script: 0xde, flags: 0x0}, + 1103: {region: 0xea, script: 0x5b, flags: 0x0}, + 1104: {region: 0x9a, script: 0xe6, flags: 0x0}, + 1105: {region: 0xdc, script: 0x22, flags: 0x0}, + 1106: {region: 0x166, script: 0x5b, flags: 0x0}, + 1107: {region: 0x166, script: 0x5b, flags: 0x0}, + 1108: {region: 0x166, script: 0x5b, flags: 0x0}, + 1109: {region: 0x166, script: 0x5b, flags: 0x0}, + 1110: {region: 0x166, script: 0x5b, flags: 0x0}, + 1111: {region: 0x166, script: 0x5b, flags: 0x0}, + 1112: {region: 0x166, script: 0x5b, flags: 0x0}, + 1113: {region: 0x166, script: 0x5b, flags: 0x0}, + 1114: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1115: {region: 0x166, script: 0x5b, flags: 0x0}, + 1116: {region: 0x166, script: 0x5b, flags: 0x0}, + 1117: {region: 0x9a, script: 0x53, flags: 0x0}, + 1118: {region: 0x53, script: 0xe4, flags: 0x0}, + 1119: {region: 0xdc, script: 0x22, flags: 0x0}, + 1120: {region: 0xdc, script: 0x22, flags: 0x0}, + 1121: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1122: {region: 0x166, script: 0x5b, flags: 0x0}, + 1123: {region: 0x113, script: 0x5b, flags: 0x0}, + 1124: {region: 0x132, script: 0x5b, flags: 0x0}, + 1125: {region: 0x127, script: 0x5b, flags: 0x0}, + 1126: {region: 0x166, script: 0x5b, flags: 0x0}, 1127: {region: 0x3c, script: 0x3, flags: 0x1}, - 1128: {region: 0x165, script: 0x5a, flags: 0x0}, - 1129: {region: 0x165, script: 0x5a, flags: 0x0}, - 1130: {region: 0x165, script: 0x5a, flags: 0x0}, - 1131: {region: 0x123, script: 0xe6, flags: 0x0}, - 1132: {region: 0xdb, script: 0x22, flags: 0x0}, - 1133: {region: 0xdb, script: 0x22, flags: 0x0}, - 1134: {region: 0xdb, script: 0x22, flags: 0x0}, - 1135: {region: 0x6f, script: 0x2c, flags: 0x0}, - 1136: {region: 0x165, script: 0x5a, flags: 0x0}, - 1137: {region: 0x6d, script: 0x2c, flags: 0x0}, - 1138: {region: 0x165, script: 0x5a, flags: 0x0}, - 1139: {region: 0x165, script: 0x5a, flags: 0x0}, - 1140: {region: 0x165, script: 0x5a, flags: 0x0}, - 1141: {region: 0xd6, script: 0x5a, flags: 0x0}, - 1142: {region: 0x127, script: 0x5a, flags: 0x0}, - 1143: {region: 0x125, script: 0x5a, flags: 0x0}, - 1144: {region: 0x32, script: 0x5a, flags: 0x0}, - 1145: {region: 0xdb, script: 0x22, flags: 0x0}, - 1146: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1147: {region: 0x165, script: 0x5a, flags: 0x0}, - 1148: {region: 0x165, script: 0x5a, flags: 0x0}, - 1149: {region: 0x32, script: 0x5a, flags: 0x0}, - 1150: {region: 0xd4, script: 0x5a, flags: 0x0}, - 1151: {region: 0x165, script: 0x5a, flags: 0x0}, - 1152: {region: 0x161, script: 0x5a, flags: 0x0}, - 1153: {region: 0x165, script: 0x5a, flags: 0x0}, - 1154: {region: 0x129, script: 0x5a, flags: 0x0}, - 1155: {region: 0x165, script: 0x5a, flags: 0x0}, - 1156: {region: 0xce, script: 0x5a, flags: 0x0}, - 1157: {region: 0x165, script: 0x5a, flags: 0x0}, - 1158: {region: 0xe6, script: 0x5a, flags: 0x0}, - 1159: {region: 0x165, script: 0x5a, flags: 0x0}, - 1160: {region: 0x165, script: 0x5a, flags: 0x0}, - 1161: {region: 0x165, script: 0x5a, flags: 0x0}, - 1162: {region: 0x12b, script: 0x5a, flags: 0x0}, - 1163: {region: 0x12b, script: 0x5a, flags: 0x0}, - 1164: {region: 0x12e, script: 0x5a, flags: 0x0}, - 1165: {region: 0x165, script: 0x5, flags: 0x0}, - 1166: {region: 0x161, script: 0x5a, flags: 0x0}, - 1167: {region: 0x87, script: 0x34, flags: 0x0}, - 1168: {region: 0xdb, script: 0x22, flags: 0x0}, - 1169: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1170: {region: 0x43, script: 0xe7, flags: 0x0}, - 1171: {region: 0x165, script: 0x5a, flags: 0x0}, - 1172: {region: 0x106, script: 0x20, flags: 0x0}, - 1173: {region: 0x165, script: 0x5a, flags: 0x0}, - 1174: {region: 0x165, script: 0x5a, flags: 0x0}, - 1175: {region: 0x131, script: 0x5a, flags: 0x0}, - 1176: {region: 0x165, script: 0x5a, flags: 0x0}, - 1177: {region: 0x123, script: 0xe6, flags: 0x0}, - 1178: {region: 0x32, script: 0x5a, flags: 0x0}, - 1179: {region: 0x165, script: 0x5a, flags: 0x0}, - 1180: {region: 0x165, script: 0x5a, flags: 0x0}, - 1181: {region: 0xce, script: 0x5a, flags: 0x0}, - 1182: {region: 0x165, script: 0x5a, flags: 0x0}, - 1183: {region: 0x165, script: 0x5a, flags: 0x0}, - 1184: {region: 0x12d, script: 0x5a, flags: 0x0}, - 1185: {region: 0x165, script: 0x5a, flags: 0x0}, - 1187: {region: 0x165, script: 0x5a, flags: 0x0}, - 1188: {region: 0xd4, script: 0x5a, flags: 0x0}, - 1189: {region: 0x53, script: 0xdf, flags: 0x0}, - 1190: {region: 0xe5, script: 0x5a, flags: 0x0}, - 1191: {region: 0x165, script: 0x5a, flags: 0x0}, - 1192: {region: 0x106, script: 0x20, flags: 0x0}, - 1193: {region: 0xba, script: 0x5a, flags: 0x0}, - 1194: {region: 0x165, script: 0x5a, flags: 0x0}, - 1195: {region: 0x106, script: 0x20, flags: 0x0}, + 1128: {region: 0x166, script: 0x5b, flags: 0x0}, + 1129: {region: 0x166, script: 0x5b, flags: 0x0}, + 1130: {region: 0x166, script: 0x5b, flags: 0x0}, + 1131: {region: 0x124, script: 0xee, flags: 0x0}, + 1132: {region: 0xdc, script: 0x22, flags: 0x0}, + 1133: {region: 0xdc, script: 0x22, flags: 0x0}, + 1134: {region: 0xdc, script: 0x22, flags: 0x0}, + 1135: {region: 0x70, script: 0x2c, flags: 0x0}, + 1136: {region: 0x166, script: 0x5b, flags: 0x0}, + 1137: {region: 0x6e, script: 0x2c, flags: 0x0}, + 1138: {region: 0x166, script: 0x5b, flags: 0x0}, + 1139: {region: 0x166, script: 0x5b, flags: 0x0}, + 1140: {region: 0x166, script: 0x5b, flags: 0x0}, + 1141: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1142: {region: 0x128, script: 0x5b, flags: 0x0}, + 1143: {region: 0x126, script: 0x5b, flags: 0x0}, + 1144: {region: 0x32, script: 0x5b, flags: 0x0}, + 1145: {region: 0xdc, script: 0x22, flags: 0x0}, + 1146: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1147: {region: 0x166, script: 0x5b, flags: 0x0}, + 1148: {region: 0x166, script: 0x5b, flags: 0x0}, + 1149: {region: 0x32, script: 0x5b, flags: 0x0}, + 1150: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1151: {region: 0x166, script: 0x5b, flags: 0x0}, + 1152: {region: 0x162, script: 0x5b, flags: 0x0}, + 1153: {region: 0x166, script: 0x5b, flags: 0x0}, + 1154: {region: 0x12a, script: 0x5b, flags: 0x0}, + 1155: {region: 0x166, script: 0x5b, flags: 0x0}, + 1156: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1157: {region: 0x166, script: 0x5b, flags: 0x0}, + 1158: {region: 0xe7, script: 0x5b, flags: 0x0}, + 1159: {region: 0x166, script: 0x5b, flags: 0x0}, + 1160: {region: 0x166, script: 0x5b, flags: 0x0}, + 1161: {region: 0x166, script: 0x5b, flags: 0x0}, + 1162: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1163: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1164: {region: 0x12f, script: 0x5b, flags: 0x0}, + 1165: {region: 0x166, script: 0x5, flags: 0x0}, + 1166: {region: 0x162, script: 0x5b, flags: 0x0}, + 1167: {region: 0x88, script: 0x34, flags: 0x0}, + 1168: {region: 0xdc, script: 0x22, flags: 0x0}, + 1169: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1170: {region: 0x43, script: 0xef, flags: 0x0}, + 1171: {region: 0x166, script: 0x5b, flags: 0x0}, + 1172: {region: 0x107, script: 0x20, flags: 0x0}, + 1173: {region: 0x166, script: 0x5b, flags: 0x0}, + 1174: {region: 0x166, script: 0x5b, flags: 0x0}, + 1175: {region: 0x132, script: 0x5b, flags: 0x0}, + 1176: {region: 0x166, script: 0x5b, flags: 0x0}, + 1177: {region: 0x124, script: 0xee, flags: 0x0}, + 1178: {region: 0x32, script: 0x5b, flags: 0x0}, + 1179: {region: 0x166, script: 0x5b, flags: 0x0}, + 1180: {region: 0x166, script: 0x5b, flags: 0x0}, + 1181: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1182: {region: 0x166, script: 0x5b, flags: 0x0}, + 1183: {region: 0x166, script: 0x5b, flags: 0x0}, + 1184: {region: 0x12e, script: 0x5b, flags: 0x0}, + 1185: {region: 0x166, script: 0x5b, flags: 0x0}, + 1187: {region: 0x166, script: 0x5b, flags: 0x0}, + 1188: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1189: {region: 0x53, script: 0xe7, flags: 0x0}, + 1190: {region: 0xe6, script: 0x5b, flags: 0x0}, + 1191: {region: 0x166, script: 0x5b, flags: 0x0}, + 1192: {region: 0x107, script: 0x20, flags: 0x0}, + 1193: {region: 0xbb, script: 0x5b, flags: 0x0}, + 1194: {region: 0x166, script: 0x5b, flags: 0x0}, + 1195: {region: 0x107, script: 0x20, flags: 0x0}, 1196: {region: 0x3f, script: 0x4, flags: 0x1}, - 1197: {region: 0x11c, script: 0xea, flags: 0x0}, - 1198: {region: 0x130, script: 0x20, flags: 0x0}, - 1199: {region: 0x75, script: 0x5a, flags: 0x0}, - 1200: {region: 0x2a, script: 0x5a, flags: 0x0}, + 1197: {region: 0x11d, script: 0xf3, flags: 0x0}, + 1198: {region: 0x131, script: 0x20, flags: 0x0}, + 1199: {region: 0x76, script: 0x5b, flags: 0x0}, + 1200: {region: 0x2a, script: 0x5b, flags: 0x0}, 1202: {region: 0x43, script: 0x3, flags: 0x1}, - 1203: {region: 0x99, script: 0xe, flags: 0x0}, - 1204: {region: 0xe8, script: 0x5, flags: 0x0}, - 1205: {region: 0x165, script: 0x5a, flags: 0x0}, - 1206: {region: 0x165, script: 0x5a, flags: 0x0}, - 1207: {region: 0x165, script: 0x5a, flags: 0x0}, - 1208: {region: 0x165, script: 0x5a, flags: 0x0}, - 1209: {region: 0x165, script: 0x5a, flags: 0x0}, - 1210: {region: 0x165, script: 0x5a, flags: 0x0}, - 1211: {region: 0x165, script: 0x5a, flags: 0x0}, + 1203: {region: 0x9a, script: 0xe, flags: 0x0}, + 1204: {region: 0xe9, script: 0x5, flags: 0x0}, + 1205: {region: 0x166, script: 0x5b, flags: 0x0}, + 1206: {region: 0x166, script: 0x5b, flags: 0x0}, + 1207: {region: 0x166, script: 0x5b, flags: 0x0}, + 1208: {region: 0x166, script: 0x5b, flags: 0x0}, + 1209: {region: 0x166, script: 0x5b, flags: 0x0}, + 1210: {region: 0x166, script: 0x5b, flags: 0x0}, + 1211: {region: 0x166, script: 0x5b, flags: 0x0}, 1212: {region: 0x46, script: 0x4, flags: 0x1}, - 1213: {region: 0x165, script: 0x5a, flags: 0x0}, - 1214: {region: 0xb4, script: 0xeb, flags: 0x0}, - 1215: {region: 0x165, script: 0x5a, flags: 0x0}, - 1216: {region: 0x161, script: 0x5a, flags: 0x0}, - 1217: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1218: {region: 0x106, script: 0x5a, flags: 0x0}, - 1219: {region: 0x13e, script: 0x5a, flags: 0x0}, - 1220: {region: 0x11b, script: 