A module for parameter estimation in partial differential equations (PDEs) using the Differential Evolution (DE) algorithm.
python 3.xnumpypandasscipyscikit-learntqdm>=4.29.0matplotlib(plots only)seaborn(plots only)- LaTeX (plots only)
The module consists of a constructor that prepares the data and the model to be fit, along with a series of routines to find the best fit parameters, compute likelihood profiles and perform bootstrapping, as well as visualising the results.
The main component of the module, it is initialised as
import PDEparams as pde
my_object = pde.PDEmodel(data, model, initfunc, bounds, param_names=None, nvars=1,
ndims=1, nreplicates=1, obsidx=None, outfunc=None)The data is assumed to be in the form of a pandas DataFrame. You can
construct a DataFrame directly from file as, e.g.,
import pandas as pd
data = pd.read_csv('data_file.csv')
# or
data = pd.read_excel('data_file.xlsx')Refer to the pandas
documentation
for details. Another, not recommended, way of constructing the
DataFrame is to manually input the values:
data_values = [[t0, x0, f(t0,x0)], [t0, x1, f(t0,x1)], ..., [t1, x0, f(t1,x0)], [t1, x1, f(t1,x1)], ...]
data = pd.DataFrame(data_values)The data should be structured so that the first column corresponds to
the timepoints, followed by the spatial coordinates and the outputs. For
instance, the data for a two-dimensional system with coordinates
and two variables,
and
, will have the form
* Note the order in which the spatial coordinates are entered in the
data. The index of the right-most coordinate runs first; e.g., for a
3D system, after
,
should follow.
** The name of the columns is not important,
the dimensionality of the system is defined by the user with the
arguments noutputs and ndims (see below).
If more than one measurement per space-time coordinate exists, they should be entered consecutively, as in
We refer to these as ‘replicates’. The number of replicates is
controlled by the parameter nreplicates (see below). If you have one
data file per replicate—let us say 3 different .csv files—you can
merge them with
data_1 = pd.read_csv('data_1.csv')
data_2 = pd.read_csv('data_2.csv')
data_3 = pd.read_csv('data_3.csv')
data = data_1.append([data_2, data_3], ignore_index=False).sort_index().reset_index(drop=True)This will result in a DataFrame where the first 3 rows correspond to
the first row of each of the data files, and so on, as in the picture
above.
This is the PDE or system of PDEs that fits the data. It should be defined as a function of the initial condition, the time domain, the spatial grid, and the parameters to be estimated, and it should return the time derivative of the variables in the system. It would look like this:
def my_pde(initial_condition, time_domain, spatial_grid, parameter_1, parameter_2, ...):
variables = ... # preprocessing of initial condition
dobs_dt = ... # the equation for the time derivative
dobs_dt[boundaries] = ... # boundary conditions
output = ... # postprocessing of dobs_dt
return outputThe preprocessing step mentioned above corresponds to retrieving the
actual shape of the system given the input: the integration is handled
using scipy’s odeint, which only accepts one-dimensional inputs. If
we imagine a system of 2 equations in 1 spatial dimension, we need to
feed the initial condition for both variables as one long array, instead
of two arrays. The preprocessing step then retrieves these two original
arrays; after the time derivative is calculated for both variables, the
postprocessing converts the two derivatives into one long derivative.
While more convoluted, the idea is the same for a larger number of
spatial dimensions.
The module takes care of feeding the model the correct one-dimensional input regardless of the actual dimensionality of the problem. The preprocessing inside the model needs to be hardcoded, but full illustrations appear in the examples directory.
Note that the module also works for ODEs—see details below and in the
examples directory. In this case, the definition of the
system should not include the spatial_grid argument.
This is the initial condition generator. Each of the variables in the system will have an initial condition that is a function of the spatial grid, as in
def initial_f(grid_point):
...
def initial_g(grid_point):
...initfunc should be a list comprising those functions:
initfunc = [initial_f, initial_g]See more details in the examples directory.
For ODEs, the initial condition should still be defined as a function for each of the variables in the system.
The optimisation performed by DE is constrained and, therefore, bounds for the parameter values must be provided. These should be in the form of a tuple of tuples or list of tuples.
bounds = ((lower_1, upper_1), (lower_2, upper_2) ...)
# or
bounds = [(lower_1, upper_1), (lower_2, upper_2) ...]List of parameter names, for use in plots and output tables. If not
specified, they will be called 'parameter_1', 'parameter_2', etc.
The number of variables in the system of equations. If not specified, it is assumed to be 1.
The number of spatial coordinates in the data—ndims=0 for ODEs. If not
specified, it is assumed to be 1.
The number of measurements per space-time coordinate in the data. If not specified, it is assumed to be 1.
