-
Notifications
You must be signed in to change notification settings - Fork 2
Membrane helix prediction with SVMs
License
psipred/MemSatSVM
This commit does not belong to any branch on this repository, and may belong to a fork outside of the repository.
Folders and files
Name | Name | Last commit message | Last commit date | |
---|---|---|---|---|
Repository files navigation
MEMSAT-SVM Usage Notes ====================== Program and documentation is Copyright (C) 2008 David T. Jones and Timothy Nugent, all rights reserved. All Trademarks and Registered Names are acknowledged in this document. THIS SOFTWARE MAY ONLY BE USED FOR NON-COMMERCIAL PURPOSES. PLEASE CONTACT THE AUTHOR IF YOU REQUIRE A LICENSE FOR COMMERCIAL USE. Pre-Compilation =============== You first need to get the large model files from our download site and unpack them to a models/ directory. From the root dir of your memsatsvm installation wget http://bioinfadmin.cs.ucl.ac.uk/downloads/memsat-svm/models.tar.gz tar -zxvf models.tar.gz Compiling MEMSAT-SVM ==================== C and C++ compilers differ from system to system. However on a standard Unix or Linux system, MEMSAT-SVM can be compiled simply with: make A copy of SVM Light is included; the executable will be placed in the bin folder where the run_memsat-svm.pl expects to find it. Full details of SVM light, including the licence, can be found at: http://svmlight.joachims.org/ To produce graphical representations of topology, the GD library and the perl GD module must be installed. The GD library should be present on most modern Linux distributions. The perl GD module can usually be installed by running the following command as root: cpan -i GD Configuring MEMSAT-SVM ====================== Importantly, a few paths need to be set before using MEMSAT-SVM: see the comments on top of script "run_memsat-svm.pl" and set variables accordingly. In particular, the absolute path to the Perl library needs to be set. Also, the path to this directory, to the NCBI binary directory and to a database for PSI-BLAST searches must be set. my $mem_dir = '........'; # directory where "run_memsat-svm.pl" can be found . . . my $ncbidir = '........'; # where blastpgp and makemat are found my $dbname = '........'; # e.g. swissprot.fa, which has been formatdb'ed You can also pass these last 3 values using the following paramaters: ./run_memsat-svm.pl -w /path/to/memsat-svm/ -n /usr/local/blast/bin/ -d swissprot.fa fasta.fa If the NCBI directory is not specified, the script will try to find it using 'locate blastpgp'. Finally, note that MEMSAT-SVM writes several temporary files (these will be erased if flag '-e 1' is used), some of them inside the "input" folder, some inside the "output" folder where the results are saved as well. Default folders are present; however, when running several similar sequences at the same time, it is wise to specify sequence-specific input and output folders by means of flags '-i' and '-j', in order to avoid clashes due to identical temporary file names. Try "./run_memsat-svm.pl" or "./run_memsat-svm.pl -h" for help on all available flags. Ubuntu Configuration ==================== The ./run_memsat-svm.pl uses bash instead of Ubuntu's dash shell. You'll have to change it like this: sudo ln -sf /bin/bash /bin/sh Running MEMSAT-SVM ================== To run MEMSAT-SVM using fasta files: ./run_memsat-svm.pl examples/*fa This will call PSI-BLAST in order to generate matrix files. If you have already generated these, you can pass the -mtx flag to skip the PSI-BLAST step: ./run_memsat-svm.pl -mtx 1 examples/*mtx To perform a constrained prediction, Pass a constraints file as an argument. This should have the same name as the fasta file but with a .constraints suffix. You can still process multiple files at once; the constraints file will be matched to the corresponding fasta or matrix file: ./run_memsat-svm.pl -mtx 1 examples/1R3J_C.constraints examples/1R3J_C.mtx The constraints file should have the following format, where s,o,m,i are signal peptide, outside loop, membrane and inside loop: s: 1-15 o: 1-30 m: 37-59,82-100 i: 65,80,220-230 To run globmem-svm - in order to discriminate between globular and transmembrane proteins - pass the -p flag: ./run_memsat-svm.pl -mtx 1 -p 1 examples/*mtx Below is a full list of command line paramaters: -p <0|1|2> Programs to run. memsat-svm predicts topology, globmem-svm discriminates between transmembrane and globular proteins. Default 0. 