0x5a, flags: 0x0}, - 1221: {region: 0x165, script: 0x5a, flags: 0x0}, - 1222: {region: 0x36, script: 0x5a, flags: 0x0}, - 1223: {region: 0x60, script: 0x5a, flags: 0x0}, - 1224: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1225: {region: 0x1, script: 0x5a, flags: 0x0}, - 1226: {region: 0x106, script: 0x5a, flags: 0x0}, - 1227: {region: 0x6a, script: 0x5a, flags: 0x0}, - 1228: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1229: {region: 0x165, script: 0x5a, flags: 0x0}, - 1230: {region: 0x36, script: 0x5a, flags: 0x0}, - 1231: {region: 0x4e, script: 0x5a, flags: 0x0}, - 1232: {region: 0x165, script: 0x5a, flags: 0x0}, - 1233: {region: 0x6f, script: 0x2c, flags: 0x0}, - 1234: {region: 0x165, script: 0x5a, flags: 0x0}, - 1235: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1236: {region: 0x2f, script: 0x5a, flags: 0x0}, - 1237: {region: 0x99, script: 0xe1, flags: 0x0}, - 1238: {region: 0x99, script: 0x22, flags: 0x0}, - 1239: {region: 0x165, script: 0x5a, flags: 0x0}, - 1240: {region: 0x165, script: 0x5a, flags: 0x0}, - 1241: {region: 0x165, script: 0x5a, flags: 0x0}, - 1242: {region: 0x165, script: 0x5a, flags: 0x0}, - 1243: {region: 0x165, script: 0x5a, flags: 0x0}, - 1244: {region: 0x165, script: 0x5a, flags: 0x0}, - 1245: {region: 0x165, script: 0x5a, flags: 0x0}, - 1246: {region: 0x165, script: 0x5a, flags: 0x0}, - 1247: {region: 0x165, script: 0x5a, flags: 0x0}, - 1248: {region: 0x140, script: 0x5a, flags: 0x0}, - 1249: {region: 0x165, script: 0x5a, flags: 0x0}, - 1250: {region: 0x165, script: 0x5a, flags: 0x0}, - 1251: {region: 0xa8, script: 0x5, flags: 0x0}, - 1252: {region: 0x165, script: 0x5a, flags: 0x0}, - 1253: {region: 0x114, script: 0x5a, flags: 0x0}, - 1254: {region: 0x165, script: 0x5a, flags: 0x0}, - 1255: {region: 0x165, script: 0x5a, flags: 0x0}, - 1256: {region: 0x165, script: 0x5a, flags: 0x0}, - 1257: {region: 0x165, script: 0x5a, flags: 0x0}, - 1258: {region: 0x99, script: 0x22, flags: 0x0}, + 1213: {region: 0x166, script: 0x5b, flags: 0x0}, + 1214: {region: 0xb5, script: 0xf4, flags: 0x0}, + 1215: {region: 0x166, script: 0x5b, flags: 0x0}, + 1216: {region: 0x162, script: 0x5b, flags: 0x0}, + 1217: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1218: {region: 0x107, script: 0x5b, flags: 0x0}, + 1219: {region: 0x13f, script: 0x5b, flags: 0x0}, + 1220: {region: 0x11c, script: 0x5b, flags: 0x0}, + 1221: {region: 0x166, script: 0x5b, flags: 0x0}, + 1222: {region: 0x36, script: 0x5b, flags: 0x0}, + 1223: {region: 0x61, script: 0x5b, flags: 0x0}, + 1224: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1225: {region: 0x1, script: 0x5b, flags: 0x0}, + 1226: {region: 0x107, script: 0x5b, flags: 0x0}, + 1227: {region: 0x6b, script: 0x5b, flags: 0x0}, + 1228: {region: 0x130, script: 0x5b, flags: 0x0}, + 1229: {region: 0x166, script: 0x5b, flags: 0x0}, + 1230: {region: 0x36, script: 0x5b, flags: 0x0}, + 1231: {region: 0x4e, script: 0x5b, flags: 0x0}, + 1232: {region: 0x166, script: 0x5b, flags: 0x0}, + 1233: {region: 0x70, script: 0x2c, flags: 0x0}, + 1234: {region: 0x166, script: 0x5b, flags: 0x0}, + 1235: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1236: {region: 0x2f, script: 0x5b, flags: 0x0}, + 1237: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1238: {region: 0x9a, script: 0x22, flags: 0x0}, + 1239: {region: 0x166, script: 0x5b, flags: 0x0}, + 1240: {region: 0x166, script: 0x5b, flags: 0x0}, + 1241: {region: 0x166, script: 0x5b, flags: 0x0}, + 1242: {region: 0x166, script: 0x5b, flags: 0x0}, + 1243: {region: 0x166, script: 0x5b, flags: 0x0}, + 1244: {region: 0x166, script: 0x5b, flags: 0x0}, + 1245: {region: 0x166, script: 0x5b, flags: 0x0}, + 1246: {region: 0x166, script: 0x5b, flags: 0x0}, + 1247: {region: 0x166, script: 0x5b, flags: 0x0}, + 1248: {region: 0x141, script: 0x5b, flags: 0x0}, + 1249: {region: 0x166, script: 0x5b, flags: 0x0}, + 1250: {region: 0x166, script: 0x5b, flags: 0x0}, + 1251: {region: 0xa9, script: 0x5, flags: 0x0}, + 1252: {region: 0x166, script: 0x5b, flags: 0x0}, + 1253: {region: 0x115, script: 0x5b, flags: 0x0}, + 1254: {region: 0x166, script: 0x5b, flags: 0x0}, + 1255: {region: 0x166, script: 0x5b, flags: 0x0}, + 1256: {region: 0x166, script: 0x5b, flags: 0x0}, + 1257: {region: 0x166, script: 0x5b, flags: 0x0}, + 1258: {region: 0x9a, script: 0x22, flags: 0x0}, 1259: {region: 0x53, script: 0x3b, flags: 0x0}, - 1260: {region: 0x165, script: 0x5a, flags: 0x0}, - 1261: {region: 0x165, script: 0x5a, flags: 0x0}, - 1262: {region: 0x41, script: 0x5a, flags: 0x0}, - 1263: {region: 0x165, script: 0x5a, flags: 0x0}, - 1264: {region: 0x12b, script: 0x18, flags: 0x0}, - 1265: {region: 0x165, script: 0x5a, flags: 0x0}, - 1266: {region: 0x161, script: 0x5a, flags: 0x0}, - 1267: {region: 0x165, script: 0x5a, flags: 0x0}, - 1268: {region: 0x12b, script: 0x62, flags: 0x0}, - 1269: {region: 0x12b, script: 0x63, flags: 0x0}, - 1270: {region: 0x7d, script: 0x2e, flags: 0x0}, - 1271: {region: 0x53, script: 0x67, flags: 0x0}, - 1272: {region: 0x10b, script: 0x6c, flags: 0x0}, - 1273: {region: 0x108, script: 0x77, flags: 0x0}, - 1274: {region: 0x99, script: 0x22, flags: 0x0}, - 1275: {region: 0x131, script: 0x5a, flags: 0x0}, - 1276: {region: 0x165, script: 0x5a, flags: 0x0}, - 1277: {region: 0x9c, script: 0x8e, flags: 0x0}, - 1278: {region: 0x165, script: 0x5a, flags: 0x0}, - 1279: {region: 0x15e, script: 0xc7, flags: 0x0}, - 1280: {region: 0x165, script: 0x5a, flags: 0x0}, - 1281: {region: 0x165, script: 0x5a, flags: 0x0}, - 1282: {region: 0xdb, script: 0x22, flags: 0x0}, - 1283: {region: 0x165, script: 0x5a, flags: 0x0}, - 1284: {region: 0x165, script: 0x5a, flags: 0x0}, - 1285: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1286: {region: 0x75, script: 0x5a, flags: 0x0}, - 1287: {region: 0x165, script: 0x5a, flags: 0x0}, - 1288: {region: 0x165, script: 0x5a, flags: 0x0}, - 1289: {region: 0x52, script: 0x5a, flags: 0x0}, - 1290: {region: 0x165, script: 0x5a, flags: 0x0}, - 1291: {region: 0x165, script: 0x5a, flags: 0x0}, - 1292: {region: 0x165, script: 0x5a, flags: 0x0}, - 1293: {region: 0x52, script: 0x5a, flags: 0x0}, - 1294: {region: 0x165, script: 0x5a, flags: 0x0}, - 1295: {region: 0x165, script: 0x5a, flags: 0x0}, - 1296: {region: 0x165, script: 0x5a, flags: 0x0}, - 1297: {region: 0x165, script: 0x5a, flags: 0x0}, + 1260: {region: 0x166, script: 0x5b, flags: 0x0}, + 1261: {region: 0x166, script: 0x5b, flags: 0x0}, + 1262: {region: 0x41, script: 0x5b, flags: 0x0}, + 1263: {region: 0x166, script: 0x5b, flags: 0x0}, + 1264: {region: 0x12c, script: 0x18, flags: 0x0}, + 1265: {region: 0x166, script: 0x5b, flags: 0x0}, + 1266: {region: 0x162, script: 0x5b, flags: 0x0}, + 1267: {region: 0x166, script: 0x5b, flags: 0x0}, + 1268: {region: 0x12c, script: 0x63, flags: 0x0}, + 1269: {region: 0x12c, script: 0x64, flags: 0x0}, + 1270: {region: 0x7e, script: 0x2e, flags: 0x0}, + 1271: {region: 0x53, script: 0x68, flags: 0x0}, + 1272: {region: 0x10c, script: 0x6d, flags: 0x0}, + 1273: {region: 0x109, script: 0x79, flags: 0x0}, + 1274: {region: 0x9a, script: 0x22, flags: 0x0}, + 1275: {region: 0x132, script: 0x5b, flags: 0x0}, + 1276: {region: 0x166, script: 0x5b, flags: 0x0}, + 1277: {region: 0x9d, script: 0x93, flags: 0x0}, + 1278: {region: 0x166, script: 0x5b, flags: 0x0}, + 1279: {region: 0x15f, script: 0xce, flags: 0x0}, + 1280: {region: 0x166, script: 0x5b, flags: 0x0}, + 1281: {region: 0x166, script: 0x5b, flags: 0x0}, + 1282: {region: 0xdc, script: 0x22, flags: 0x0}, + 1283: {region: 0x166, script: 0x5b, flags: 0x0}, + 1284: {region: 0x166, script: 0x5b, flags: 0x0}, + 1285: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1286: {region: 0x76, script: 0x5b, flags: 0x0}, + 1287: {region: 0x166, script: 0x5b, flags: 0x0}, + 1288: {region: 0x166, script: 0x5b, flags: 0x0}, + 1289: {region: 0x52, script: 0x5b, flags: 0x0}, + 1290: {region: 0x166, script: 0x5b, flags: 0x0}, + 1291: {region: 0x166, script: 0x5b, flags: 0x0}, + 1292: {region: 0x166, script: 0x5b, flags: 0x0}, + 1293: {region: 0x52, script: 0x5b, flags: 0x0}, + 1294: {region: 0x166, script: 0x5b, flags: 0x0}, + 1295: {region: 0x166, script: 0x5b, flags: 0x0}, + 1296: {region: 0x166, script: 0x5b, flags: 0x0}, + 1297: {region: 0x166, script: 0x5b, flags: 0x0}, 1298: {region: 0x1, script: 0x3e, flags: 0x0}, - 1299: {region: 0x165, script: 0x5a, flags: 0x0}, - 1300: {region: 0x165, script: 0x5a, flags: 0x0}, - 1301: {region: 0x165, script: 0x5a, flags: 0x0}, - 1302: {region: 0x165, script: 0x5a, flags: 0x0}, - 1303: {region: 0x165, script: 0x5a, flags: 0x0}, - 1304: {region: 0xd6, script: 0x5a, flags: 0x0}, - 1305: {region: 0x165, script: 0x5a, flags: 0x0}, - 1306: {region: 0x165, script: 0x5a, flags: 0x0}, - 1307: {region: 0x165, script: 0x5a, flags: 0x0}, - 1308: {region: 0x41, script: 0x5a, flags: 0x0}, - 1309: {region: 0x165, script: 0x5a, flags: 0x0}, - 1310: {region: 0xcf, script: 0x5a, flags: 0x0}, + 1299: {region: 0x166, script: 0x5b, flags: 0x0}, + 1300: {region: 0x166, script: 0x5b, flags: 0x0}, + 1301: {region: 0x166, script: 0x5b, flags: 0x0}, + 1302: {region: 0x166, script: 0x5b, flags: 0x0}, + 1303: {region: 0x166, script: 0x5b, flags: 0x0}, + 1304: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1305: {region: 0x166, script: 0x5b, flags: 0x0}, + 1306: {region: 0x166, script: 0x5b, flags: 0x0}, + 1307: {region: 0x166, script: 0x5b, flags: 0x0}, + 1308: {region: 0x41, script: 0x5b, flags: 0x0}, + 1309: {region: 0x166, script: 0x5b, flags: 0x0}, + 1310: {region: 0xd0, script: 0x5b, flags: 0x0}, 1311: {region: 0x4a, script: 0x3, flags: 0x1}, - 1312: {region: 0x165, script: 0x5a, flags: 0x0}, - 1313: {region: 0x165, script: 0x5a, flags: 0x0}, - 1314: {region: 0x165, script: 0x5a, flags: 0x0}, - 1315: {region: 0x53, script: 0x5a, flags: 0x0}, - 1316: {region: 0x10b, script: 0x5a, flags: 0x0}, - 1318: {region: 0xa8, script: 0x5, flags: 0x0}, - 1319: {region: 0xd9, script: 0x5a, flags: 0x0}, - 1320: {region: 0xba, script: 0xe3, flags: 0x0}, + 1312: {region: 0x166, script: 0x5b, flags: 0x0}, + 1313: {region: 