In the case when not all variables in the system are actually observed,
we need to specify for which of them we have data. obsidx is a list of
indices, starting from zero, corresponding to the position of the
observed variables in the model we have defined. For instance, if we
have a three-dimensional state vector with data for the second and third
variables, we should pass
obsidx=[1,2]If only one variable is observed, obsidx can be either an integer or a
list of one integer. In the case above, if we now have data only for the
third variable:
obsidx=2
# or
obsidx=[2]obsidx defaults to None, meaning that all variables are measured.
Sometimes we do not have data for the raw variables in the system but
rather a function of them. This is specified by outfunc, which
defaults to None, meaning we have data for the raw outputs. For
instance, if we can only measure the square of the third variable in a
three-dimensional system, we should define
def outfunc(state_vector):
x, y, z = state_vector
return z**2and pass this argument to the PDEmodel constructor.
Note that, if outfunc is specified, the argument obsidx is
overridden. The function is always a function of the full state vector,
even if the actual measured quantity only involves a few of the
variables, as shown above.
Upon construction, the initial condition functions are applied to the
spatial grid and stored in the attribute initial_condition—for the
example above, this can be retrieved by calling
my_object.initial_condition. As a sanity check, it may be helpful to
plot this initial condition; this is not part of the module, but the
examples directory contains some visualisation code.
Additionally, the time-step between the first and second datapoints is
obtained, and an array of timepoints is constructed starting from
and ending at
the first datapoint, using this time-step. This is prepended to the
timepoints in the data and stored as the attribute
time.
Other attributes include: - model - data - nvars - spacedims:
the value of ndims in the input - nparams: the number of parameters
space: the spatial grid
The optimisation is carried out by calling
my_object.fit()If no argument is given, the cost function to minimise will be the mean
squared error. For other cost functions, you need to provide the error
argument; for instance, for the root mean squared error:
my_object.fit(error='rmse')Possible choices for error are:
'mse': mean squared error'rmse': root mean squared error'msle': mean squared logarithmic error'rmsle': root mean squared logarithmic error'mae': mean absolute error'medae': median absolute error
The results are displayed on screen and stored in the attribute
best_params, while the optimum value of the cost function is stored in
the attribute best_error.
Likelihood profiles are computed for each parameter by fixing its value and refitting the rest of the parameters. This is done using
my_object.likelihood_profiles()A list of parameter values to try can be explicitly given for each parameter in the model, using the optional argument param_values—this should be a list of lists or a list of arrays, and its size must coincide with the number of parameters. For instance, in oder to use the values [1,2,3] for the first and [4,5,6] for the second parameter in a model with two parameters, use
my_object.likelihood_profiles(param_values=[[1,2,3], [4,5,6]])If no explicit values are provided, the likelihood profiles will be computed using a regular grid within the parameter bounds for each parameter. There is a second optional argument, npoints, that controls the number of points to use in the grid. If no argument is given, a regular grid of 100 points will be used per parameter. For, e.g., 250 points per parameter, use
my_object.likelihood_profiles(npoints=250)The full results are stored as a DataFrame in the form
and can be retrieved with my_object.likelihood_profiles
For a quick look at the profiles, use
my_object.plot_profiles()You should see something like this:
If the best fit parameters have already been obtained via the fit()
function, the cost function to be used for the likelihood profiles will
match the original cost function—additionally, the best fit parameters
will be highlighted in the plots. If not, the likelihood profiles will
be computed with the default mean squared error.
Bootstrapping is carried out by randomly choosing one replicate per spatio-temporal coordinate and refitting all parameters in multiple rounds. Done using
my_object.bootstrap()If no argument is given, the process is repeated 100 times. For other
configurations, use the optional nruns argument; e.g.,
my_object.bootstrap(nruns=250)A summary of the results is displayed on screen and stored as a
DataFrame in the attribute bootstrap_summary, while the full results
are stored as a DataFrame in the attribute bootstrap_raw.
Respectively,
Summary:
Full:
For a quick look at the results, use
my_object.plot_bootstrap()You should see something like this:
If the best fit parameters have already been obtained via the fit()
function, the cost function to be used for bootstrapping will match the
original cost function—additionally, the best fit parameters will be
highlighted in the plots. If not, the default mean squared error will be
used.
R. Storn, and K. Price. “Differential evolution–a simple and efficient heuristic for global optimization over continuous spaces”, Journal of Global Optimization 11(4), pp. 341-359 (1997).
A. Raue, C. Kreutz, T. Maiwald, J. Bachmann, M. Schilling, U. Klingmüller, and J. Timmer. “Structural and practical identifiability analysis of partially observed dynamical models by exploiting the profile likelihood”, Bioinformatics 25(15), pp. 1923-1929 (2009).