0 = Run memsat-svm 1 = Run memsat-svm and globmem-svm 2 = run globmem-svm -mtx <1|0> Process PSI-BLAST .mtx files instead of fasta files. Default 0. -n <directory> NCBI binary directory (location of blastpgp and makemat) -d <path> Database for running PSI-BLAST. -e <0|1> Erase intermediate files. Default 0. -g <0|1> Draw topology schematic and cartoon. Default 1. -m <int> Minimum score for a transmembrane helix. Default: 220000 -r <int> Minimum score for a re-entrant helix. Default: 178000 -h <0|1> Show help. Default 0. Example Results =============== In this example MEMSAT-SVM is used to predict the secondary structure and topology of Potassium channel KcsA. The input file (in FASTA format) is as follows: >1M57_H MRHSTTLTGCATGAAGLLAATAAAAQQQSLEIIGRPQPGGTGFQPSASPVATQIHWLDGFILVIIAAITIFVTL LILYAVWRFHEKRNKVPARFTHNSPLEIAWTIVPIVILVAIGAFSLPVLFNQQEIPEADVTVKVTGYQWYWGYE YPDEEISFESYMIGSPATGGDNRMSPEVEQQLIEAGYSRDEFLLATDTAMVVPVNKTVVVQVTGADVIHSWTVP AFGVKQDAVPGRLAQLWFRAEREGIFFGQCSELCGISHAYMPITVKVVSEEAYAAWLEQARGGTYELSSVLPAT PAGVSVE ./run_memsat-svm.pl -p 1 examples/1M57_H.fa The following output is produced by the run_memsat-svm.pl script (note the paths to the NCBI directory and database will vary): MEMSAT-SVM: Alpha-helical transmembrane protein topology prediction using Support Vector Machines Running PSI-BLAST: examples/1M57_H.fa /usr/local/blast/bin/blastpgp -a 1 -j 2 -h 1e-3 -e 1e-3 -b 0 -d databases/uniprot_sprot -i memsat-svm_tmp.fasta -C memsat-svm_tmp.chk >& memsat-svm_tmp.out Generating SVM input files... Running svm_classify... bin/svm_classify -v 0 input/1M57_H_w33_GM.input models/MEMSAT-SVM_w33_GM.model output/1M57_H_SVM_w33_GM.prediction bin/svm_classify -v 0 input/1M57_H_w35_TM.input models/MEMSAT-SVM_w35_IO.model output/1M57_H_SVM_w35_IO.prediction bin/svm_classify -v 0 input/1M57_H_w33_TM.input models/MEMSAT-SVM_w33_HL.model output/1M57_H_SVM_w33_HL.prediction bin/svm_classify -v 0 input/1M57_H_w27_TM.input models/MEMSAT-SVM_w27_SP.model output/1M57_H_SVM_w27_SP.prediction bin/svm_classify -v 0 input/1M57_H_w27_TM.input models/MEMSAT-SVM_w27_RE.model output/1M57_H_SVM_w27_RE.prediction Parsing SVM output files... Running GLOBMEM-SVM... Running MEMSAT-SVM... bin/memsat-svm -m 220 -r 178 -f 1 output/1M57_H_SVM_ALL.out > output/1M57_H.memsat_svm Written file output/1M57_H.memsat_svm Written file output/1M57_H_schematic.png Written file output/1M57_H_cartoon_memsat_svm_.png Written file output/1M57_H.globmem_svm DISCRIMINATING TRANSMEMBRANE PROTEINS FROM GLOBULAR =================================================== The contents of 1M57_H.globmem_svm shows that the sequence is predicted to be a transmembrane protein, with 49 residues predicted to lie within the membrane: Transmembrane residues found: 45 Transmembrane score: 74.545051921 This looks like a transmembrane protein. TOPOLOGY PREDICTION =================== The contents of 1M57_H.memsat_svm is as follows: ... Processing 1 helix: Transmembrane helix 1 from 60 (in) to 81 (out) : 3903.24 Score = 3.772554 Processing 1 helix: Transmembrane helix 1 from 60 (out) to 81 (in) : 3940.16 Score = 4.070846 ... Processing 5 helices: Transmembrane helix 1 from 19 (in) to 34 (out) : -445.657 Transmembrane helix 2 from 60 (out) to 81 (in) : 3940.16 Transmembrane helix 3 from 99 (in) to 119 (out) : 3253.82 Transmembrane helix 4 from 193 (out) to 208 (in) : -506.732 Transmembrane