0x166, script: 0x5b, flags: 0x0}, + 1314: {region: 0x166, script: 0x5b, flags: 0x0}, + 1315: {region: 0x53, script: 0x5b, flags: 0x0}, + 1316: {region: 0x10c, script: 0x5b, flags: 0x0}, + 1318: {region: 0xa9, script: 0x5, flags: 0x0}, + 1319: {region: 0xda, script: 0x5b, flags: 0x0}, + 1320: {region: 0xbb, script: 0xeb, flags: 0x0}, 1321: {region: 0x4d, script: 0x14, flags: 0x1}, - 1322: {region: 0x53, script: 0x7d, flags: 0x0}, - 1323: {region: 0x165, script: 0x5a, flags: 0x0}, - 1324: {region: 0x122, script: 0x5a, flags: 0x0}, - 1325: {region: 0xd0, script: 0x5a, flags: 0x0}, - 1326: {region: 0x165, script: 0x5a, flags: 0x0}, - 1327: {region: 0x161, script: 0x5a, flags: 0x0}, - 1329: {region: 0x12b, script: 0x5a, flags: 0x0}, + 1322: {region: 0x53, script: 0x7f, flags: 0x0}, + 1323: {region: 0x166, script: 0x5b, flags: 0x0}, + 1324: {region: 0x123, script: 0x5b, flags: 0x0}, + 1325: {region: 0xd1, script: 0x5b, flags: 0x0}, + 1326: {region: 0x166, script: 0x5b, flags: 0x0}, + 1327: {region: 0x162, script: 0x5b, flags: 0x0}, + 1329: {region: 0x12c, script: 0x5b, flags: 0x0}, } // likelyLangList holds lists info associated with likelyLang. -// Size: 388 bytes, 97 elements +// Size: 582 bytes, 97 elements var likelyLangList = [97]likelyScriptRegion{ - 0: {region: 0x9c, script: 0x7, flags: 0x0}, - 1: {region: 0xa1, script: 0x78, flags: 0x2}, - 2: {region: 0x11c, script: 0x84, flags: 0x2}, - 3: {region: 0x32, script: 0x5a, flags: 0x0}, - 4: {region: 0x9b, script: 0x5, flags: 0x4}, - 5: {region: 0x9c, script: 0x5, flags: 0x4}, - 6: {region: 0x106, script: 0x20, flags: 0x4}, - 7: {region: 0x9c, script: 0x5, flags: 0x2}, - 8: {region: 0x106, script: 0x20, flags: 0x0}, + 0: {region: 0x9d, script: 0x7, flags: 0x0}, + 1: {region: 0xa2, script: 0x7a, flags: 0x2}, + 2: {region: 0x11d, script: 0x87, flags: 0x2}, + 3: {region: 0x32, script: 0x5b, flags: 0x0}, + 4: {region: 0x9c, script: 0x5, flags: 0x4}, + 5: {region: 0x9d, script: 0x5, flags: 0x4}, + 6: {region: 0x107, script: 0x20, flags: 0x4}, + 7: {region: 0x9d, script: 0x5, flags: 0x2}, + 8: {region: 0x107, script: 0x20, flags: 0x0}, 9: {region: 0x38, script: 0x2f, flags: 0x2}, - 10: {region: 0x135, script: 0x5a, flags: 0x0}, - 11: {region: 0x7b, script: 0xca, flags: 0x2}, - 12: {region: 0x114, script: 0x5a, flags: 0x0}, - 13: {region: 0x84, script: 0x1, flags: 0x2}, - 14: {region: 0x5d, script: 0x1f, flags: 0x0}, - 15: {region: 0x87, script: 0x5f, flags: 0x2}, - 16: {region: 0xd6, script: 0x5a, flags: 0x0}, + 10: {region: 0x136, script: 0x5b, flags: 0x0}, + 11: {region: 0x7c, script: 0xd1, flags: 0x2}, + 12: {region: 0x115, script: 0x5b, flags: 0x0}, + 13: {region: 0x85, script: 0x1, flags: 0x2}, + 14: {region: 0x5e, script: 0x1f, flags: 0x0}, + 15: {region: 0x88, script: 0x60, flags: 0x2}, + 16: {region: 0xd7, script: 0x5b, flags: 0x0}, 17: {region: 0x52, script: 0x5, flags: 0x4}, - 18: {region: 0x10b, script: 0x5, flags: 0x4}, - 19: {region: 0xae, script: 0x20, flags: 0x0}, + 18: {region: 0x10c, script: 0x5, flags: 0x4}, + 19: {region: 0xaf, script: 0x20, flags: 0x0}, 20: {region: 0x24, script: 0x5, flags: 0x4}, 21: {region: 0x53, script: 0x5, flags: 0x4}, - 22: {region: 0x9c, script: 0x5, flags: 0x4}, - 23: {region: 0xc5, script: 0x5, flags: 0x4}, + 22: {region: 0x9d, script: 0x5, flags: 0x4}, + 23: {region: 0xc6, script: 0x5, flags: 0x4}, 24: {region: 0x53, script: 0x5, flags: 0x2}, - 25: {region: 0x12b, script: 0x5a, flags: 0x0}, - 26: {region: 0xb0, script: 0x5, flags: 0x4}, - 27: {region: 0x9b, script: 0x5, flags: 0x2}, - 28: {region: 0xa5, script: 0x20, flags: 0x0}, + 25: {region: 0x12c, script: 0x5b, flags: 0x0}, + 26: {region: 0xb1, script: 0x5, flags: 0x4}, + 27: {region: 0x9c, script: 0x5, flags: 0x2}, + 28: {region: 0xa6, script: 0x20, flags: 0x0}, 29: {region: 0x53, script: 0x5, flags: 0x4}, - 30: {region: 0x12b, script: 0x5a, flags: 0x4}, + 30: {region: 0x12c, script: 0x5b, flags: 0x4}, 31: {region: 0x53, script: 0x5, flags: 0x2}, - 32: {region: 0x12b, script: 0x5a, flags: 0x2}, - 33: {region: 0xdb, script: 0x22, flags: 0x0}, - 34: {region: 0x99, script: 0x5d, flags: 0x2}, - 35: {region: 0x83, script: 0x5a, flags: 0x0}, - 36: {region: 0x84, script: 0x7c, flags: 0x4}, - 37: {region: 0x84, script: 0x7c, flags: 0x2}, - 38: {region: 0xc5, script: 0x20, flags: 0x0}, - 39: {region: 0x53, script: 0x70, flags: 0x4}, - 40: {region: 0x53, script: 0x70, flags: 0x2}, - 41: {region: 0xd0, script: 0x5a, flags: 0x0}, + 32: {region: 0x12c, script: 0x5b, flags: 0x2}, + 33: {region: 0xdc, script: 0x22, flags: 0x0}, + 34: {region: 0x9a, script: 0x5e, flags: 0x2}, + 35: {region: 0x84, script: 0x5b, flags: 0x0}, + 36: {region: 0x85, script: 0x7e, flags: 0x4}, + 37: {region: 0x85, script: 0x7e, flags: 0x2}, + 38: {region: 0xc6, script: 0x20, flags: 0x0}, + 39: {region: 0x53, script: 0x71, flags: 0x4}, + 40: {region: 0x53, script: 0x71, flags: 0x2}, + 41: {region: 0xd1, script: 0x5b, flags: 0x0}, 42: {region: 0x4a, script: 0x5, flags: 0x4}, - 43: {region: 0x95, script: 0x5, flags: 0x4}, - 44: {region: 0x99, script: 0x36, flags: 0x0}, - 45: {region: 0xe8, script: 0x5, flags: 0x4}, - 46: {region: 0xe8, script: 0x5, flags: 0x2}, - 47: {region: 0x9c, script: 0x88, flags: 0x0}, - 48: {region: 0x53, script: 0x89, flags: 0x2}, - 49: {region: 0xba, script: 0xe3, flags: 0x0}, - 50: {region: 0xd9, script: 0x5a, flags: 0x4}, - 51: {region: 0xe8, script: 0x5, flags: 0x0}, - 52: {region: 0x99, script: 0x22, flags: 0x2}, - 53: {region: 0x99, script: 0x4f, flags: 0x2}, - 54: {region: 0x99, script: 0xce, flags: 0x2}, - 55: {region: 0x105, script: 0x20, flags: 0x0}, - 56: {region: 0xbd, script: 0x5a, flags: 0x4}, - 57: {region: 0x104, script: 0x5a, flags: 0x4}, - 58: {region: 0x106, script: 0x5a, flags: 0x4}, - 59: {region: 0x12b, script: 0x5a, flags: 0x4}, - 60: {region: 0x124, script: 0x20, flags: 0x0}, - 61: {region: 0xe8, script: 0x5, flags: 0x4}, - 62: {region: 0xe8, script: 0x5, flags: 0x2}, + 43: {region: 0x96, script: 0x5, flags: 0x4}, + 44: {region: 0x9a, script: 0x36, flags: 0x0}, + 45: {region: 0xe9, script: 0x5, flags: 0x4}, + 46: {region: 0xe9, script: 0x5, flags: 0x2}, + 47: {region: 0x9d, script: 0x8d, flags: 0x0}, + 48: {region: 0x53, script: 0x8e, flags: 0x2}, + 49: {region: 0xbb, script: 0xeb, flags: 0x0}, + 50: {region: 0xda, script: 0x5b, flags: 0x4}, + 51: {region: 0xe9, script: 0x5, flags: 0x0}, + 52: {region: 0x9a, script: 0x22, flags: 0x2}, + 53: {region: 0x9a, script: 0x50, flags: 0x2}, + 54: {region: 0x9a, script: 0xd5, flags: 0x2}, + 55: {region: 0x106, script: 0x20, flags: 0x0}, + 56: {region: 0xbe, script: 0x5b, flags: 0x4}, + 57: {region: 0x105, script: 0x5b, flags: 0x4}, + 58: {region: 0x107, script: 0x5b, flags: 0x4}, + 59: {region: 0x12c, script: 0x5b, flags: 0x4}, + 60: {region: 0x125, script: 0x20, flags: 0x0}, + 61: {region: 0xe9, script: 0x5, flags: 0x4}, + 62: {region: 0xe9, script: 0x5, flags: 0x2}, 63: {region: 0x53, script: 0x5, flags: 0x0}, - 64: {region: 0xae, script: 0x20, flags: 0x4}, - 65: {region: 0xc5, script: 0x20, flags: 0x4}, - 66: {region: 0xae, script: 0x20, flags: 0x2}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0xdb, script: 0x22, flags: 0x4}, - 69: {region: 0xdb, script: 0x22, flags: 0x2}, - 70: {region: 0x137, script: 0x5a, flags: 0x0}, + 64: {region: 0xaf, script: 0x20, flags: 0x4}, + 65: {region: 0xc6, script: 0x20, flags: 0x4}, + 66: {region: 0xaf, script: 0x20, flags: 0x2}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0xdc, script: 0x22, flags: 0x4}, + 69: {region: 0xdc, script: 0x22, flags: 0x2}, + 70: {region: 0x138, script: 0x5b, flags: 0x0}, 71: {region: 0x24, script: 0x5, flags: 0x4}, 72: {region: 0x53, script: 0x20, flags: 0x4}, 73: {region: 0x24, script: 0x5, flags: 0x2}, - 74: {region: 0x8d, script: 0x3c, flags: 0x0}, + 74: {region: 0x8e, script: 0x3c, flags: 0x0}, 75: {region: 0x53, script: 0x3b, flags: 0x4}, 76: {region: 0x53, script: 0x3b, flags: 0x2}, 77: {region: 0x53, script: 0x3b, flags: 0x0}, 78: {region: 0x2f, script: 0x3c, flags: 0x4}, 79: {region: 0x3e, script: 0x3c, flags: 0x4}, - 80: {region: 0x7b, script: 0x3c, flags: 0x4}, - 81: {region: 0x7e, script: 0x3c, flags: 0x4}, - 82: {region: 0x8d, script: 0x3c, flags: 0x4}, - 83: {region: 0x95, script: 0x3c, flags: 0x4}, - 84: {region: 0xc6, script: 0x3c, flags: 0x4}, - 85: {region: 0xd0, script: 0x3c, flags: 0x4}, - 86: {region: 0xe2, script: 0x3c, flags: 0x4}, - 87: {region: 0xe5, script: 0x3c, flags: 0x4}, - 88: {region: 0xe7, script: 0x3c, flags: 0x4}, - 89: {region: 0x116, script: 0x3c, flags: 0x4}, - 90: {region: 0x123, script: 0x3c, flags: 0x4}, - 91: {region: 0x12e, script: 0x3c, flags: 0x4}, - 92: {region: 0x135, script: 0x3c, flags: 0x4}, - 93: {region: 0x13e, script: 0x3c, flags: 0x4}, - 94: {region: 0x12e, script: 0x11, flags: 0x2}, - 95: {region: 0x12e, script: 0x37, flags: 0x2}, - 96: {region: 0x12e, script: 0x3c, flags: 0x2}, + 80: {region: 0x7c, script: 0x3c, flags: 0x4}, + 81: {region: 0x7f, script: 0x3c, flags: 0x4}, + 82: {region: 0x8e, script: 0x3c, flags: 0x4}, + 83: {region: 0x96, script: 0x3c, flags: 0x4}, + 84: {region: 0xc7, script: 0x3c, flags: 0x4}, + 85: {region: 0xd1, script: 0x3c, flags: 0x4}, + 86: {region: 0xe3, script: 0x3c, flags: 0x4}, + 87: {region: 0xe6, script: 0x3c, flags: 0x4}, + 88: {region: 0xe8, script: 0x3c, flags: 0x4}, + 89: {region: 0x117, script: 0x3c, flags: 0x4}, + 90: {region: 0x124, script: 0x3c, flags: 0x4}, + 91: {region: 0x12f, script: 0x3c, flags: 0x4}, + 92: {region: 0x136, script: 0x3c, flags: 0x4}, + 93: {region: 0x13f, script: 0x3c, flags: 0x4}, + 94: {region: 0x12f, script: 0x11, flags: 0x2}, + 95: {region: 0x12f, script: 0x37, flags: 0x2}, + 96: {region: 0x12f, script: 0x3c, flags: 0x2}, } type likelyLangScript struct { lang uint16 - script uint8 + script uint16 flags uint8 } @@ -2979,349 +3009,349 @@ type likelyLangScript struct { // for a given regionID, lang and script are the index and size respectively // of the list in likelyRegionList. // TODO: exclude containers and user-definable regions from the list. -// Size: 1432 bytes, 358 elements -var likelyRegion = [358]likelyLangScript{ - 34: {lang: 0xd7, script: 0x5a, flags: 0x0}, +// Size: 2154 bytes, 359 elements +var likelyRegion = [359]likelyLangScript{ + 34: {lang: 0xd7, script: 0x5b, flags: 0x0}, 35: {lang: 0x3a, script: 0x5, flags: 0x0}, 36: {lang: 0x0, script: 0x2, flags: 0x1}, 39: {lang: 0x2, script: 0x2, flags: 0x1}, 40: {lang: 0x4, script: 0x2, flags: 0x1}, - 42: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 43: {lang: 0x0, script: 0x5a, flags: 0x0}, - 44: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 45: {lang: 0x41b, script: 0x5a, flags: 0x0}, - 46: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 48: {lang: 0x367, script: 0x5a, flags: 0x0}, - 49: {lang: 0x444, script: 0x5a, flags: 0x0}, - 50: {lang: 0x58, script: 0x5a, flags: 0x0}, + 42: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 43: {lang: 0x0, script: 0x5b, flags: 0x0}, + 44: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 45: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 46: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 48: {lang: 0x367, script: 0x5b, flags: 0x0}, + 49: {lang: 0x444, script: 0x5b, flags: 0x0}, + 50: {lang: 0x58, script: 0x5b, flags: 0x0}, 51: {lang: 0x6, script: 0x2, flags: 0x1}, 53: {lang: 0xa5, script: 0xe, flags: 0x0}, - 54: {lang: 0x367, script: 0x5a, flags: 0x0}, - 55: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 54: {lang: 0x367, script: 0x5b, flags: 0x0}, + 55: {lang: 0x15e, script: 0x5b, flags: 0x0}, 56: {lang: 0x7e, script: 0x20, flags: 0x0}, 57: {lang: 0x3a, script: 0x5, flags: 0x0}, - 58: {lang: 0x3d9, script: 0x5a, flags: 0x0}, - 59: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 60: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 62: {lang: 0x31f, script: 0x5a, flags: 0x0}, - 63: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 64: {lang: 0x3a1, script: 0x5a, flags: 0x0}, - 65: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 58: {lang: 0x3d9, script: 0x5b, flags: 0x0}, + 59: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 60: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 62: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 63: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 64: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 65: {lang: 0x3c0, script: 0x5b, flags: 0x0}, 67: {lang: 0x8, script: 0x2, flags: 0x1}, - 69: {lang: 0x0, script: 0x5a, flags: 0x0}, + 69: {lang: 0x0, script: 0x5b, flags: 0x0}, 71: {lang: 0x71, script: 0x20, flags: 0x0}, 73: {lang: 0x512, script: 0x3e, flags: 0x2}, 74: {lang: 0x31f, script: 0x5, flags: 0x2}, - 75: {lang: 0x445, script: 0x5a, flags: 0x0}, - 76: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 77: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 78: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 81: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 82: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 75: {lang: 0x445, script: 0x5b, flags: 0x0}, + 76: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 77: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 78: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 81: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 82: {lang: 0x15e, script: 0x5b, flags: 0x0}, 83: {lang: 0xa, script: 0x4, flags: 0x1}, - 84: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 85: {lang: 0x0, script: 0x5a, flags: 0x0}, - 86: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 89: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 90: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 91: {lang: 0x3a1, script: 0x5a, flags: 0x0}, - 93: {lang: 0xe, script: 0x2, flags: 0x1}, - 94: {lang: 0xfa, script: 0x5a, flags: 0x0}, - 96: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 98: {lang: 0x1, script: 0x5a, flags: 0x0}, - 99: {lang: 0x101, script: 0x5a, flags: 0x0}, - 101: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 103: {lang: 0x10, script: 0x2, flags: 0x1}, - 104: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 105: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 106: {lang: 0x140, script: 0x5a, flags: 0x0}, - 107: {lang: 0x3a, script: 0x5, flags: 0x0}, + 84: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 85: {lang: 0x0, script: 0x5b, flags: 0x0}, + 87: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 90: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 91: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 92: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 94: {lang: 0xe, script: 0x2, flags: 0x1}, + 95: {lang: 0xfa, script: 0x5b, flags: 0x0}, + 97: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 99: {lang: 0x1, script: 0x5b, flags: 0x0}, + 100: {lang: 0x101, script: 0x5b, flags: 0x0}, + 102: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 104: {lang: 0x10, script: 0x2, flags: 0x1}, + 105: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 106: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 107: {lang: 0x140, script: 0x5b, flags: 0x0}, 108: {lang: 0x3a, script: 0x5, flags: 0x0}, - 109: {lang: 0x46f, script: 0x2c, flags: 0x0}, - 110: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 111: {lang: 0x12, script: 0x2, flags: 0x1}, - 113: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 114: {lang: 0x151, script: 0x5a, flags: 0x0}, - 115: {lang: 0x1c0, script: 0x22, flags: 0x2}, - 118: {lang: 0x158, script: 0x5a, flags: 0x0}, - 120: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 122: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 123: {lang: 0x14, script: 0x2, flags: 0x1}, - 125: {lang: 0x16, script: 0x3, flags: 0x1}, - 126: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 128: {lang: 0x21, script: 0x5a, flags: 0x0}, - 130: {lang: 0x245, script: 0x5a, flags: 0x0}, - 132: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 133: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 134: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 135: {lang: 0x19, script: 0x2, flags: 0x1}, - 136: {lang: 0x0, script: 0x5a, flags: 0x0}, - 137: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 139: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 141: {lang: 0x529, script: 0x3c, flags: 0x0}, - 142: {lang: 0x0, script: 0x5a, flags: 0x0}, - 143: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 144: {lang: 0x1d1, script: 0x5a, flags: 0x0}, - 145: {lang: 0x1d4, script: 0x5a, flags: 0x0}, - 146: {lang: 0x1d5, script: 0x5a, flags: 0x0}, - 148: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 149: {lang: 0x1b, script: 0x2, flags: 0x1}, - 151: {lang: 0x1bc, script: 0x3e, flags: 0x0}, - 153: {lang: 0x1d, script: 0x3, flags: 0x1}, - 155: {lang: 0x3a, script: 0x5, flags: 0x0}, - 156: {lang: 0x20, script: 0x2, flags: 0x1}, - 157: {lang: 0x1f8, script: 0x5a, flags: 0x0}, - 158: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 161: {lang: 0x3a, script: 0x5, flags: 0x0}, - 162: {lang: 0x200, script: 0x49, flags: 0x0}, - 164: {lang: 0x445, script: 0x5a, flags: 0x0}, - 165: {lang: 0x28a, script: 0x20, flags: 0x0}, - 166: {lang: 0x22, script: 0x3, flags: 0x1}, - 168: {lang: 0x25, script: 0x2, flags: 0x1}, - 170: {lang: 0x254, script: 0x53, flags: 0x0}, - 171: {lang: 0x254, script: 0x53, flags: 0x0}, - 172: {lang: 0x3a, script: 0x5, flags: 0x0}, - 174: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 175: {lang: 0x27, script: 0x2, flags: 0x1}, - 176: {lang: 0x3a, script: 0x5, flags: 0x0}, - 178: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 179: {lang: 0x40c, script: 0xcf, flags: 0x0}, - 181: {lang: 0x43b, script: 0x5a, flags: 0x0}, - 182: {lang: 0x2c0, script: 0x5a, flags: 0x0}, - 183: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 184: {lang: 0x2c7, script: 0x5a, flags: 0x0}, - 185: {lang: 0x3a, script: 0x5, flags: 0x0}, - 186: {lang: 0x29, script: 0x2, flags: 0x1}, - 187: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 188: {lang: 0x2b, script: 0x2, flags: 0x1}, - 189: {lang: 0x432, script: 0x5a, flags: 0x0}, - 190: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 191: {lang: 0x2f1, script: 0x5a, flags: 0x0}, - 194: {lang: 0x2d, script: 0x2, flags: 0x1}, - 195: {lang: 0xa0, script: 0x5a, flags: 0x0}, - 196: {lang: 0x2f, script: 0x2, flags: 0x1}, - 197: {lang: 0x31, script: 0x2, flags: 0x1}, - 198: {lang: 0x33, script: 0x2, flags: 0x1}, - 200: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 201: {lang: 0x35, script: 0x2, flags: 0x1}, - 203: {lang: 0x320, script: 0x5a, flags: 0x0}, - 204: {lang: 0x37, script: 0x3, flags: 0x1}, - 205: {lang: 0x128, script: 0xe5, flags: 0x0}, - 207: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 208: {lang: 0x31f, script: 0x5a, flags: 0x0}, - 209: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 210: {lang: 0x16, script: 0x5a, flags: 0x0}, - 211: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 212: {lang: 0x1b4, script: 0x5a, flags: 0x0}, - 214: {lang: 0x1b4, script: 0x5, flags: 0x2}, - 216: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 217: {lang: 0x367, script: 0x5a, flags: 0x0}, - 218: {lang: 0x347, script: 0x5a, flags: 0x0}, - 219: {lang: 0x351, script: 0x22, flags: 0x0}, - 225: {lang: 0x3a, script: 0x5, flags: 0x0}, - 226: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 228: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 229: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 230: {lang: 0x486, script: 0x5a, flags: 0x0}, - 231: {lang: 0x153, script: 0x5a, flags: 0x0}, - 232: {lang: 0x3a, script: 0x3, flags: 0x1}, - 233: {lang: 0x3b3, script: 0x5a, flags: 0x0}, - 234: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 236: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 237: {lang: 0x3a, script: 0x5, flags: 0x0}, - 238: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 240: {lang: 0x3a2, script: 0x5a, flags: 0x0}, - 241: {lang: 0x194, script: 0x5a, flags: 0x0}, - 243: {lang: 0x3a, script: 0x5, flags: 0x0}, - 258: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 260: {lang: 0x3d, script: 0x2, flags: 0x1}, - 261: {lang: 0x432, script: 