helix 5 from 250 (in) to 265 (out) : -565.749 Score = -100000.000000 Processing 4 helices: Transmembrane helix 1 from 60 (out) to 81 (in) : 3940.16 Transmembrane helix 2 from 99 (in) to 119 (out) : 3253.82 Transmembrane helix 3 from 193 (out) to 208 (in) : -506.732 Transmembrane helix 4 from 250 (in) to 265 (out) : -565.749 Score = -100000.000000 Processing 3 helices: Transmembrane helix 1 from 19 (in) to 34 (out) : -445.657 Transmembrane helix 2 from 60 (out) to 81 (in) : 3940.16 Transmembrane helix 3 from 99 (in) to 119 (out) : 3253.82 Score = -100000.000000 Processing 2 helices: Transmembrane helix 1 from 60 (out) to 81 (in) : 3940.16 Transmembrane helix 2 from 99 (in) to 119 (out) : 3253.82 Score = 7.337172 .... Processing 5 helices: Transmembrane helix 1 from 60 (out) to 81 (in) : 3940.16 Transmembrane helix 2 from 99 (in) to 119 (out) : 3253.82 Transmembrane helix 3 from 190 (out) to 205 (in) : -519.582 Transmembrane helix 4 from 209 (in) to 224 (out) : -569.823 Transmembrane helix 5 from 253 (out) to 268 (in) : -559.528 Score = -100000.000000 Processing 4 helices: Transmembrane helix 1 from 19 (in) to 34 (out) : -445.657 Transmembrane helix 2 from 60 (out) to 81 (in) : 3940.16 Transmembrane helix 3 from 99 (in) to 119 (out) : 3253.82 Transmembrane helix 4 from 193 (out) to 208 (in) : -506.732 Score = -100000.000000 Processing 3 helices: Transmembrane helix 1 from 60 (out) to 81 (in) : 3940.16 Transmembrane helix 2 from 99 (in) to 119 (out) : 3253.82 Transmembrane helix 3 from 193 (out) to 208 (in) : -506.732 Score = -100000.000000 Processing 2 helices: Transmembrane helix 1 from 60 (in) to 81 (out) : 3903.24 Transmembrane helix 2 from 99 (out) to 119 (in) : 3250.58 Score = 7.010628 Summary of topology analysis: 1 helix (+) : Score = 3.77255 1 helix (-) : Score = 4.07085 2 helices (+) : Score = 7.01063 2 helices (-) : Score = 7.33717 3 helices (+) : Score = -100000 3 helices (-) : Score = -100000 4 helices (+) : Score = -100000 4 helices (-) : Score = -100000 5 helices (+) : Score = -100000 5 helices (-) : Score = -100000 ... Results: Signal peptide: 1-13 Signal score: 22.738 Topology: 60-81,99-119 Re-entrant helices: Not detected. Helix count: 2 N-terminal: out Score: 7.33717 All the possible topologies, and associated scores, are listed from the top of the file. At the bottom is a summary. Topologies with weakly predicted helices will be scored down (to -100000), as will topologies that do not fit constraints when a constrained prediction is made. The highest scoring topology is returned at the bottom; in this case a 2 helix prediction with the N-terminal outside, and a predicted signal peptide. The larger the difference in score between the highest and second highest scoring topologies, the greater the prediction confidence.This topology is illustrated in the files 1M57_H_schematic.png 1M57_H_cartoon_memsat_svm.png. A signal peptide score about 8.5 will force the N-terminal to be extracellular and will results in prediction of a signal peptide, regardless of the prior topology prediction. Please note that the maximum sequence length is currently set to 4000 residues, as sequences longer than this are likely to be multi-domain proteins. The maximum number of helices that can be predicted is currently set to 25. Both these values can be modified by changing the values MAXSEQLEN and MAXNHEL at the top of the memsat-svm.cpp file. However, the program was benchmarked with the default settings so prediction accuracy may vary if you adjust these values. FINALLY ======= If you need assistance in getting MEMSAT-SVM working, or if you find any bugs, please contact the author at the following e-mail address: Timothy Nugent E-mail: [email protected] Bioinformatics Unit Dept. of Computer Science University College Gower Street London WC1E 6BT
About
Membrane helix prediction with SVMs
Topics
Resources
License
Stars
Watchers
Forks
Packages 0
No packages published