0x20, flags: 0x0}, - 262: {lang: 0x3f, script: 0x2, flags: 0x1}, - 263: {lang: 0x3e5, script: 0x5a, flags: 0x0}, - 264: {lang: 0x3a, script: 0x5, flags: 0x0}, - 266: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 267: {lang: 0x3a, script: 0x5, flags: 0x0}, - 268: {lang: 0x41, script: 0x2, flags: 0x1}, - 271: {lang: 0x416, script: 0x5a, flags: 0x0}, - 272: {lang: 0x347, script: 0x5a, flags: 0x0}, - 273: {lang: 0x43, script: 0x2, flags: 0x1}, - 275: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 276: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 277: {lang: 0x429, script: 0x5a, flags: 0x0}, - 278: {lang: 0x367, script: 0x5a, flags: 0x0}, - 280: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 282: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 284: {lang: 0x45, script: 0x2, flags: 0x1}, - 288: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 289: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 290: {lang: 0x47, script: 0x2, flags: 0x1}, - 291: {lang: 0x49, script: 0x3, flags: 0x1}, - 292: {lang: 0x4c, script: 0x2, flags: 0x1}, - 293: {lang: 0x477, script: 0x5a, flags: 0x0}, - 294: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 295: {lang: 0x476, script: 0x5a, flags: 0x0}, - 296: {lang: 0x4e, script: 0x2, flags: 0x1}, - 297: {lang: 0x482, script: 0x5a, flags: 0x0}, - 299: {lang: 0x50, script: 0x4, flags: 0x1}, - 301: {lang: 0x4a0, script: 0x5a, flags: 0x0}, - 302: {lang: 0x54, script: 0x2, flags: 0x1}, - 303: {lang: 0x445, script: 0x5a, flags: 0x0}, - 304: {lang: 0x56, script: 0x3, flags: 0x1}, - 305: {lang: 0x445, script: 0x5a, flags: 0x0}, - 309: {lang: 0x512, script: 0x3e, flags: 0x2}, - 310: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 311: {lang: 0x4bc, script: 0x5a, flags: 0x0}, - 312: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 315: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 318: {lang: 0x4c3, script: 0x5a, flags: 0x0}, - 319: {lang: 0x8a, script: 0x5a, flags: 0x0}, - 320: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 322: {lang: 0x41b, script: 0x5a, flags: 0x0}, - 333: {lang: 0x59, script: 0x2, flags: 0x1}, - 350: {lang: 0x3a, script: 0x5, flags: 0x0}, - 351: {lang: 0x5b, script: 0x2, flags: 0x1}, - 356: {lang: 0x423, script: 0x5a, flags: 0x0}, + 109: {lang: 0x3a, script: 0x5, flags: 0x0}, + 110: {lang: 0x46f, script: 0x2c, flags: 0x0}, + 111: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 112: {lang: 0x12, script: 0x2, flags: 0x1}, + 114: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 115: {lang: 0x151, script: 0x5b, flags: 0x0}, + 116: {lang: 0x1c0, script: 0x22, flags: 0x2}, + 119: {lang: 0x158, script: 0x5b, flags: 0x0}, + 121: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 123: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 124: {lang: 0x14, script: 0x2, flags: 0x1}, + 126: {lang: 0x16, script: 0x3, flags: 0x1}, + 127: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 129: {lang: 0x21, script: 0x5b, flags: 0x0}, + 131: {lang: 0x245, script: 0x5b, flags: 0x0}, + 133: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 134: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 135: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 136: {lang: 0x19, script: 0x2, flags: 0x1}, + 137: {lang: 0x0, script: 0x5b, flags: 0x0}, + 138: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 140: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 142: {lang: 0x529, script: 0x3c, flags: 0x0}, + 143: {lang: 0x0, script: 0x5b, flags: 0x0}, + 144: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 145: {lang: 0x1d1, script: 0x5b, flags: 0x0}, + 146: {lang: 0x1d4, script: 0x5b, flags: 0x0}, + 147: {lang: 0x1d5, script: 0x5b, flags: 0x0}, + 149: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 150: {lang: 0x1b, script: 0x2, flags: 0x1}, + 152: {lang: 0x1bc, script: 0x3e, flags: 0x0}, + 154: {lang: 0x1d, script: 0x3, flags: 0x1}, + 156: {lang: 0x3a, script: 0x5, flags: 0x0}, + 157: {lang: 0x20, script: 0x2, flags: 0x1}, + 158: {lang: 0x1f8, script: 0x5b, flags: 0x0}, + 159: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 162: {lang: 0x3a, script: 0x5, flags: 0x0}, + 163: {lang: 0x200, script: 0x49, flags: 0x0}, + 165: {lang: 0x445, script: 0x5b, flags: 0x0}, + 166: {lang: 0x28a, script: 0x20, flags: 0x0}, + 167: {lang: 0x22, script: 0x3, flags: 0x1}, + 169: {lang: 0x25, script: 0x2, flags: 0x1}, + 171: {lang: 0x254, script: 0x54, flags: 0x0}, + 172: {lang: 0x254, script: 0x54, flags: 0x0}, + 173: {lang: 0x3a, script: 0x5, flags: 0x0}, + 175: {lang: 0x3e2, script: 0x20, flags: 0x0}, + 176: {lang: 0x27, script: 0x2, flags: 0x1}, + 177: {lang: 0x3a, script: 0x5, flags: 0x0}, + 179: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 180: {lang: 0x40c, script: 0xd6, flags: 0x0}, + 182: {lang: 0x43b, script: 0x5b, flags: 0x0}, + 183: {lang: 0x2c0, script: 0x5b, flags: 0x0}, + 184: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 185: {lang: 0x2c7, script: 0x5b, flags: 0x0}, + 186: {lang: 0x3a, script: 0x5, flags: 0x0}, + 187: {lang: 0x29, script: 0x2, flags: 0x1}, + 188: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 189: {lang: 0x2b, script: 0x2, flags: 0x1}, + 190: {lang: 0x432, script: 0x5b, flags: 0x0}, + 191: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 192: {lang: 0x2f1, script: 0x5b, flags: 0x0}, + 195: {lang: 0x2d, script: 0x2, flags: 0x1}, + 196: {lang: 0xa0, script: 0x5b, flags: 0x0}, + 197: {lang: 0x2f, script: 0x2, flags: 0x1}, + 198: {lang: 0x31, script: 0x2, flags: 0x1}, + 199: {lang: 0x33, script: 0x2, flags: 0x1}, + 201: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 202: {lang: 0x35, script: 0x2, flags: 0x1}, + 204: {lang: 0x320, script: 0x5b, flags: 0x0}, + 205: {lang: 0x37, script: 0x3, flags: 0x1}, + 206: {lang: 0x128, script: 0xed, flags: 0x0}, + 208: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 209: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 210: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 211: {lang: 0x16, script: 0x5b, flags: 0x0}, + 212: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 213: {lang: 0x1b4, script: 0x5b, flags: 0x0}, + 215: {lang: 0x1b4, script: 0x5, flags: 0x2}, + 217: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 218: {lang: 0x367, script: 0x5b, flags: 0x0}, + 219: {lang: 0x347, script: 0x5b, flags: 0x0}, + 220: {lang: 0x351, script: 0x22, flags: 0x0}, + 226: {lang: 0x3a, script: 0x5, flags: 0x0}, + 227: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 229: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 230: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 231: {lang: 0x486, script: 0x5b, flags: 0x0}, + 232: {lang: 0x153, script: 0x5b, flags: 0x0}, + 233: {lang: 0x3a, script: 0x3, flags: 0x1}, + 234: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 235: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 237: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 238: {lang: 0x3a, script: 0x5, flags: 0x0}, + 239: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 241: {lang: 0x3a2, script: 0x5b, flags: 0x0}, + 242: {lang: 0x194, script: 0x5b, flags: 0x0}, + 244: {lang: 0x3a, script: 0x5, flags: 0x0}, + 259: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 261: {lang: 0x3d, script: 0x2, flags: 0x1}, + 262: {lang: 0x432, script: 0x20, flags: 0x0}, + 263: {lang: 0x3f, script: 0x2, flags: 0x1}, + 264: {lang: 0x3e5, script: 0x5b, flags: 0x0}, + 265: {lang: 0x3a, script: 0x5, flags: 0x0}, + 267: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 268: {lang: 0x3a, script: 0x5, flags: 0x0}, + 269: {lang: 0x41, script: 0x2, flags: 0x1}, + 272: {lang: 0x416, script: 0x5b, flags: 0x0}, + 273: {lang: 0x347, script: 0x5b, flags: 0x0}, + 274: {lang: 0x43, script: 0x2, flags: 0x1}, + 276: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 277: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 278: {lang: 0x429, script: 0x5b, flags: 0x0}, + 279: {lang: 0x367, script: 0x5b, flags: 0x0}, + 281: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 283: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 285: {lang: 0x45, script: 0x2, flags: 0x1}, + 289: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 290: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 291: {lang: 0x47, script: 0x2, flags: 0x1}, + 292: {lang: 0x49, script: 0x3, flags: 0x1}, + 293: {lang: 0x4c, script: 0x2, flags: 0x1}, + 294: {lang: 0x477, script: 0x5b, flags: 0x0}, + 295: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 296: {lang: 0x476, script: 0x5b, flags: 0x0}, + 297: {lang: 0x4e, script: 0x2, flags: 0x1}, + 298: {lang: 0x482, script: 0x5b, flags: 0x0}, + 300: {lang: 0x50, script: 0x4, flags: 0x1}, + 302: {lang: 0x4a0, script: 0x5b, flags: 0x0}, + 303: {lang: 0x54, script: 0x2, flags: 0x1}, + 304: {lang: 0x445, script: 0x5b, flags: 0x0}, + 305: {lang: 0x56, script: 0x3, flags: 0x1}, + 306: {lang: 0x445, script: 0x5b, flags: 0x0}, + 310: {lang: 0x512, script: 0x3e, flags: 0x2}, + 311: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 312: {lang: 0x4bc, script: 0x5b, flags: 0x0}, + 313: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 316: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 319: {lang: 0x4c3, script: 0x5b, flags: 0x0}, + 320: {lang: 0x8a, script: 0x5b, flags: 0x0}, + 321: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 323: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 334: {lang: 0x59, script: 0x2, flags: 0x1}, + 351: {lang: 0x3a, script: 0x5, flags: 0x0}, + 352: {lang: 0x5b, script: 0x2, flags: 0x1}, + 357: {lang: 0x423, script: 0x5b, flags: 0x0}, } // likelyRegionList holds lists info associated with likelyRegion. -// Size: 372 bytes, 93 elements +// Size: 558 bytes, 93 elements var likelyRegionList = [93]likelyLangScript{ 0: {lang: 0x148, script: 0x5, flags: 0x0}, - 1: {lang: 0x476, script: 0x5a, flags: 0x0}, - 2: {lang: 0x431, script: 0x5a, flags: 0x0}, + 1: {lang: 0x476, script: 0x5b, flags: 0x0}, + 2: {lang: 0x431, script: 0x5b, flags: 0x0}, 3: {lang: 0x2ff, script: 0x20, flags: 0x0}, 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, - 5: {lang: 0x274, script: 0x5a, flags: 0x0}, - 6: {lang: 0xb7, script: 0x5a, flags: 0x0}, + 5: {lang: 0x274, script: 0x5b, flags: 0x0}, + 6: {lang: 0xb7, script: 0x5b, flags: 0x0}, 7: {lang: 0x432, script: 0x20, flags: 0x0}, - 8: {lang: 0x12d, script: 0xe7, flags: 0x0}, + 8: {lang: 0x12d, script: 0xef, flags: 0x0}, 9: {lang: 0x351, script: 0x22, flags: 0x0}, 10: {lang: 0x529, script: 0x3b, flags: 0x0}, 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, - 12: {lang: 0x523, script: 0x5a, flags: 0x0}, - 13: {lang: 0x29a, script: 0xe6, flags: 0x0}, + 12: {lang: 0x523, script: 0x5b, flags: 0x0}, + 13: {lang: 0x29a, script: 0xee, flags: 0x0}, 14: {lang: 0x136, script: 0x34, flags: 0x0}, - 15: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 15: {lang: 0x48a, script: 0x5b, flags: 0x0}, 16: {lang: 0x3a, script: 0x5, flags: 0x0}, - 17: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 17: {lang: 0x15e, script: 0x5b, flags: 0x0}, 18: {lang: 0x27, script: 0x2c, flags: 0x0}, - 19: {lang: 0x139, script: 0x5a, flags: 0x0}, + 19: {lang: 0x139, script: 0x5b, flags: 0x0}, 20: {lang: 0x26a, script: 0x5, flags: 0x2}, 21: {lang: 0x512, script: 0x3e, flags: 0x2}, 22: {lang: 0x210, script: 0x2e, flags: 0x0}, 23: {lang: 0x5, script: 0x20, flags: 0x0}, - 24: {lang: 0x274, script: 0x5a, flags: 0x0}, + 24: {lang: 0x274, script: 0x5b, flags: 0x0}, 25: {lang: 0x136, script: 0x34, flags: 0x0}, 26: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 27: {lang: 0x1e1, script: 0x5a, flags: 0x0}, + 27: {lang: 0x1e1, script: 0x5b, flags: 0x0}, 28: {lang: 0x31f, script: 0x5, flags: 0x0}, 29: {lang: 0x1be, script: 0x22, flags: 0x0}, 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 31: {lang: 0x236, script: 0x75, flags: 0x0}, + 31: {lang: 0x236, script: 0x76, flags: 0x0}, 32: {lang: 0x148, script: 0x5, flags: 0x0}, - 33: {lang: 0x476, script: 0x5a, flags: 0x0}, - 34: {lang: 0x24a, script: 0x4e, flags: 0x0}, + 33: {lang: 0x476, script: 0x5b, flags: 0x0}, + 34: {lang: 0x24a, script: 0x4f, flags: 0x0}, 35: {lang: 0xe6, script: 0x5, flags: 0x0}, - 36: {lang: 0x226, script: 0xe6, flags: 0x0}, + 36: {lang: 0x226, script: 0xee, flags: 0x0}, 37: {lang: 0x3a, script: 0x5, flags: 0x0}, - 38: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 39: {lang: 0x2b8, script: 0x57, flags: 0x0}, - 40: {lang: 0x226, script: 0xe6, flags: 0x0}, + 38: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 39: {lang: 0x2b8, script: 0x58, flags: 0x0}, + 40: {lang: 0x226, script: 0xee, flags: 0x0}, 41: {lang: 0x3a, script: 0x5, flags: 0x0}, - 42: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 43: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 42: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 43: {lang: 0x3dc, script: 0x5b, flags: 0x0}, 44: {lang: 0x4ae, script: 0x20, flags: 0x0}, 45: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 46: {lang: 0x431, script: 0x5a, flags: 0x0}, - 47: {lang: 0x331, script: 0x75, flags: 0x0}, - 48: {lang: 0x213, script: 0x5a, flags: 0x0}, + 46: {lang: 0x431, script: 0x5b, flags: 0x0}, + 47: {lang: 0x331, script: 0x76, flags: 0x0}, + 48: {lang: 0x213, script: 0x5b, flags: 0x0}, 49: {lang: 0x30b, script: 0x20, flags: 0x0}, 50: {lang: 0x242, script: 0x5, flags: 0x0}, 51: {lang: 0x529, script: 0x3c, flags: 0x0}, - 52: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 52: {lang: 0x3c0, script: 0x5b, flags: 0x0}, 53: {lang: 0x3a, script: 0x5, flags: 0x0}, - 54: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 55: {lang: 0x2ed, script: 0x5a, flags: 0x0}, + 54: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 55: {lang: 0x2ed, script: 0x5b, flags: 0x0}, 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, 57: {lang: 0x88, script: 0x22, flags: 0x0}, 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, 60: {lang: 0xbe, script: 0x22, flags: 0x0}, - 61: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 61: {lang: 0x3dc, script: 0x5b, flags: 0x0}, 62: {lang: 0x7e, script: 0x20, flags: 0x0}, 63: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 64: {lang: 0x267, script: 0x5a, flags: 0x0}, - 65: {lang: 0x444, script: 0x5a, flags: 0x0}, + 64: {lang: 0x267, script: 0x5b, flags: 0x0}, + 65: {lang: 0x444, script: 0x5b, flags: 0x0}, 66: {lang: 0x512, script: 0x3e, flags: 0x0}, - 67: {lang: 0x412, script: 0x5a, flags: 0x0}, + 67: {lang: 0x412, script: 0x5b, flags: 0x0}, 68: {lang: 0x4ae, script: 0x20, flags: 0x0}, 69: {lang: 0x3a, script: 0x5, flags: 0x0}, - 70: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 71: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 70: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 71: {lang: 0x15e, script: 0x5b, flags: 0x0}, 72: {lang: 0x35, script: 0x5, flags: 0x0}, - 73: {lang: 0x46b, script: 0xe6, flags: 0x0}, + 73: {lang: 0x46b, script: 0xee, flags: 0x0}, 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, - 75: {lang: 0x30f, script: 0x75, flags: 0x0}, + 75: {lang: 0x30f, script: 0x76, flags: 0x0}, 76: {lang: 0x467, script: 0x20, flags: 0x0}, 77: {lang: 0x148, script: 0x5, flags: 0x0}, 78: {lang: 0x3a, script: 0x5, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 80: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 80: {lang: 0x48a, script: 0x5b, flags: 0x0}, 81: {lang: 0x58, script: 0x5, flags: 0x0}, 82: {lang: 0x219, script: 0x20, flags: 0x0}, 83: {lang: 0x81, script: 0x34, flags: 0x0}, 84: {lang: 0x529, script: 0x3c, flags: 0x0}, - 85: {lang: 0x48c, script: 0x5a, flags: 0x0}, + 85: {lang: 0x48c, script: 0x5b, flags: 0x0}, 86: {lang: 0x4ae, script: 0x20, flags: 0x0}, 87: {lang: 0x512, script: 0x3e, flags: 0x0}, - 88: {lang: 0x3b3, script: 0x5a, flags: 0x0}, - 89: {lang: 0x431, script: 0x5a, flags: 0x0}, + 88: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 89: {lang: 0x431, script: 0x5b, flags: 0x0}, 90: {lang: 0x432, script: 0x20, flags: 0x0}, - 91: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 91: {lang: 0x15e, script: 0x5b, flags: 0x0}, 92: {lang: 0x446, script: 0x5, flags: 0x0}, } type likelyTag struct { lang uint16 region uint16 - script uint8 + script uint16 } // Size: 198 bytes, 33 elements var likelyRegionGroup = [33]likelyTag{ - 1: {lang: 0x139, region: 0xd6, script: 0x5a}, - 2: {lang: 0x139, region: 0x135, script: 0x5a}, - 3: {lang: 0x3c0, region: 0x41, script: 0x5a}, - 4: {lang: 0x139, region: 0x2f, script: 0x5a}, - 5: {lang: 0x139, region: 0xd6, script: 0x5a}, - 6: {lang: 0x13e, region: 0xcf, script: 0x5a}, - 7: {lang: 0x445, region: 0x12f, script: 0x5a}, - 8: {lang: 0x3a, region: 0x6b, script: 0x5}, - 9: {lang: 0x445, region: 0x4b, script: 0x5a}, - 10: {lang: 0x139, region: 0x161, script: 0x5a}, - 11: {lang: 0x139, region: 0x135, script: 0x5a}, - 12: {lang: 0x139, region: 0x135, script: 0x5a}, - 13: {lang: 0x13e, region: 0x59, script: 0x5a}, + 1: {lang: 0x139, region: 0xd7, script: 0x5b}, + 2: {lang: 0x139, region: 0x136, script: 0x5b}, + 3: {lang: 0x3c0, region: 0x41, script: 0x5b}, + 4: {lang: 0x139, region: 0x2f, script: 0x5b}, + 5: {lang: 0x139, region: 0xd7, script: 0x5b}, + 6: {lang: 0x13e, region: 0xd0, script: 0x5b}, + 7: {lang: 0x445, region: 0x130, script: 0x5b}, + 8: {lang: 0x3a, region: 0x6c, script: 0x5}, + 9: {lang: 0x445, region: 0x4b, script: 0x5b}, + 10: {lang: 0x139, region: 0x162, script: 0x5b}, + 11: {lang: 0x139, region: 0x136, script: 0x5b}, + 12: {lang: 0x139, region: 0x136, script: 0x5b}, + 13: {lang: 0x13e, region: 0x5a, script: 0x5b}, 14: {lang: 0x529, region: 0x53, script: 0x3b}, - 15: {lang: 0x1be, region: 0x99, script: 0x22}, - 16: {lang: 0x1e1, region: 0x95, script: 0x5a}, - 17: {lang: 0x1f9, region: 0x9e, script: 0x5a}, - 18: {lang: 0x139, region: 0x2f, script: 0x5a}, - 19: {lang: 0x139, region: 0xe6, script: 0x5a}, - 20: {lang: 0x139, region: 0x8a, script: 0x5a}, - 21: {lang: 0x41b, region: 0x142, script: 0x5a}, + 15: {lang: 0x1be, region: 0x9a, script: 0x22}, + 16: {lang: 0x1e1, region: 0x96, script: 0x5b}, + 17: {lang: 0x1f9, region: 0x9f, script: 0x5b}, + 18: {lang: 0x139, region: 0x2f, script: 0x5b}, + 19: {lang: 0x139, region: 0xe7, script: 0x5b}, + 20: {lang: 0x139, region: 0x8b, script: 0x5b}, + 21: {lang: 0x41b, region: 0x143, script: 0x5b}, 22: {lang: 0x529, region: 0x53, script: 0x3b}, - 23: {lang: 0x4bc, region: 0x137, script: 0x5a}, - 24: {lang: 0x3a, region: 0x108, script: 0x5}, - 25: {lang: 0x3e2, region: 0x106, script: 0x20}, - 26: {lang: 0x3e2, region: 0x106, script: 0x20}, - 27: {lang: 0x139, region: 0x7b, script: 0x5a}, - 28: {lang: 0x10d, region: 0x60, script: 0x5a}, - 29: {lang: 0x139, region: 0xd6, script: 0x5a}, - 30: {lang: 0x13e, region: 0x1f, script: 0x5a}, - 31: {lang: 0x139, region: 0x9a, script: 0x5a}, - 32: {lang: 0x139, region: 0x7b, script: 0x5a}, + 23: {lang: 0x4bc, region: 0x138, script: 0x5b}, + 24: {lang: 0x3a, region: 0x109, script: 0x5}, + 25: {lang: 0x3e2, region: 0x107, script: 0x20}, + 26: {lang: 0x3e2, region: 0x107, script: 0x20}, + 27: {lang: 0x139, region: 0x7c, script: 0x5b}, + 28: {lang: 0x10d, region: 0x61, script: 0x5b}, + 29: {lang: 0x139, region: 0xd7, script: 0x5b}, + 30: {lang: 0x13e, region: 0x1f, script: 0x5b}, + 31: {lang: 0x139, region: 0x9b, script: 0x5b}, + 32: {lang: 0x139, region: 0x7c, script: 0x5b}, } // Size: 264 bytes, 33 elements @@ -3342,8 +3372,8 @@ var regionContainment = [33]uint64{ // regionInclusion maps region identifiers to sets of regions in regionInclusionBits, // where each set holds all groupings that are directly connected in a region // containment graph. -// Size: 358 bytes, 358 elements -var regionInclusion = [358]uint8{ +// Size: 359 bytes, 359 elements +var regionInclusion = [359]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, @@ -3356,45 +3386,45 @@ var regionInclusion = [358]uint8{ // Entry 40 - 7F 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, - 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23, - 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35, - 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39, - 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f, - 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21, - 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c, + 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x21, 0x34, + 0x23, 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, + 0x35, 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, + 0x39, 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, + 0x2f, 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, + 0x21, 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, // Entry 80 - BF - 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a, - 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34, - 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24, - 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c, - 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c, - 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31, - 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a, - 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f, + 0x2c, 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, + 0x3a, 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, + 0x34, 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, + 0x24, 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, + 0x2c, 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, + 0x3c, 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, + 0x31, 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, + 0x2a, 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, // Entry C0 - FF - 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c, - 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34, - 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21, - 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29, - 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31, - 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21, - 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, + 0x2f, 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, + 0x3c, 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, + 0x34, 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, + 0x21, 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, + 0x29, 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, + 0x31, 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, + 0x21, 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, // Entry 100 - 13F - 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f, - 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a, - 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f, - 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26, - 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d, - 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f, - 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d, - 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b, + 0x21, 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, + 0x2f, 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, + 0x3a, 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, + 0x2f, 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, + 0x26, 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, + 0x3d, 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, + 0x2f, 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, + 0x3d, 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, // Entry 140 - 17F - 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, + 0x3b, 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f, - 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, + 0x2f, 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, } // regionInclusionBits is an array of bit vectors where every vector represents @@ -3446,19 +3476,19 @@ var regionInclusionNext = [73]uint8{ type parentRel struct { lang uint16 - script uint8 - maxScript uint8 + script uint16 + maxScript uint16 toRegion uint16 fromRegion []uint16 } // Size: 414 bytes, 5 elements var parents = [5]parentRel{ - 0: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}}, - 1: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}}, - 2: {lang: 0x13e, script: 0x0, maxScript: 0x5a, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}}, - 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5a, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}}, - 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8d, fromRegion: []uint16{0xc6}}, + 0: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5d, 0x5e, 0x62, 0x65, 0x6e, 0x74, 0x75, 0x76, 0x7c, 0x7d, 0x80, 0x81, 0x82, 0x84, 0x8d, 0x8e, 0x97, 0x98, 0x99, 0x9a, 0x9b, 0xa0, 0xa1, 0xa5, 0xa8, 0xaa, 0xae, 0xb2, 0xb5, 0xb6, 0xc0, 0xc7, 0xcb, 0xcc, 0xcd, 0xcf, 0xd1, 0xd3, 0xd6, 0xd7, 0xde, 0xe0, 0xe1, 0xe7, 0xe8, 0xe9, 0xec, 0xf1, 0x108, 0x10a, 0x10b, 0x10c, 0x10e, 0x10f, 0x113, 0x118, 0x11c, 0x11e, 0x120, 0x126, 0x12a, 0x12d, 0x12e, 0x130, 0x132, 0x13a, 0x13d, 0x140, 0x143, 0x162, 0x163, 0x165}}, + 1: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x61, 0x64, 0x73, 0xda, 0x10d, 0x110}}, + 2: {lang: 0x13e, script: 0x0, maxScript: 0x5b, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x57, 0x5a, 0x66, 0x6a, 0x8a, 0x90, 0xd0, 0xd9, 0xe3, 0xe5, 0xed, 0xf2, 0x11b, 0x136, 0x137, 0x13c}}, + 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5b, toRegion: 0xef, fromRegion: []uint16{0x2a, 0x4e, 0x5b, 0x87, 0x8c, 0xb8, 0xc7, 0xd2, 0x119, 0x127}}, + 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8e, fromRegion: []uint16{0xc7}}, } -// Total table size 26398 bytes (25KiB); checksum: 1C859EA7 +// Total table size 30466 bytes (29KiB); checksum: 7544152B diff --git a/vendor/golang.org/x/text/language/doc.go b/vendor/golang.org/x/text/language/doc.go index 8afecd5..212b77c 100644 --- a/vendor/golang.org/x/text/language/doc.go +++ b/vendor/golang.org/x/text/language/doc.go @@ -10,18 +10,17 @@ // and provides the user with the best experience // (see https://blog.golang.org/matchlang). // -// -// Matching preferred against supported languages +// # Matching preferred against supported languages // // A Matcher for an application that supports English, Australian English, // Danish, and standard Mandarin can be created as follows: // -// var matcher = language.NewMatcher([]language.Tag{ -// language.English, // The first language is used as fallback. -// language.MustParse("en-AU"), -// language.Danish, -// language.Chinese, -// }) +// var matcher = language.NewMatcher([]language.Tag{ +// language.English, // The first language is used as fallback. +// language.MustParse("en-AU"), +// language.Danish, +// language.Chinese, +// }) // // This list of supported languages is typically implied by the languages for // which there exists translations of the user interface. @@ -30,14 +29,14 @@ // language tags. // The MatchString finds best matches for such strings: // -// handler(w http.ResponseWriter, r *http.Request) { -// lang, _ := r.Cookie("lang") -// accept := r.Header.Get("Accept-Language") -// tag, _ := language.MatchStrings(matcher, lang.String(), accept) +// handler(w http.ResponseWriter, r *http.Request) { +// lang, _ := r.Cookie("lang") +// accept := r.Header.Get("Accept-Language") +// tag, _ := language.MatchStrings(matcher, lang.String(), accept) // -// // tag should now be used for the initialization of any -// // locale-specific service. -// } +// // tag should now be used for the initialization of any +// // locale-specific service. +// } // // The Matcher's Match method can be used to match Tags directly. // @@ -48,8 +47,7 @@ // For instance, it will know that a reader of Bokmål Danish can read Norwegian // and will know that Cantonese ("yue") is a good match for "zh-HK". // -// -// Using match results +// # Using match results // // To guarantee a consistent user experience to the user it is important to // use the same language tag for the selection of any locale-specific services. @@ -58,9 +56,9 @@ // More subtly confusing is using the wrong sorting order or casing // algorithm for a certain language. // -// All the packages in x/text that provide locale-specific services -// (e.g. collate, cases) should be initialized with the tag that was -// obtained at the start of an interaction with the user. +// All the packages in x/text that provide locale-specific services +// (e.g. collate, cases) should be initialized with the tag that was +// obtained at the start of an interaction with the user. // // Note that Tag that is returned by Match and MatchString may differ from any // of the supported languages, as it may contain carried over settings from @@ -70,8 +68,7 @@ // Match and MatchString both return the index of the matched supported tag // to simplify associating such data with the matched tag. // -// -// Canonicalization +// # Canonicalization // // If one uses the Matcher to compare languages one does not need to // worry about canonicalization. @@ -92,10 +89,9 @@ // equivalence relations. The CanonType type can be used to alter the // canonicalization form. // -// References +// # References // // BCP 47 - Tags for Identifying Languages http://tools.ietf.org/html/bcp47 -// package language // import "golang.org/x/text/language" // TODO: explanation on how to match languages for your own locale-specific diff --git a/vendor/golang.org/x/text/language/go1_1.go b/vendor/golang.org/x/text/language/go1_1.go deleted file mode 100644 index c743558..0000000 --- a/vendor/golang.org/x/text/language/go1_1.go +++ /dev/null @@ -1,39 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build !go1.2 -// +build !go1.2 - -package language - -import "sort" - -func sortStable(s sort.Interface) { - ss := stableSort{ - s: s, - pos: make([]int, s.Len()), - } - for i := range ss.pos { - ss.pos[i] = i - } - sort.Sort(&ss) -} - -type stableSort struct { - s sort.Interface - pos []int -} - -func (s *stableSort) Len() int { - return len(s.pos) -} - -func (s *stableSort) Less(i, j int) bool { - return s.s.Less(i, j) || !s.s.Less(j, i) && s.pos[i] < s.pos[j] -} - -func (s *stableSort) Swap(i, j int) { - s.s.Swap(i, j) - s.pos[i], s.pos[j] = s.pos[j], s.pos[i] -} diff --git a/vendor/golang.org/x/text/language/go1_2.go b/vendor/golang.org/x/text/language/go1_2.go deleted file mode 100644 index 77aaaa2..0000000 --- a/vendor/golang.org/x/text/language/go1_2.go +++ /dev/null @@ -1,12 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build go1.2 -// +build go1.2 - -package language - -import "sort" - -var sortStable = sort.Stable diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go index 289b3a3..4d9c661 100644 --- a/vendor/golang.org/x/text/language/language.go +++ b/vendor/golang.org/x/text/language/language.go @@ -344,7 +344,7 @@ func (t Tag) Parent() Tag { return Tag(compact.Tag(t).Parent()) } -// returns token t and the rest of the string. +// nextToken returns token t and the rest of the string. func nextToken(s string) (t, tail string) { p := strings.Index(s[1:], "-") if p == -1 { diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go index f734921..ee45f49 100644 --- a/vendor/golang.org/x/text/language/match.go +++ b/vendor/golang.org/x/text/language/match.go @@ -545,7 +545,7 @@ type bestMatch struct { // match as the preferred match. // // If pin is true and have and tag are a strong match, it will henceforth only -// consider matches for this language. This corresponds to the nothing that most +// consider matches for this language. This corresponds to the idea that most // users have a strong preference for the first defined language. A user can // still prefer a second language over a dialect of the preferred language by // explicitly specifying dialects, e.g. "en, nl, en-GB". In this case pin should diff --git a/vendor/golang.org/x/text/language/parse.go b/vendor/golang.org/x/text/language/parse.go index 59b0410..4d57222 100644 --- a/vendor/golang.org/x/text/language/parse.go +++ b/vendor/golang.org/x/text/language/parse.go @@ -6,6 +6,7 @@ package language import ( "errors" + "sort" "strconv" "strings" @@ -147,6 +148,7 @@ func update(b *language.Builder, part ...interface{}) (err error) { } var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight") +var errTagListTooLarge = errors.New("tag list exceeds max length") // ParseAcceptLanguage parses the contents of an Accept-Language header as // defined in http://www.ietf.org/rfc/rfc2616.txt and returns a list of Tags and @@ -164,6 +166,10 @@ func ParseAcceptLanguage(s string) (tag []Tag, q []float32, err error) { } }() + if strings.Count(s, "-") > 1000 { + return nil, nil, errTagListTooLarge + } + var entry string for s != "" { if entry, s = split(s, ','); entry == "" { @@ -201,7 +207,7 @@ func ParseAcceptLanguage(s string) (tag []Tag, q []float32, err error) { tag = append(tag, t) q = append(q, float32(w)) } - sortStable(&tagSort{tag, q}) + sort.Stable(&tagSort{tag, q}) return tag, q, nil } diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go index 96b57f6..a6573dc 100644 --- a/vendor/golang.org/x/text/language/tables.go +++ b/vendor/golang.org/x/text/language/tables.go @@ -23,31 +23,31 @@ const ( _419 = 31 _BR = 65 _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 ) const ( - _Latn = 90 + _Latn = 91 _Hani = 57 _Hans = 59 _Hant = 60 - _Qaaa = 143 - _Qaai = 151 - _Qabx = 192 - _Zinh = 245 - _Zyyy = 250 - _Zzzz = 251 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 ) -var regionToGroups = []uint8{ // 358 elements +var regionToGroups = []uint8{ // 359 elements // Entry 0 - 3F 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, @@ -60,51 +60,51 @@ var regionToGroups = []uint8{ // 358 elements // Entry 40 - 7F 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08, - 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, + 0x08, 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, // Entry 80 - BF - 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, - 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, + 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, // Entry C0 - FF - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01, - 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, + 0x01, 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 100 - 13F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, - 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, // Entry 140 - 17F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, -} // Size: 382 bytes + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, +} // Size: 383 bytes var paradigmLocales = [][3]uint16{ // 3 elements - 0: [3]uint16{0x139, 0x0, 0x7b}, + 0: [3]uint16{0x139, 0x0, 0x7c}, 1: [3]uint16{0x13e, 0x0, 0x1f}, - 2: [3]uint16{0x3c0, 0x41, 0xee}, + 2: [3]uint16{0x3c0, 0x41, 0xef}, } // Size: 42 bytes type mutualIntelligibility struct { @@ -249,30 +249,30 @@ var matchLang = []mutualIntelligibility{ // 113 elements // matchScript holds pairs of scriptIDs where readers of one script // can typically also read the other. Each is associated with a confidence. var matchScript = []scriptIntelligibility{ // 26 elements - 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5a, haveScript: 0x20, distance: 0x5}, - 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5a, distance: 0x5}, - 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5a, distance: 0xa}, + 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5b, haveScript: 0x20, distance: 0x5}, + 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5b, distance: 0x5}, + 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5b, distance: 0xa}, 4: {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x20, distance: 0xa}, - 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5a, distance: 0xa}, - 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4e, haveScript: 0x5a, distance: 0xa}, - 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x52, haveScript: 0x5a, distance: 0xa}, - 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x57, haveScript: 0x5a, distance: 0xa}, - 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6e, haveScript: 0x5a, distance: 0xa}, - 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x75, haveScript: 0x5a, distance: 0xa}, - 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5a, distance: 0xa}, - 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x81, haveScript: 0x5a, distance: 0xa}, - 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5a, distance: 0xa}, - 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xcf, haveScript: 0x5a, distance: 0xa}, - 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xde, haveScript: 0x5a, distance: 0xa}, - 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe1, haveScript: 0x5a, distance: 0xa}, - 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5a, distance: 0xa}, - 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5a, distance: 0xa}, + 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5b, distance: 0xa}, + 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4f, haveScript: 0x5b, distance: 0xa}, + 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x53, haveScript: 0x5b, distance: 0xa}, + 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x58, haveScript: 0x5b, distance: 0xa}, + 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6f, haveScript: 0x5b, distance: 0xa}, + 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x76, haveScript: 0x5b, distance: 0xa}, + 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5b, distance: 0xa}, + 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x83, haveScript: 0x5b, distance: 0xa}, + 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5b, distance: 0xa}, + 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd6, haveScript: 0x5b, distance: 0xa}, + 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5b, distance: 0xa}, + 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe9, haveScript: 0x5b, distance: 0xa}, + 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5b, distance: 0xa}, + 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5b, distance: 0xa}, 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3b, haveScript: 0x3c, distance: 0xf}, 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3c, haveScript: 0x3b, distance: 0x13}, } // Size: 232 bytes @@ -295,4 +295,4 @@ var matchRegion = []regionIntelligibility{ // 15 elements 14: {lang: 0x529, script: 0x3c, group: 0x80, distance: 0x5}, } // Size: 114 bytes -// Total table size 1472 bytes (1KiB); checksum: F86C669 +// Total table size 1473 bytes (1KiB); checksum: 7BB90B5C diff --git a/vendor/modules.txt b/vendor/modules.txt index 5e90f86..2cce706 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -1,7 +1,7 @@ # github.com/GeertJohan/go.incremental v1.0.0 ## explicit; go 1.12 github.com/GeertJohan/go.incremental -# github.com/GeertJohan/go.rice v1.0.2 +# github.com/GeertJohan/go.rice v1.0.3 ## explicit; go 1.12 github.com/GeertJohan/go.rice github.com/GeertJohan/go.rice/embedded @@ -13,10 +13,10 @@ github.com/akavel/rsrc/coff # github.com/cloudfoundry/jibber_jabber v0.0.0-20151120183258-bcc4c8345a21 ## explicit github.com/cloudfoundry/jibber_jabber -# github.com/daaku/go.zipexe v1.0.0 -## explicit; go 1.12 +# github.com/daaku/go.zipexe v1.0.2 +## explicit; go 1.11 github.com/daaku/go.zipexe -# github.com/gotk3/gotk3 v0.6.1 +# github.com/gotk3/gotk3 v0.6.2 ## explicit; go 1.14 github.com/gotk3/gotk3/cairo github.com/gotk3/gotk3/gdk @@ -34,7 +34,7 @@ github.com/jessevdk/go-flags github.com/nkovacs/streamquote # github.com/onsi/ginkgo v1.16.5 ## explicit; go 1.16 -# github.com/onsi/gomega v1.20.0 +# github.com/onsi/gomega v1.27.8 ## explicit; go 1.18 # github.com/valyala/bytebufferpool v1.0.0 ## explicit @@ -42,12 +42,12 @@ github.com/valyala/bytebufferpool # github.com/valyala/fasttemplate v1.0.1 ## explicit github.com/valyala/fasttemplate -# golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f +# golang.org/x/sys v0.10.0 ## explicit; go 1.17 golang.org/x/sys/internal/unsafeheader golang.org/x/sys/unix golang.org/x/sys/windows -# golang.org/x/text v0.3.7 +# golang.org/x/text v0.11.0 ## explicit; go 1.17 golang.org/x/text/internal/language golang.org/x/text/internal/language/compact